--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -647.82 -660.96
2 -647.93 -665.33
--------------------------------------
TOTAL -647.87 -664.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.094619 0.000665 0.050248 0.148044 0.091328 1421.47 1441.77 1.000
r(A<->C){all} 0.105840 0.003778 0.008375 0.228855 0.094510 316.81 425.09 1.000
r(A<->G){all} 0.172186 0.006908 0.032141 0.335241 0.159813 318.51 361.90 1.000
r(A<->T){all} 0.080640 0.002776 0.001671 0.178999 0.071481 327.85 469.68 1.001
r(C<->G){all} 0.039367 0.001549 0.000008 0.119285 0.027322 349.85 497.00 1.001
r(C<->T){all} 0.505276 0.010267 0.310899 0.698400 0.505749 446.42 470.40 1.000
r(G<->T){all} 0.096691 0.003135 0.005646 0.203415 0.087039 462.70 479.18 1.002
pi(A){all} 0.241701 0.000468 0.199043 0.283782 0.241689 1119.63 1226.01 1.000
pi(C){all} 0.250569 0.000503 0.208812 0.296062 0.249816 1173.45 1223.01 1.001
pi(G){all} 0.192929 0.000398 0.155918 0.233177 0.192453 1288.05 1294.35 1.000
pi(T){all} 0.314801 0.000550 0.271634 0.361426 0.313900 1199.69 1217.12 1.000
alpha{1,2} 0.600158 0.564324 0.000015 2.072402 0.337430 1044.67 1169.53 1.000
alpha{3} 1.197001 1.047704 0.000705 3.243417 0.934710 925.73 1004.67 1.000
pinvar{all} 0.572390 0.037415 0.169863 0.876821 0.605757 745.32 758.27 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=121
C1 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
C2 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
C3 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
C4 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C6 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C7 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C8 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C9 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
C1 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C2 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C3 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C4 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C6 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C7 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C8 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C9 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
C1 SYDTSDPQLLSDIGYSFDYGK
C2 SYDTSDPQLLSDIGYSFDYGK
C3 SYDTSDPQQLSDIGYSFDYGK
C4 SYDTSDPQLLSDIGYSFDYGK
C5 SYDTSDPQLLSDIGYSFDYGK
C6 SYDTSDPQLLSDIGYSFDYGK
C7 SYDTSDPQLLSDIGYSFDYGK
C8 SYDNSDPQSLSDIGYSFDYGK
C9 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
-- Starting log on Tue Oct 25 21:15:30 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=999, Nseq=9, Len=121
C1 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
C2 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
C3 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
C4 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C6 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C7 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C8 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C9 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
C1 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C2 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C3 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C4 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C6 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C7 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C8 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C9 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
C1 SYDTSDPQLLSDIGYSFDYGK
C2 SYDTSDPQLLSDIGYSFDYGK
C3 SYDTSDPQQLSDIGYSFDYGK
C4 SYDTSDPQLLSDIGYSFDYGK
C5 SYDTSDPQLLSDIGYSFDYGK
C6 SYDTSDPQLLSDIGYSFDYGK
C7 SYDTSDPQLLSDIGYSFDYGK
C8 SYDNSDPQSLSDIGYSFDYGK
C9 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
-- Starting log on Tue Oct 25 21:14:53 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=121
C1 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
C2 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
C3 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
C4 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C6 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C7 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
C8 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
C9 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
C1 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C2 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C3 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C4 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C6 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C7 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C8 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
C9 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
C1 SYDTSDPQLLSDIGYSFDYGK
C2 SYDTSDPQLLSDIGYSFDYGK
C3 SYDTSDPQQLSDIGYSFDYGK
C4 SYDTSDPQLLSDIGYSFDYGK
C5 SYDTSDPQLLSDIGYSFDYGK
C6 SYDTSDPQLLSDIGYSFDYGK
C7 SYDTSDPQLLSDIGYSFDYGK
C8 SYDNSDPQSLSDIGYSFDYGK
C9 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
-- Starting log on Tue Oct 25 21:27:27 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/gapped_alignment/fubar,TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 9 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666733252
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1026626449
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4389161250
Seed = 357394729
Swapseed = 1666733252
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 20 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -736.532104 -- 32.479477
Chain 2 -- -741.079683 -- 32.479477
Chain 3 -- -739.823135 -- 32.479477
Chain 4 -- -742.255956 -- 32.479477
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -737.265244 -- 32.479477
Chain 2 -- -736.859926 -- 32.479477
Chain 3 -- -733.225374 -- 32.479477
Chain 4 -- -740.527374 -- 32.479477
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-736.532] (-741.080) (-739.823) (-742.256) * [-737.265] (-736.860) (-733.225) (-740.527)
1000 -- (-671.536) [-663.299] (-662.306) (-658.424) * (-660.936) (-665.262) [-654.433] (-658.861) -- 0:00:00
2000 -- (-663.555) (-659.442) (-659.635) [-655.398] * (-662.800) (-656.753) [-659.575] (-660.897) -- 0:00:00
3000 -- (-662.286) (-661.901) [-653.758] (-655.445) * [-654.070] (-665.058) (-658.290) (-659.325) -- 0:00:00
4000 -- (-656.173) (-654.846) [-652.782] (-657.655) * [-658.626] (-660.912) (-657.697) (-661.166) -- 0:04:09
5000 -- (-655.090) [-659.659] (-662.958) (-663.891) * (-658.066) (-663.477) [-659.555] (-655.841) -- 0:03:19
Average standard deviation of split frequencies: 0.096027
6000 -- (-656.130) (-651.422) [-651.752] (-655.666) * [-655.892] (-658.434) (-656.673) (-658.180) -- 0:02:45
7000 -- (-657.313) (-650.930) [-652.898] (-662.437) * [-652.193] (-663.218) (-661.956) (-659.464) -- 0:02:21
8000 -- (-649.524) [-657.092] (-657.084) (-665.116) * (-653.270) (-665.701) [-651.488] (-654.580) -- 0:02:04
9000 -- [-652.445] (-651.980) (-660.140) (-661.188) * (-660.803) (-657.257) (-659.499) [-654.153] -- 0:03:40
10000 -- (-666.940) [-649.893] (-663.992) (-654.799) * (-673.497) (-661.969) (-656.959) [-656.572] -- 0:03:18
Average standard deviation of split frequencies: 0.065529
11000 -- (-657.916) (-660.760) (-653.478) [-656.161] * (-653.804) [-652.161] (-674.974) (-660.275) -- 0:02:59
12000 -- (-657.211) (-656.219) (-678.836) [-649.405] * [-650.834] (-652.976) (-657.982) (-661.033) -- 0:02:44
13000 -- [-653.729] (-660.927) (-671.314) (-655.145) * (-655.062) (-653.894) (-662.960) [-654.928] -- 0:02:31
14000 -- (-654.089) (-656.326) [-648.033] (-654.098) * (-649.614) [-652.580] (-659.510) (-649.899) -- 0:03:31
15000 -- (-659.450) (-659.746) (-652.177) [-648.205] * [-652.141] (-656.546) (-662.035) (-654.086) -- 0:03:17
Average standard deviation of split frequencies: 0.066961
16000 -- (-657.337) (-660.598) [-656.005] (-650.770) * (-655.286) (-654.677) (-651.784) [-652.370] -- 0:03:04
17000 -- (-666.364) [-651.223] (-653.257) (-658.029) * (-667.917) (-659.687) [-656.538] (-659.614) -- 0:02:53
18000 -- (-654.672) [-657.266] (-653.050) (-647.528) * (-651.917) [-650.719] (-653.000) (-650.651) -- 0:03:38
19000 -- (-656.925) (-655.781) [-654.123] (-657.506) * (-656.319) (-655.869) (-657.470) [-651.812] -- 0:03:26
20000 -- (-653.306) (-668.253) [-649.953] (-657.168) * (-656.713) (-645.902) (-666.137) [-652.956] -- 0:03:16
Average standard deviation of split frequencies: 0.052463
21000 -- (-658.258) (-659.601) [-649.774] (-656.153) * (-661.230) [-657.709] (-656.517) (-658.944) -- 0:03:06
22000 -- (-653.148) (-653.690) [-649.055] (-657.654) * (-667.547) (-660.643) (-650.254) [-652.098] -- 0:03:42
23000 -- (-654.883) (-647.625) (-655.794) [-647.613] * (-648.775) (-657.392) [-649.835] (-658.863) -- 0:03:32
24000 -- (-658.316) [-650.830] (-663.821) (-652.603) * (-663.982) [-655.478] (-653.220) (-673.619) -- 0:03:23
25000 -- (-659.014) (-651.940) (-653.893) [-655.817] * (-653.541) (-651.863) [-656.503] (-658.821) -- 0:03:15
Average standard deviation of split frequencies: 0.035438
26000 -- (-656.941) (-650.130) (-653.679) [-649.797] * (-653.343) (-661.643) (-651.825) [-653.972] -- 0:03:07
27000 -- [-649.771] (-653.834) (-654.737) (-647.072) * (-662.337) (-650.650) (-653.568) [-648.490] -- 0:03:36
28000 -- [-658.139] (-656.084) (-656.372) (-652.232) * (-652.468) (-657.087) (-658.432) [-658.968] -- 0:03:28
29000 -- (-652.807) (-651.636) (-650.701) [-648.521] * [-652.586] (-653.783) (-651.282) (-648.922) -- 0:03:20
30000 -- [-654.723] (-658.981) (-652.985) (-654.069) * (-658.499) (-651.871) [-647.266] (-655.055) -- 0:03:14
Average standard deviation of split frequencies: 0.038064
31000 -- (-647.320) (-659.634) (-651.634) [-651.882] * (-655.471) (-651.589) [-652.415] (-654.523) -- 0:03:38
32000 -- [-650.134] (-657.130) (-647.520) (-665.463) * (-660.982) [-657.387] (-652.593) (-659.681) -- 0:03:31
33000 -- (-651.224) [-651.895] (-657.067) (-653.176) * (-652.742) [-656.163] (-662.925) (-654.991) -- 0:03:25
34000 -- [-646.383] (-660.057) (-651.609) (-650.110) * (-666.559) (-655.299) (-660.606) [-654.573] -- 0:03:18
35000 -- (-653.022) (-649.905) (-650.048) [-649.609] * (-662.907) (-659.606) (-659.334) [-656.354] -- 0:03:13
Average standard deviation of split frequencies: 0.028946
36000 -- (-651.466) (-658.716) (-653.316) [-650.518] * (-664.023) [-654.466] (-657.000) (-655.984) -- 0:03:34
37000 -- [-649.561] (-651.873) (-657.292) (-652.422) * (-661.220) (-647.087) [-648.514] (-662.825) -- 0:03:28
38000 -- (-657.505) (-648.795) (-653.688) [-648.865] * (-664.449) (-653.080) (-654.823) [-650.089] -- 0:03:22
39000 -- (-651.963) [-654.627] (-650.085) (-663.500) * (-659.913) (-649.879) [-651.119] (-653.682) -- 0:03:17
40000 -- (-653.210) (-656.861) [-649.427] (-654.054) * [-652.434] (-651.318) (-651.724) (-662.979) -- 0:03:36
Average standard deviation of split frequencies: 0.028980
41000 -- (-649.379) (-667.595) [-645.748] (-654.947) * (-651.837) (-655.842) (-649.460) [-656.170] -- 0:03:30
42000 -- (-651.253) (-651.670) (-660.927) [-658.753] * (-658.774) [-651.908] (-644.227) (-659.215) -- 0:03:25
43000 -- (-658.566) (-651.247) [-648.133] (-651.343) * (-646.008) (-657.647) [-648.999] (-661.547) -- 0:03:20
44000 -- (-654.820) (-658.993) [-654.378] (-655.555) * (-659.613) (-651.601) [-665.852] (-652.890) -- 0:03:15
45000 -- (-645.630) [-650.185] (-650.641) (-660.290) * (-646.732) [-647.717] (-653.790) (-655.630) -- 0:03:32
Average standard deviation of split frequencies: 0.025350
46000 -- [-648.506] (-656.302) (-663.818) (-652.713) * [-645.969] (-650.313) (-654.852) (-664.081) -- 0:03:27
47000 -- (-655.327) (-660.245) [-650.876] (-654.316) * (-656.936) (-660.239) (-652.909) [-652.910] -- 0:03:22
48000 -- [-645.006] (-657.220) (-663.051) (-655.183) * (-652.374) [-648.062] (-658.152) (-653.402) -- 0:03:18
49000 -- (-655.782) (-658.701) (-656.630) [-652.399] * (-662.121) (-663.127) [-653.565] (-652.085) -- 0:03:33
50000 -- [-652.082] (-654.289) (-662.310) (-651.860) * (-650.588) (-660.720) [-648.719] (-657.058) -- 0:03:29
Average standard deviation of split frequencies: 0.031830
51000 -- [-652.388] (-663.784) (-656.486) (-657.377) * [-661.290] (-655.133) (-649.046) (-655.391) -- 0:03:24
52000 -- (-649.776) [-655.270] (-658.664) (-653.783) * (-661.108) (-663.079) [-656.762] (-651.634) -- 0:03:20
53000 -- (-650.571) (-649.974) (-656.259) [-650.891] * (-655.287) (-655.335) [-651.529] (-655.266) -- 0:03:16
54000 -- [-649.899] (-656.586) (-647.191) (-653.857) * (-659.716) (-652.689) (-659.801) [-651.012] -- 0:03:30
55000 -- [-650.311] (-656.800) (-656.066) (-662.755) * (-658.944) (-654.809) (-654.512) [-653.856] -- 0:03:26
Average standard deviation of split frequencies: 0.030866
56000 -- (-652.365) [-657.943] (-657.308) (-657.213) * [-649.665] (-654.664) (-663.284) (-653.148) -- 0:03:22
57000 -- (-652.403) (-661.497) [-653.387] (-665.540) * (-657.823) [-655.419] (-657.046) (-648.822) -- 0:03:18
58000 -- (-651.418) [-658.766] (-653.750) (-659.667) * (-656.367) [-648.258] (-658.485) (-652.152) -- 0:03:31
59000 -- [-648.768] (-657.656) (-652.867) (-661.852) * [-654.072] (-659.605) (-666.371) (-658.995) -- 0:03:27
60000 -- (-654.076) (-653.337) [-651.285] (-664.810) * [-651.801] (-650.655) (-660.798) (-654.573) -- 0:03:23
Average standard deviation of split frequencies: 0.033996
61000 -- (-655.164) [-652.995] (-658.516) (-654.623) * [-653.630] (-652.051) (-660.169) (-647.403) -- 0:03:20
62000 -- (-650.969) (-646.925) (-654.878) [-655.596] * (-664.046) (-659.652) (-650.845) [-653.358] -- 0:03:16
63000 -- (-656.398) (-661.514) (-655.797) [-651.450] * (-654.668) [-654.555] (-663.238) (-654.660) -- 0:03:28
64000 -- (-650.679) [-652.202] (-650.504) (-659.718) * (-654.117) (-650.321) (-677.797) [-652.199] -- 0:03:24
65000 -- (-664.990) (-657.779) [-648.217] (-650.683) * (-660.388) [-647.655] (-657.000) (-648.138) -- 0:03:21
Average standard deviation of split frequencies: 0.030554
66000 -- (-654.890) (-651.459) (-654.703) [-650.017] * (-654.784) [-650.481] (-662.295) (-650.064) -- 0:03:18
67000 -- (-653.170) (-653.727) (-651.649) [-653.582] * (-655.007) (-664.600) (-653.150) [-650.797] -- 0:03:14
68000 -- [-654.834] (-654.877) (-664.846) (-656.903) * [-656.704] (-656.706) (-655.036) (-651.478) -- 0:03:25
69000 -- (-654.913) (-667.095) [-645.579] (-650.778) * (-661.517) (-654.718) [-650.635] (-653.869) -- 0:03:22
70000 -- [-651.595] (-661.174) (-652.299) (-649.825) * [-644.264] (-648.608) (-668.398) (-651.278) -- 0:03:19
Average standard deviation of split frequencies: 0.029430
71000 -- (-655.013) (-668.154) [-652.932] (-654.802) * (-660.713) (-650.912) (-662.143) [-655.542] -- 0:03:16
72000 -- [-656.687] (-656.534) (-664.675) (-654.454) * (-654.921) (-657.549) (-655.984) [-652.217] -- 0:03:26
73000 -- (-654.945) (-653.368) [-650.477] (-653.942) * [-652.216] (-653.653) (-654.015) (-648.433) -- 0:03:23
74000 -- (-655.221) (-657.558) (-665.413) [-653.087] * (-650.926) (-653.968) (-657.507) [-648.854] -- 0:03:20
75000 -- (-654.245) (-659.231) [-647.698] (-668.290) * [-645.149] (-648.635) (-652.190) (-655.460) -- 0:03:17
Average standard deviation of split frequencies: 0.028459
76000 -- (-652.835) (-658.761) (-662.819) [-651.665] * [-651.016] (-655.904) (-664.532) (-653.209) -- 0:03:14
77000 -- (-650.894) (-665.294) (-653.735) [-652.193] * (-653.637) (-661.650) (-650.495) [-656.631] -- 0:03:23
78000 -- (-657.078) (-661.982) [-651.690] (-652.303) * (-655.024) (-649.950) (-648.498) [-652.567] -- 0:03:20
79000 -- (-657.178) (-654.640) [-651.657] (-652.408) * (-648.006) (-652.763) (-652.930) [-651.166] -- 0:03:18
80000 -- (-660.193) (-648.972) (-655.359) [-654.647] * [-650.684] (-660.914) (-650.941) (-649.507) -- 0:03:15
Average standard deviation of split frequencies: 0.029609
81000 -- (-655.533) [-658.718] (-655.445) (-650.508) * (-658.776) (-659.333) [-649.504] (-663.315) -- 0:03:24
82000 -- [-652.989] (-651.178) (-649.892) (-650.980) * [-654.183] (-655.539) (-659.788) (-649.135) -- 0:03:21
83000 -- (-654.993) (-648.982) (-651.905) [-651.297] * (-647.508) (-654.910) (-656.113) [-653.800] -- 0:03:18
84000 -- (-652.133) (-667.625) (-650.795) [-649.645] * [-650.470] (-653.212) (-648.951) (-659.550) -- 0:03:16
85000 -- [-650.181] (-651.357) (-652.892) (-648.431) * (-647.903) (-655.580) (-663.326) [-650.146] -- 0:03:13
Average standard deviation of split frequencies: 0.027984
86000 -- (-649.548) (-654.581) (-649.548) [-647.781] * [-651.455] (-649.188) (-648.842) (-657.574) -- 0:03:21
87000 -- (-652.428) [-650.329] (-648.239) (-654.271) * [-652.533] (-652.696) (-663.096) (-656.624) -- 0:03:19
88000 -- (-653.155) (-658.463) (-671.452) [-652.853] * (-653.416) [-646.478] (-679.311) (-655.841) -- 0:03:16
89000 -- [-652.263] (-650.318) (-661.406) (-657.071) * [-657.499] (-656.336) (-650.623) (-652.163) -- 0:03:14
90000 -- (-660.995) [-651.536] (-659.187) (-657.541) * (-655.520) (-646.971) [-646.960] (-652.884) -- 0:03:22
Average standard deviation of split frequencies: 0.028137
91000 -- (-656.811) (-653.473) [-647.432] (-657.046) * [-659.555] (-659.370) (-652.297) (-654.534) -- 0:03:19
92000 -- [-655.221] (-655.665) (-654.983) (-653.476) * (-655.350) (-649.551) (-659.678) [-655.025] -- 0:03:17
93000 -- (-655.137) (-655.891) [-655.535] (-652.457) * (-657.355) (-646.012) (-651.695) [-649.800] -- 0:03:15
94000 -- [-657.703] (-653.893) (-650.151) (-651.539) * (-658.196) (-656.575) (-655.619) [-648.752] -- 0:03:12
95000 -- (-652.542) (-671.557) (-653.777) [-658.524] * (-645.242) (-654.294) (-655.451) [-650.914] -- 0:03:20
Average standard deviation of split frequencies: 0.026863
96000 -- (-659.958) (-653.136) (-649.383) [-652.038] * (-654.728) [-651.011] (-655.741) (-651.523) -- 0:03:17
97000 -- (-653.610) [-649.474] (-647.204) (-654.316) * [-651.815] (-656.174) (-649.915) (-653.940) -- 0:03:15
98000 -- (-665.820) (-656.056) (-647.716) [-660.406] * (-655.686) (-662.010) [-647.432] (-649.346) -- 0:03:13
99000 -- (-656.085) (-658.322) (-652.809) [-652.500] * [-651.034] (-652.736) (-652.498) (-658.083) -- 0:03:20
100000 -- [-659.235] (-659.871) (-650.050) (-654.999) * (-664.176) (-650.670) (-649.170) [-654.721] -- 0:03:18
Average standard deviation of split frequencies: 0.028617
101000 -- [-658.357] (-660.043) (-647.149) (-651.542) * [-655.331] (-649.585) (-648.560) (-662.755) -- 0:03:15
102000 -- [-651.964] (-656.523) (-652.005) (-656.256) * [-652.251] (-650.955) (-651.668) (-651.780) -- 0:03:13
103000 -- (-651.284) [-657.803] (-657.179) (-660.739) * (-659.240) (-649.558) [-650.772] (-650.511) -- 0:03:20
104000 -- (-655.785) (-653.975) (-653.298) [-649.896] * (-653.936) (-662.101) (-654.373) [-648.702] -- 0:03:18
105000 -- (-656.095) (-660.401) [-648.678] (-651.583) * (-658.584) (-652.701) [-646.803] (-653.944) -- 0:03:16
Average standard deviation of split frequencies: 0.026436
106000 -- (-653.548) (-660.167) [-651.128] (-653.441) * (-654.111) [-650.645] (-652.662) (-654.194) -- 0:03:13
107000 -- (-650.749) (-649.993) [-651.647] (-661.493) * (-656.103) (-651.536) (-656.962) [-654.869] -- 0:03:11
108000 -- (-658.885) (-646.844) [-654.282] (-658.934) * (-654.101) (-650.443) (-650.144) [-648.950] -- 0:03:18
109000 -- (-652.875) [-649.523] (-660.768) (-647.292) * [-649.337] (-662.070) (-654.082) (-650.785) -- 0:03:16
110000 -- [-654.786] (-656.880) (-655.250) (-660.846) * (-655.036) (-656.873) (-660.922) [-652.598] -- 0:03:14
Average standard deviation of split frequencies: 0.024138
111000 -- (-657.903) [-649.593] (-650.925) (-665.089) * (-656.934) [-657.241] (-651.844) (-662.776) -- 0:03:12
112000 -- (-656.187) (-651.634) [-646.532] (-652.646) * (-656.846) (-649.003) [-651.021] (-651.455) -- 0:03:18
113000 -- (-664.416) (-659.891) [-649.395] (-651.569) * (-653.478) (-655.522) [-652.039] (-655.142) -- 0:03:16
114000 -- (-661.022) [-649.178] (-664.084) (-658.061) * (-651.681) [-646.945] (-666.445) (-657.593) -- 0:03:14
115000 -- (-659.120) (-650.080) (-654.203) [-654.976] * [-652.980] (-654.980) (-652.943) (-664.752) -- 0:03:12
Average standard deviation of split frequencies: 0.024835
116000 -- (-661.103) (-652.759) [-651.521] (-652.409) * (-658.966) [-645.082] (-650.689) (-651.514) -- 0:03:18
117000 -- (-653.110) (-647.249) (-653.991) [-649.577] * [-653.721] (-651.901) (-656.750) (-650.245) -- 0:03:16
118000 -- (-649.621) (-648.945) (-654.869) [-651.756] * (-655.785) (-661.444) [-647.941] (-656.750) -- 0:03:14
119000 -- (-650.903) (-648.156) (-655.934) [-651.120] * [-656.142] (-651.961) (-656.672) (-654.595) -- 0:03:12
120000 -- (-653.045) [-648.609] (-655.462) (-651.874) * [-660.679] (-653.866) (-658.182) (-651.556) -- 0:03:10
Average standard deviation of split frequencies: 0.023440
121000 -- (-664.203) [-652.730] (-651.887) (-656.887) * [-655.749] (-649.626) (-647.143) (-658.185) -- 0:03:16
122000 -- (-651.812) [-649.047] (-654.377) (-652.056) * (-657.096) [-649.786] (-650.657) (-666.173) -- 0:03:14
123000 -- (-656.347) (-656.132) [-654.228] (-654.883) * (-654.459) (-657.620) (-650.034) [-651.228] -- 0:03:12
124000 -- (-656.193) (-650.476) [-655.880] (-658.753) * (-652.896) (-649.523) [-654.613] (-649.783) -- 0:03:10
125000 -- [-650.875] (-653.792) (-654.009) (-658.883) * (-650.663) (-658.477) [-650.157] (-651.300) -- 0:03:16
Average standard deviation of split frequencies: 0.023071
126000 -- (-654.918) [-654.770] (-657.784) (-650.707) * [-651.381] (-652.556) (-652.035) (-659.656) -- 0:03:14
127000 -- (-663.599) (-648.911) (-654.250) [-653.044] * [-648.568] (-654.931) (-654.632) (-653.855) -- 0:03:12
128000 -- (-661.176) [-652.518] (-653.001) (-659.790) * (-659.488) [-660.848] (-655.463) (-654.313) -- 0:03:10
129000 -- (-648.453) [-653.777] (-653.160) (-654.446) * (-652.056) [-649.332] (-655.912) (-659.621) -- 0:03:09
130000 -- (-659.107) (-651.264) (-660.090) [-649.672] * (-652.812) (-655.597) (-658.265) [-658.580] -- 0:03:14
Average standard deviation of split frequencies: 0.023768
131000 -- (-656.619) [-656.891] (-658.893) (-649.182) * (-648.815) (-648.183) [-650.195] (-659.823) -- 0:03:12
132000 -- (-655.147) [-656.621] (-665.288) (-665.207) * (-658.233) (-649.675) [-656.494] (-654.606) -- 0:03:10
133000 -- (-653.928) (-656.538) [-649.426] (-653.604) * [-651.511] (-660.110) (-655.362) (-659.962) -- 0:03:09
134000 -- [-654.024] (-657.785) (-664.194) (-652.655) * (-653.181) [-654.884] (-667.811) (-660.290) -- 0:03:13
135000 -- (-650.608) (-654.880) [-648.878] (-663.818) * (-660.041) (-661.126) [-648.901] (-652.314) -- 0:03:12
Average standard deviation of split frequencies: 0.021817
136000 -- (-650.270) [-652.609] (-660.680) (-653.588) * (-655.791) (-651.049) [-652.076] (-651.732) -- 0:03:10
137000 -- (-653.211) (-664.889) (-651.474) [-650.172] * (-653.893) (-650.453) (-660.925) [-652.389] -- 0:03:08
138000 -- (-654.038) (-649.623) (-655.843) [-657.409] * (-655.211) (-651.706) (-670.172) [-661.121] -- 0:03:13
139000 -- (-656.844) (-666.956) [-658.961] (-653.109) * (-655.692) [-653.989] (-667.068) (-653.342) -- 0:03:12
140000 -- (-653.997) (-654.999) (-646.717) [-645.645] * (-659.452) [-649.387] (-649.723) (-658.291) -- 0:03:10
Average standard deviation of split frequencies: 0.019910
141000 -- [-647.340] (-652.863) (-651.083) (-646.291) * (-650.878) [-649.910] (-652.708) (-664.457) -- 0:03:08
142000 -- (-654.230) [-652.773] (-664.207) (-652.882) * [-653.823] (-662.566) (-662.634) (-657.570) -- 0:03:07
143000 -- [-652.401] (-651.704) (-661.687) (-655.414) * (-653.566) [-653.914] (-652.986) (-656.199) -- 0:03:11
144000 -- (-652.984) [-653.719] (-653.353) (-657.926) * (-653.130) (-652.765) [-645.570] (-655.256) -- 0:03:10
145000 -- (-659.213) (-660.325) (-664.740) [-647.284] * (-649.105) (-663.800) [-651.713] (-655.008) -- 0:03:08
Average standard deviation of split frequencies: 0.020322
146000 -- (-650.594) (-654.631) (-670.538) [-649.126] * (-656.025) (-661.213) (-656.128) [-654.340] -- 0:03:07
147000 -- (-651.204) (-657.200) (-653.404) [-647.546] * (-654.851) (-657.651) [-650.927] (-647.244) -- 0:03:11
148000 -- (-655.200) (-651.569) [-651.074] (-651.420) * (-670.163) (-662.059) [-651.416] (-646.685) -- 0:03:09
149000 -- (-664.041) [-660.972] (-653.290) (-661.535) * [-649.606] (-655.544) (-658.465) (-655.310) -- 0:03:08
150000 -- [-655.352] (-651.481) (-655.431) (-652.187) * (-647.944) (-658.768) (-658.486) [-653.624] -- 0:03:07
Average standard deviation of split frequencies: 0.019509
151000 -- (-658.606) (-661.146) (-656.389) [-653.468] * (-649.099) (-653.960) (-659.170) [-654.092] -- 0:03:11
152000 -- (-655.349) (-658.415) [-651.606] (-652.698) * (-653.574) [-656.040] (-651.953) (-649.050) -- 0:03:09
153000 -- (-654.974) [-658.262] (-660.140) (-646.873) * (-654.363) [-663.362] (-658.128) (-664.419) -- 0:03:08
154000 -- (-657.218) (-655.410) (-656.166) [-653.098] * (-649.996) (-649.885) [-651.125] (-650.565) -- 0:03:06
155000 -- (-655.552) [-653.525] (-661.671) (-651.949) * (-650.444) [-652.691] (-656.247) (-655.355) -- 0:03:10
Average standard deviation of split frequencies: 0.019138
156000 -- (-653.477) [-650.079] (-653.014) (-648.041) * [-651.707] (-653.782) (-656.195) (-654.549) -- 0:03:09
157000 -- (-650.978) [-650.006] (-656.687) (-652.162) * (-655.287) (-653.211) (-653.051) [-649.801] -- 0:03:07
158000 -- (-650.241) [-649.827] (-660.749) (-654.189) * (-667.804) [-654.153] (-654.939) (-652.744) -- 0:03:06
159000 -- (-656.274) (-657.313) [-655.559] (-650.672) * (-651.411) [-654.837] (-657.093) (-652.338) -- 0:03:05
160000 -- [-649.982] (-656.940) (-649.629) (-661.010) * (-658.883) (-653.456) [-648.575] (-649.004) -- 0:03:09
Average standard deviation of split frequencies: 0.019330
161000 -- [-655.627] (-647.040) (-652.234) (-654.340) * (-650.004) (-657.896) [-651.733] (-646.586) -- 0:03:07
162000 -- [-652.643] (-656.211) (-663.238) (-657.956) * [-654.364] (-657.509) (-653.560) (-652.128) -- 0:03:06
163000 -- [-649.429] (-654.921) (-649.043) (-656.861) * (-649.316) (-653.150) [-656.172] (-660.830) -- 0:03:04
164000 -- [-651.008] (-650.923) (-653.872) (-651.816) * (-651.696) [-647.719] (-655.051) (-664.392) -- 0:03:08
165000 -- (-651.159) [-653.349] (-657.587) (-648.660) * (-656.056) (-655.089) (-650.482) [-648.245] -- 0:03:07
Average standard deviation of split frequencies: 0.017828
166000 -- (-651.207) (-650.093) (-651.553) [-658.372] * (-650.848) (-657.081) [-649.174] (-648.578) -- 0:03:05
167000 -- (-657.667) (-652.021) (-655.534) [-656.167] * (-663.658) (-664.482) [-649.996] (-652.840) -- 0:03:04
168000 -- [-649.285] (-655.963) (-651.875) (-648.101) * (-659.797) [-651.876] (-664.504) (-649.553) -- 0:03:03
169000 -- (-664.529) (-651.854) [-651.078] (-647.739) * [-653.771] (-650.499) (-658.262) (-649.564) -- 0:03:06
170000 -- (-656.110) (-656.830) [-660.128] (-647.691) * [-649.104] (-662.377) (-652.457) (-650.733) -- 0:03:05
Average standard deviation of split frequencies: 0.016898
171000 -- (-653.356) (-660.828) (-653.926) [-657.478] * (-655.315) (-651.121) (-645.425) [-651.176] -- 0:03:04
172000 -- (-653.939) (-654.703) [-650.426] (-655.226) * (-664.966) (-656.304) (-659.909) [-657.658] -- 0:03:02
173000 -- (-658.776) (-661.125) (-656.680) [-653.948] * [-649.931] (-652.336) (-654.256) (-657.089) -- 0:03:06
174000 -- (-653.646) (-653.393) [-657.512] (-656.478) * (-660.300) (-658.451) [-655.924] (-656.138) -- 0:03:05
175000 -- (-649.362) [-654.482] (-665.291) (-650.501) * (-648.421) (-654.346) [-653.317] (-652.032) -- 0:03:03
Average standard deviation of split frequencies: 0.017961
176000 -- (-660.325) (-652.541) [-650.444] (-654.438) * [-654.254] (-663.142) (-658.277) (-653.601) -- 0:03:02
177000 -- (-650.467) (-659.388) [-653.517] (-655.641) * (-655.639) (-654.196) (-652.727) [-650.132] -- 0:03:01
178000 -- (-655.730) (-657.480) (-657.205) [-649.013] * (-658.115) (-650.736) [-655.773] (-657.412) -- 0:03:04
179000 -- [-646.642] (-652.116) (-650.471) (-653.412) * (-650.451) (-657.078) [-653.940] (-652.484) -- 0:03:03
180000 -- [-660.121] (-647.035) (-661.594) (-655.858) * (-653.451) (-654.669) [-652.642] (-657.220) -- 0:03:02
Average standard deviation of split frequencies: 0.018091
181000 -- (-657.482) [-648.598] (-658.454) (-658.672) * (-650.076) (-657.795) (-666.831) [-650.235] -- 0:03:00
182000 -- (-651.586) (-657.828) (-661.118) [-651.744] * [-647.559] (-654.369) (-656.771) (-651.867) -- 0:03:04
183000 -- (-651.127) [-654.548] (-652.861) (-655.013) * [-657.693] (-650.643) (-655.861) (-662.226) -- 0:03:03
184000 -- (-654.271) (-661.128) (-653.465) [-651.331] * (-657.876) (-656.487) (-652.669) [-653.249] -- 0:03:01
185000 -- (-656.238) (-663.399) [-655.085] (-652.658) * (-652.128) (-652.713) [-654.550] (-662.373) -- 0:03:00
Average standard deviation of split frequencies: 0.018337
186000 -- [-653.408] (-650.313) (-659.292) (-657.318) * [-660.294] (-658.588) (-656.331) (-653.392) -- 0:03:03
187000 -- [-648.164] (-659.093) (-650.207) (-656.727) * [-648.437] (-659.732) (-657.046) (-662.942) -- 0:03:02
188000 -- [-648.606] (-658.196) (-652.747) (-655.787) * (-654.094) [-651.716] (-650.827) (-649.475) -- 0:03:01
189000 -- (-652.186) [-651.963] (-652.076) (-652.586) * (-649.297) (-662.145) (-655.956) [-659.892] -- 0:03:00
190000 -- (-656.967) (-651.547) (-654.293) [-652.086] * (-661.338) (-661.656) (-654.316) [-651.911] -- 0:03:03
Average standard deviation of split frequencies: 0.017889
191000 -- (-661.106) (-656.010) [-651.467] (-651.813) * [-652.096] (-656.374) (-654.183) (-650.814) -- 0:03:02
192000 -- (-654.338) [-653.615] (-660.071) (-653.250) * [-645.111] (-656.316) (-653.107) (-657.196) -- 0:03:00
193000 -- (-662.980) (-657.487) [-646.525] (-648.025) * (-651.584) (-658.797) [-661.211] (-656.459) -- 0:02:59
194000 -- (-653.031) (-654.863) (-647.480) [-656.728] * [-650.158] (-648.626) (-664.591) (-657.319) -- 0:02:58
195000 -- (-658.871) [-653.032] (-653.323) (-651.720) * (-656.025) (-654.018) (-655.363) [-652.215] -- 0:03:01
Average standard deviation of split frequencies: 0.017968
196000 -- (-650.815) (-654.557) [-650.759] (-650.242) * (-647.537) (-653.406) (-654.511) [-650.471] -- 0:03:00
197000 -- (-655.536) [-655.588] (-650.491) (-650.253) * (-653.577) (-654.648) (-663.106) [-653.917] -- 0:02:59
198000 -- (-655.096) (-658.807) [-652.985] (-653.383) * (-652.270) (-657.648) [-651.256] (-655.864) -- 0:02:58
199000 -- (-658.137) (-655.402) (-653.033) [-652.962] * (-649.600) (-651.147) (-669.447) [-649.868] -- 0:03:01
200000 -- (-661.711) [-653.914] (-655.414) (-657.027) * (-660.505) (-660.555) [-650.414] (-658.043) -- 0:03:00
Average standard deviation of split frequencies: 0.015818
201000 -- (-661.037) [-654.246] (-657.264) (-655.343) * [-649.728] (-659.577) (-665.288) (-660.614) -- 0:02:58
202000 -- (-655.621) [-649.493] (-652.572) (-648.355) * (-654.767) (-653.539) (-654.187) [-660.384] -- 0:02:57
203000 -- (-663.160) (-651.828) [-648.320] (-653.456) * (-649.103) (-652.631) (-656.088) [-652.738] -- 0:02:56
204000 -- (-663.724) (-646.980) (-656.823) [-654.357] * (-658.109) (-653.062) [-650.255] (-661.545) -- 0:02:59
205000 -- (-659.061) (-651.969) [-656.113] (-651.800) * (-654.526) [-655.647] (-652.325) (-663.943) -- 0:02:58
Average standard deviation of split frequencies: 0.016448
206000 -- (-653.982) [-652.847] (-658.142) (-650.992) * (-656.258) [-651.514] (-660.704) (-660.674) -- 0:02:57
207000 -- (-654.712) (-654.912) (-650.583) [-647.903] * (-645.068) [-648.760] (-650.967) (-650.866) -- 0:02:56
208000 -- (-654.254) (-653.586) [-649.893] (-655.070) * (-645.920) (-655.850) (-654.123) [-650.106] -- 0:02:58
209000 -- (-656.121) (-657.225) (-650.212) [-653.615] * (-656.145) [-646.913] (-654.433) (-653.629) -- 0:02:57
210000 -- [-657.814] (-660.198) (-649.797) (-657.779) * (-659.645) [-648.223] (-652.787) (-671.614) -- 0:02:56
Average standard deviation of split frequencies: 0.019876
211000 -- [-653.782] (-655.780) (-653.661) (-659.864) * (-651.156) [-650.190] (-657.329) (-653.788) -- 0:02:55
212000 -- (-655.387) [-654.805] (-652.033) (-652.259) * (-655.428) (-664.067) [-654.462] (-652.893) -- 0:02:54
213000 -- (-655.820) [-652.367] (-652.825) (-656.403) * (-652.526) [-646.401] (-668.677) (-658.625) -- 0:02:57
214000 -- (-654.053) (-653.680) [-649.335] (-655.223) * (-655.567) [-649.611] (-663.502) (-654.604) -- 0:02:56
215000 -- (-652.068) (-652.849) [-648.647] (-648.755) * (-660.174) (-649.320) [-652.777] (-657.804) -- 0:02:55
Average standard deviation of split frequencies: 0.019505
216000 -- (-651.487) [-652.731] (-660.747) (-649.632) * (-646.757) [-645.547] (-647.904) (-658.234) -- 0:02:54
217000 -- (-658.509) [-651.702] (-651.739) (-645.491) * (-653.334) (-652.908) (-656.088) [-652.892] -- 0:02:56
218000 -- (-658.181) (-649.150) (-654.433) [-649.645] * (-650.111) [-648.462] (-660.161) (-651.216) -- 0:02:55
219000 -- (-666.169) [-652.645] (-652.764) (-653.132) * (-656.208) [-647.660] (-651.868) (-653.457) -- 0:02:54
220000 -- (-656.040) [-649.690] (-656.226) (-656.359) * (-650.411) (-656.213) [-651.209] (-651.953) -- 0:02:53
Average standard deviation of split frequencies: 0.020028
221000 -- (-661.722) [-654.356] (-651.591) (-650.674) * (-662.163) (-654.114) (-660.317) [-647.489] -- 0:02:52
222000 -- (-664.148) (-659.266) (-656.052) [-647.964] * (-663.273) (-650.975) (-659.297) [-660.950] -- 0:02:55
223000 -- (-660.635) (-652.012) (-654.620) [-651.266] * (-658.338) (-662.029) [-659.548] (-662.586) -- 0:02:54
224000 -- (-658.419) (-651.959) [-656.073] (-654.477) * (-649.145) (-653.636) (-657.033) [-650.343] -- 0:02:53
225000 -- (-662.916) (-657.831) [-649.898] (-662.187) * (-660.035) (-652.066) [-653.943] (-661.898) -- 0:02:52
Average standard deviation of split frequencies: 0.019294
226000 -- (-656.791) (-658.363) (-655.787) [-657.652] * [-648.156] (-668.270) (-653.221) (-651.492) -- 0:02:54
227000 -- (-659.363) [-654.134] (-659.311) (-651.988) * (-652.961) (-647.541) (-652.936) [-647.398] -- 0:02:53
228000 -- [-652.913] (-646.453) (-650.963) (-659.432) * (-652.962) (-651.147) [-653.390] (-658.744) -- 0:02:52
229000 -- (-653.547) [-646.046] (-654.386) (-655.444) * (-651.747) [-653.610] (-657.462) (-655.862) -- 0:02:51
230000 -- [-655.580] (-652.139) (-656.161) (-661.407) * [-651.753] (-652.530) (-662.236) (-658.549) -- 0:02:54
Average standard deviation of split frequencies: 0.019159
231000 -- [-649.420] (-660.944) (-651.557) (-651.818) * (-655.043) [-656.121] (-660.508) (-654.100) -- 0:02:53
232000 -- (-652.828) [-658.525] (-658.558) (-655.050) * (-657.753) [-652.988] (-647.888) (-657.704) -- 0:02:52
233000 -- (-655.513) [-650.965] (-647.511) (-648.754) * [-654.056] (-661.737) (-656.327) (-654.952) -- 0:02:51
234000 -- [-643.983] (-648.350) (-653.602) (-654.649) * (-659.095) (-666.270) [-660.938] (-653.577) -- 0:02:53
235000 -- (-655.254) (-655.970) (-648.595) [-656.453] * [-658.411] (-660.490) (-654.880) (-652.578) -- 0:02:52
Average standard deviation of split frequencies: 0.018726
236000 -- (-655.938) [-649.661] (-648.747) (-656.567) * [-649.116] (-657.314) (-657.698) (-654.534) -- 0:02:51
237000 -- (-655.914) (-662.962) [-665.443] (-654.015) * (-652.615) (-654.897) [-655.411] (-650.778) -- 0:02:50
238000 -- (-668.496) (-651.452) [-655.119] (-656.586) * [-647.569] (-649.825) (-666.089) (-653.776) -- 0:02:49
239000 -- (-658.634) (-655.588) [-656.638] (-656.567) * [-649.856] (-650.156) (-653.344) (-664.148) -- 0:02:51
240000 -- (-651.841) (-655.392) (-652.639) [-651.978] * (-653.860) [-650.214] (-660.665) (-674.368) -- 0:02:51
Average standard deviation of split frequencies: 0.018543
241000 -- (-647.353) [-656.314] (-662.048) (-652.983) * [-647.270] (-653.718) (-648.647) (-656.313) -- 0:02:50
242000 -- (-650.553) (-656.886) [-658.677] (-664.035) * (-652.742) (-650.077) [-650.358] (-654.371) -- 0:02:49
243000 -- (-651.773) (-661.938) [-650.942] (-654.715) * [-655.354] (-650.314) (-653.454) (-657.078) -- 0:02:51
244000 -- (-656.721) [-657.109] (-658.580) (-652.018) * [-648.890] (-650.325) (-652.416) (-654.442) -- 0:02:50
245000 -- (-659.362) (-658.726) (-647.727) [-652.097] * [-650.421] (-654.293) (-647.202) (-653.431) -- 0:02:49
Average standard deviation of split frequencies: 0.019546
246000 -- (-649.118) (-660.835) [-651.082] (-653.028) * (-646.285) (-650.689) (-650.000) [-658.259] -- 0:02:48
247000 -- (-650.060) (-657.243) (-657.010) [-653.170] * (-651.672) (-650.444) [-648.511] (-651.653) -- 0:02:50
248000 -- [-649.942] (-655.487) (-659.356) (-652.985) * (-650.671) (-653.287) (-662.903) [-647.582] -- 0:02:49
249000 -- [-647.008] (-651.697) (-652.266) (-654.977) * (-654.165) [-653.433] (-652.410) (-652.135) -- 0:02:48
250000 -- (-652.418) (-654.452) (-650.596) [-647.266] * (-659.560) [-645.815] (-656.644) (-649.299) -- 0:02:48
Average standard deviation of split frequencies: 0.018336
251000 -- [-657.311] (-649.877) (-660.061) (-647.759) * (-660.290) [-649.492] (-659.874) (-657.005) -- 0:02:50
252000 -- (-650.380) (-649.310) [-652.526] (-651.537) * (-659.338) [-650.306] (-660.980) (-649.897) -- 0:02:49
253000 -- (-648.650) (-659.239) [-650.276] (-649.252) * [-650.960] (-663.283) (-659.075) (-653.253) -- 0:02:48
254000 -- [-653.349] (-653.535) (-661.865) (-650.292) * [-648.829] (-649.697) (-662.385) (-654.726) -- 0:02:47
255000 -- (-659.474) [-649.397] (-655.296) (-657.416) * (-650.095) [-649.089] (-657.767) (-655.363) -- 0:02:46
Average standard deviation of split frequencies: 0.018660
256000 -- (-653.746) (-654.258) (-648.567) [-656.122] * [-651.696] (-659.346) (-650.699) (-646.493) -- 0:02:48
257000 -- [-650.546] (-646.489) (-650.061) (-655.566) * (-657.839) (-655.493) (-653.932) [-652.814] -- 0:02:47
258000 -- (-662.183) (-657.086) [-661.097] (-655.619) * (-658.059) (-651.452) (-654.563) [-659.495] -- 0:02:46
259000 -- (-653.985) (-663.499) (-653.651) [-662.783] * [-658.924] (-654.899) (-656.931) (-659.094) -- 0:02:45
260000 -- (-647.263) [-650.621] (-653.922) (-652.534) * (-652.304) (-660.933) (-650.000) [-653.091] -- 0:02:47
Average standard deviation of split frequencies: 0.018860
261000 -- (-648.382) (-653.667) [-651.803] (-652.350) * (-654.572) [-652.798] (-656.409) (-652.633) -- 0:02:47
262000 -- (-650.774) [-650.375] (-658.249) (-664.850) * (-654.608) (-652.000) [-649.790] (-657.124) -- 0:02:46
263000 -- [-644.692] (-653.338) (-656.958) (-658.873) * [-647.245] (-652.845) (-654.744) (-656.851) -- 0:02:45
264000 -- [-649.803] (-650.024) (-658.843) (-651.842) * [-653.603] (-652.052) (-650.848) (-659.042) -- 0:02:47
265000 -- (-663.719) [-654.939] (-654.168) (-659.352) * [-654.980] (-658.082) (-649.540) (-653.036) -- 0:02:46
Average standard deviation of split frequencies: 0.019494
266000 -- [-658.204] (-654.734) (-660.756) (-664.224) * (-651.808) [-653.387] (-653.906) (-651.726) -- 0:02:45
267000 -- (-659.494) [-652.725] (-649.422) (-656.090) * [-654.978] (-651.901) (-651.403) (-659.069) -- 0:02:44
268000 -- [-656.387] (-650.722) (-649.701) (-661.014) * (-647.284) [-648.783] (-649.925) (-653.127) -- 0:02:43
269000 -- (-660.104) [-646.166] (-650.680) (-661.924) * (-655.596) (-651.036) [-653.194] (-649.922) -- 0:02:45
270000 -- (-655.121) [-652.840] (-647.933) (-656.356) * [-648.451] (-653.654) (-655.828) (-652.988) -- 0:02:44
Average standard deviation of split frequencies: 0.018163
271000 -- (-669.467) (-659.991) [-650.457] (-658.718) * (-655.432) [-649.703] (-659.128) (-655.822) -- 0:02:44
272000 -- (-658.408) [-653.210] (-660.442) (-656.931) * (-654.627) (-658.963) [-655.020] (-658.407) -- 0:02:43
273000 -- (-657.340) [-650.197] (-658.955) (-650.980) * (-657.483) [-652.026] (-652.471) (-650.945) -- 0:02:45
274000 -- (-663.870) (-646.587) [-650.956] (-651.087) * (-657.560) [-648.449] (-658.264) (-657.638) -- 0:02:44
275000 -- (-651.218) [-649.846] (-662.381) (-657.225) * [-651.608] (-662.683) (-651.262) (-650.560) -- 0:02:43
Average standard deviation of split frequencies: 0.019357
276000 -- (-654.774) [-655.900] (-656.652) (-657.712) * (-660.270) (-656.284) [-650.113] (-657.944) -- 0:02:42
277000 -- (-649.617) (-649.033) (-661.785) [-651.611] * (-653.330) (-660.974) (-656.129) [-652.106] -- 0:02:41
278000 -- (-648.726) (-652.848) (-652.976) [-658.877] * [-652.664] (-655.919) (-660.037) (-655.747) -- 0:02:43
279000 -- (-651.673) (-652.929) (-653.111) [-650.374] * (-661.508) (-654.315) (-656.542) [-658.703] -- 0:02:42
280000 -- (-656.177) [-653.033] (-659.583) (-651.259) * [-653.023] (-654.260) (-666.867) (-649.960) -- 0:02:42
Average standard deviation of split frequencies: 0.017156
281000 -- (-646.361) (-653.339) (-654.670) [-651.798] * (-653.256) [-655.182] (-657.766) (-650.149) -- 0:02:41
282000 -- (-654.762) (-658.176) [-649.338] (-653.061) * (-649.242) (-659.000) (-649.561) [-656.790] -- 0:02:42
283000 -- [-649.084] (-654.676) (-657.316) (-649.708) * [-647.362] (-658.602) (-653.155) (-660.426) -- 0:02:42
284000 -- [-655.527] (-659.978) (-648.110) (-656.186) * (-659.808) (-653.493) [-648.930] (-662.943) -- 0:02:41
285000 -- (-653.668) (-656.534) (-653.431) [-651.244] * [-646.728] (-656.323) (-661.895) (-650.685) -- 0:02:40
Average standard deviation of split frequencies: 0.017911
286000 -- [-647.835] (-661.822) (-658.618) (-652.666) * (-651.858) (-647.431) (-654.221) [-655.343] -- 0:02:42
287000 -- (-655.570) [-650.691] (-663.734) (-657.718) * (-669.289) [-654.810] (-650.990) (-654.788) -- 0:02:41
288000 -- (-657.567) [-654.103] (-661.761) (-654.049) * [-654.832] (-653.685) (-649.741) (-653.600) -- 0:02:40
289000 -- (-650.689) [-653.007] (-666.192) (-654.579) * [-651.484] (-653.450) (-652.611) (-657.374) -- 0:02:39
290000 -- (-662.370) [-648.238] (-655.256) (-651.208) * [-646.993] (-662.218) (-651.787) (-650.047) -- 0:02:39
Average standard deviation of split frequencies: 0.015986
291000 -- (-662.679) [-649.680] (-655.489) (-658.257) * [-650.871] (-656.362) (-662.585) (-649.445) -- 0:02:40
292000 -- (-654.698) (-647.628) (-654.000) [-651.935] * (-651.007) [-647.417] (-653.235) (-648.342) -- 0:02:40
293000 -- (-664.435) (-651.453) (-661.202) [-649.364] * (-650.333) [-648.392] (-658.357) (-649.228) -- 0:02:39
294000 -- (-666.804) (-662.385) (-651.802) [-661.303] * [-657.217] (-659.432) (-652.231) (-663.137) -- 0:02:38
295000 -- (-652.790) (-665.804) (-652.860) [-658.282] * (-651.012) [-653.296] (-659.530) (-653.765) -- 0:02:40
Average standard deviation of split frequencies: 0.014447
296000 -- [-648.720] (-652.119) (-661.232) (-656.819) * [-655.745] (-652.580) (-655.120) (-652.528) -- 0:02:39
297000 -- (-646.785) (-656.702) [-647.052] (-658.351) * (-651.499) [-650.418] (-653.610) (-649.146) -- 0:02:38
298000 -- (-654.134) (-652.812) [-647.654] (-664.932) * (-652.195) (-657.317) [-647.980] (-647.625) -- 0:02:37
299000 -- (-658.786) (-658.314) (-653.368) [-658.554] * (-652.116) (-660.858) (-657.442) [-652.018] -- 0:02:37
300000 -- (-661.904) (-663.789) [-652.759] (-659.410) * (-650.361) [-650.664] (-651.830) (-647.972) -- 0:02:38
Average standard deviation of split frequencies: 0.013775
301000 -- (-656.001) (-651.358) (-663.890) [-658.230] * (-652.485) (-654.362) [-651.897] (-660.295) -- 0:02:37
302000 -- [-648.290] (-652.250) (-658.451) (-666.050) * (-666.095) (-648.911) (-654.119) [-650.271] -- 0:02:37
303000 -- (-652.479) (-656.891) (-660.098) [-651.563] * (-655.991) (-656.408) (-659.731) [-650.761] -- 0:02:36
304000 -- [-649.140] (-652.931) (-650.113) (-652.157) * (-652.851) [-656.636] (-657.026) (-658.066) -- 0:02:37
305000 -- (-651.152) (-650.347) (-657.059) [-649.298] * (-655.819) (-651.991) (-651.384) [-649.650] -- 0:02:37
Average standard deviation of split frequencies: 0.013645
306000 -- (-659.087) [-650.601] (-655.645) (-656.819) * [-653.536] (-654.943) (-662.050) (-653.026) -- 0:02:36
307000 -- [-652.880] (-651.777) (-661.952) (-654.832) * (-660.539) (-658.206) (-655.215) [-650.935] -- 0:02:35
308000 -- (-656.714) [-648.867] (-660.673) (-657.217) * (-651.781) [-651.179] (-657.926) (-656.543) -- 0:02:35
309000 -- [-652.551] (-657.633) (-652.987) (-657.621) * [-656.346] (-654.387) (-664.323) (-650.036) -- 0:02:36
310000 -- (-656.087) (-656.371) (-663.521) [-648.011] * (-651.389) (-651.130) [-657.206] (-652.241) -- 0:02:35
Average standard deviation of split frequencies: 0.013151
311000 -- (-646.629) (-646.484) [-655.959] (-649.706) * (-660.829) (-651.246) (-664.243) [-658.624] -- 0:02:35
312000 -- (-654.385) (-650.718) (-657.513) [-646.668] * (-662.123) (-649.636) (-661.188) [-657.217] -- 0:02:34
313000 -- (-653.940) (-649.005) (-666.169) [-649.905] * (-653.620) (-653.757) [-652.394] (-649.741) -- 0:02:35
314000 -- [-645.544] (-652.041) (-656.534) (-655.816) * (-664.347) [-664.776] (-661.002) (-659.274) -- 0:02:35
315000 -- (-656.688) (-671.276) (-653.324) [-651.099] * (-657.839) (-649.739) [-649.019] (-657.757) -- 0:02:34
Average standard deviation of split frequencies: 0.012929
316000 -- [-658.646] (-657.058) (-660.063) (-651.209) * [-655.352] (-654.223) (-652.104) (-654.741) -- 0:02:33
317000 -- (-655.594) (-658.234) [-650.591] (-654.433) * (-662.421) [-651.793] (-667.425) (-652.987) -- 0:02:32
318000 -- (-666.719) (-654.043) [-654.938] (-651.020) * (-661.290) (-651.768) [-646.176] (-656.943) -- 0:02:34
319000 -- (-657.767) (-650.225) (-647.403) [-651.488] * (-660.245) (-661.109) (-652.756) [-652.442] -- 0:02:33
320000 -- (-661.843) (-655.074) (-655.007) [-650.371] * (-650.470) (-660.381) [-654.801] (-650.786) -- 0:02:33
Average standard deviation of split frequencies: 0.012839
321000 -- (-660.709) (-653.274) (-648.897) [-649.566] * (-650.570) (-655.538) [-655.477] (-663.622) -- 0:02:32
322000 -- (-666.108) [-655.893] (-650.092) (-654.040) * (-664.876) [-647.472] (-652.096) (-653.990) -- 0:02:33
323000 -- (-662.108) (-647.905) (-651.581) [-649.487] * (-664.238) (-649.513) [-649.429] (-649.401) -- 0:02:33
324000 -- (-661.864) (-650.410) [-650.018] (-654.258) * (-657.419) (-650.580) [-647.767] (-654.858) -- 0:02:32
325000 -- (-663.429) [-649.740] (-650.213) (-645.860) * (-652.463) (-654.908) (-666.764) [-655.955] -- 0:02:31
Average standard deviation of split frequencies: 0.012725
326000 -- (-665.195) (-653.524) [-644.758] (-654.627) * (-651.905) (-649.039) [-656.170] (-650.795) -- 0:02:32
327000 -- (-659.103) [-653.239] (-655.697) (-651.598) * [-653.016] (-651.592) (-652.064) (-650.608) -- 0:02:32
328000 -- (-666.085) (-650.444) [-649.930] (-661.162) * (-652.860) [-660.379] (-658.407) (-658.208) -- 0:02:31
329000 -- (-653.373) (-651.985) [-650.465] (-653.681) * (-649.675) [-649.954] (-657.607) (-662.021) -- 0:02:30
330000 -- (-658.511) (-652.243) (-649.881) [-648.446] * (-665.484) [-654.777] (-657.079) (-654.547) -- 0:02:30
Average standard deviation of split frequencies: 0.011310
331000 -- (-658.758) (-656.918) [-659.535] (-651.324) * (-655.243) (-648.348) [-650.160] (-653.875) -- 0:02:31
332000 -- (-651.797) (-651.567) [-652.554] (-660.298) * (-649.843) [-653.968] (-648.358) (-667.922) -- 0:02:30
333000 -- (-659.644) (-656.946) [-653.148] (-660.001) * [-654.724] (-651.179) (-661.631) (-653.783) -- 0:02:30
334000 -- (-661.835) (-651.634) (-653.054) [-656.745] * (-652.489) [-648.295] (-659.779) (-666.736) -- 0:02:29
335000 -- (-654.947) (-649.063) [-653.104] (-654.340) * [-651.246] (-655.111) (-652.706) (-659.860) -- 0:02:30
Average standard deviation of split frequencies: 0.011598
336000 -- (-649.366) [-647.516] (-660.502) (-668.726) * (-654.589) (-664.543) (-648.285) [-660.832] -- 0:02:30
337000 -- [-646.775] (-655.171) (-652.260) (-657.405) * [-652.557] (-652.761) (-656.867) (-660.897) -- 0:02:29
338000 -- [-652.178] (-655.993) (-659.048) (-654.090) * [-647.201] (-654.592) (-655.989) (-657.589) -- 0:02:28
339000 -- (-649.442) (-658.026) [-653.137] (-655.401) * [-655.472] (-653.451) (-660.296) (-651.580) -- 0:02:30
340000 -- (-652.017) [-653.905] (-653.903) (-648.726) * [-650.754] (-653.520) (-656.344) (-650.746) -- 0:02:29
Average standard deviation of split frequencies: 0.012362
341000 -- (-662.424) (-652.499) (-653.180) [-655.497] * (-652.671) (-656.264) [-653.461] (-660.881) -- 0:02:28
342000 -- (-658.831) [-652.346] (-655.927) (-649.699) * (-650.996) (-665.203) [-643.398] (-648.826) -- 0:02:28
343000 -- [-649.845] (-669.007) (-656.798) (-650.153) * (-655.133) (-655.336) [-650.996] (-653.070) -- 0:02:29
344000 -- (-648.201) (-657.433) (-651.743) [-654.816] * [-651.984] (-655.103) (-649.252) (-650.071) -- 0:02:28
345000 -- [-648.929] (-655.323) (-659.712) (-649.097) * [-649.844] (-647.044) (-656.986) (-654.556) -- 0:02:28
Average standard deviation of split frequencies: 0.012716
346000 -- (-649.368) [-649.159] (-659.021) (-653.284) * (-655.570) (-653.589) (-651.138) [-651.939] -- 0:02:27
347000 -- (-651.954) (-651.790) [-652.460] (-652.440) * [-655.930] (-652.382) (-655.838) (-654.243) -- 0:02:26
348000 -- [-658.453] (-650.127) (-649.900) (-656.888) * (-661.006) (-649.588) [-652.885] (-667.661) -- 0:02:28
349000 -- (-650.544) (-651.982) (-653.794) [-646.919] * (-650.675) (-656.055) (-653.163) [-658.605] -- 0:02:27
350000 -- (-652.681) (-652.147) [-653.177] (-662.044) * (-660.316) (-656.664) [-648.748] (-655.993) -- 0:02:26
Average standard deviation of split frequencies: 0.013155
351000 -- [-649.452] (-651.894) (-659.568) (-661.945) * (-655.780) (-653.120) (-658.965) [-657.131] -- 0:02:26
352000 -- (-658.618) [-651.454] (-653.901) (-651.417) * (-654.175) (-654.110) (-653.707) [-655.747] -- 0:02:27
353000 -- (-651.770) [-655.486] (-656.492) (-651.051) * (-655.256) (-652.596) [-647.694] (-658.659) -- 0:02:26
354000 -- (-664.255) (-654.717) (-646.645) [-655.118] * [-655.043] (-658.178) (-654.077) (-656.653) -- 0:02:25
355000 -- (-662.098) (-650.982) [-648.521] (-649.679) * (-658.393) [-650.433] (-644.843) (-656.206) -- 0:02:25
Average standard deviation of split frequencies: 0.013053
356000 -- (-666.793) [-653.238] (-660.221) (-659.944) * [-652.827] (-654.277) (-652.924) (-652.507) -- 0:02:26
357000 -- [-655.210] (-648.469) (-658.065) (-660.150) * (-655.807) (-657.126) [-653.145] (-655.726) -- 0:02:25
358000 -- (-658.610) (-655.794) [-645.636] (-663.544) * (-647.749) (-649.678) [-652.371] (-657.607) -- 0:02:25
359000 -- (-652.358) (-649.892) (-654.209) [-650.833] * [-656.854] (-655.252) (-649.395) (-653.782) -- 0:02:24
360000 -- (-650.952) (-653.464) (-651.705) [-653.292] * (-652.930) (-651.731) (-650.146) [-654.166] -- 0:02:24
Average standard deviation of split frequencies: 0.013164
361000 -- (-661.199) [-651.563] (-656.100) (-654.965) * (-655.654) (-656.902) [-650.881] (-666.710) -- 0:02:25
362000 -- (-655.499) (-650.153) (-671.797) [-653.531] * [-647.666] (-652.789) (-650.110) (-659.369) -- 0:02:24
363000 -- (-661.944) [-656.912] (-653.229) (-657.230) * (-658.601) (-650.967) [-651.011] (-653.940) -- 0:02:23
364000 -- (-659.848) [-654.317] (-661.815) (-663.718) * (-651.887) (-658.627) [-648.556] (-651.984) -- 0:02:23
365000 -- (-661.842) (-654.951) (-651.821) [-649.448] * (-655.183) (-655.695) (-659.524) [-653.522] -- 0:02:24
Average standard deviation of split frequencies: 0.012972
366000 -- (-665.966) (-649.331) (-651.154) [-653.329] * (-648.068) (-664.212) (-651.006) [-648.490] -- 0:02:23
367000 -- (-655.353) (-653.362) [-649.750] (-662.112) * [-653.979] (-654.569) (-655.087) (-647.991) -- 0:02:23
368000 -- [-651.718] (-661.662) (-657.075) (-650.754) * [-652.053] (-655.823) (-659.995) (-650.017) -- 0:02:22
369000 -- (-650.578) [-660.418] (-661.292) (-662.558) * (-656.979) (-657.164) (-653.758) [-654.556] -- 0:02:23
370000 -- (-659.006) [-654.206] (-654.041) (-648.879) * [-649.457] (-647.710) (-656.523) (-651.787) -- 0:02:23
Average standard deviation of split frequencies: 0.012972
371000 -- (-648.734) (-661.061) (-648.253) [-649.395] * (-649.449) (-653.314) [-644.897] (-662.610) -- 0:02:22
372000 -- (-661.945) (-659.333) [-651.566] (-661.896) * (-653.744) [-648.382] (-654.641) (-660.859) -- 0:02:21
373000 -- (-656.303) [-657.614] (-655.337) (-657.271) * (-657.412) [-652.210] (-659.089) (-650.000) -- 0:02:21
374000 -- (-652.642) (-662.034) [-660.411] (-651.299) * (-658.945) (-644.174) (-651.343) [-651.932] -- 0:02:22
375000 -- (-650.392) (-657.998) [-652.133] (-653.320) * (-654.638) [-650.270] (-659.048) (-657.355) -- 0:02:21
Average standard deviation of split frequencies: 0.014659
376000 -- [-653.994] (-665.177) (-657.382) (-659.168) * [-652.794] (-652.020) (-660.886) (-666.438) -- 0:02:21
377000 -- (-652.379) (-656.524) (-652.782) [-651.929] * (-657.945) [-652.675] (-654.429) (-662.059) -- 0:02:20
378000 -- (-649.228) [-656.772] (-650.935) (-651.270) * (-647.375) (-655.091) [-655.530] (-654.629) -- 0:02:21
379000 -- [-649.817] (-652.731) (-652.822) (-652.898) * (-648.904) (-647.345) [-650.514] (-668.457) -- 0:02:20
380000 -- [-649.942] (-658.090) (-655.631) (-652.218) * (-652.304) [-653.640] (-660.037) (-651.419) -- 0:02:20
Average standard deviation of split frequencies: 0.014384
381000 -- [-646.948] (-652.256) (-651.153) (-657.228) * (-654.749) [-651.526] (-653.108) (-650.226) -- 0:02:19
382000 -- (-653.511) (-651.165) (-656.721) [-655.536] * [-648.975] (-654.434) (-658.158) (-653.641) -- 0:02:19
383000 -- (-649.872) (-652.903) (-658.491) [-651.540] * (-651.405) (-649.582) (-652.423) [-651.778] -- 0:02:20
384000 -- (-652.152) (-659.439) (-663.270) [-653.445] * [-646.063] (-657.051) (-653.702) (-668.125) -- 0:02:19
385000 -- (-652.710) (-650.799) [-655.291] (-646.250) * [-645.039] (-653.039) (-656.148) (-658.376) -- 0:02:18
Average standard deviation of split frequencies: 0.014248
386000 -- (-660.733) [-656.929] (-656.663) (-653.306) * (-658.167) (-655.335) [-654.721] (-659.384) -- 0:02:18
387000 -- [-653.653] (-656.871) (-653.456) (-656.253) * (-650.690) [-655.727] (-673.688) (-661.561) -- 0:02:19
388000 -- [-651.283] (-655.392) (-651.773) (-650.855) * (-655.932) (-658.798) [-655.046] (-655.276) -- 0:02:18
389000 -- [-649.924] (-659.472) (-650.431) (-653.712) * (-658.610) (-649.693) [-645.588] (-656.541) -- 0:02:18
390000 -- (-651.244) (-660.773) [-649.201] (-654.740) * (-660.739) (-659.958) [-653.343] (-655.166) -- 0:02:17
Average standard deviation of split frequencies: 0.013704
391000 -- (-656.372) (-646.519) (-653.053) [-656.903] * [-658.351] (-663.285) (-648.166) (-655.153) -- 0:02:17
392000 -- (-646.501) (-653.309) [-650.705] (-659.344) * [-644.024] (-657.626) (-658.855) (-653.154) -- 0:02:18
393000 -- (-654.194) (-659.554) [-654.292] (-653.825) * (-650.379) (-654.156) (-649.798) [-658.518] -- 0:02:17
394000 -- [-651.517] (-649.600) (-652.700) (-656.688) * (-653.064) (-660.565) [-645.599] (-662.129) -- 0:02:16
395000 -- (-651.274) [-651.764] (-651.609) (-652.993) * (-657.224) (-667.939) (-660.655) [-651.907] -- 0:02:16
Average standard deviation of split frequencies: 0.014926
396000 -- (-648.468) (-649.503) (-657.488) [-649.628] * (-661.305) (-663.599) [-649.745] (-649.525) -- 0:02:17
397000 -- [-652.089] (-649.648) (-654.848) (-654.124) * (-659.203) (-658.868) (-658.360) [-649.298] -- 0:02:16
398000 -- (-657.085) (-658.086) (-653.254) [-647.910] * (-653.214) (-654.959) (-649.407) [-646.786] -- 0:02:16
399000 -- (-657.311) (-654.135) [-653.594] (-663.020) * (-653.837) (-657.599) (-653.521) [-649.260] -- 0:02:15
400000 -- (-656.095) (-651.983) (-667.660) [-650.826] * (-652.653) (-659.363) [-646.980] (-650.477) -- 0:02:15
Average standard deviation of split frequencies: 0.015205
401000 -- [-647.966] (-650.427) (-652.068) (-656.755) * (-668.404) [-657.486] (-650.465) (-651.329) -- 0:02:15
402000 -- (-653.139) [-647.484] (-650.047) (-653.582) * (-663.087) [-656.126] (-647.945) (-657.656) -- 0:02:15
403000 -- (-660.323) (-655.176) [-649.346] (-650.646) * (-651.276) (-660.976) (-650.063) [-652.128] -- 0:02:14
404000 -- [-655.516] (-651.934) (-651.564) (-651.613) * (-654.306) (-652.381) [-648.990] (-661.486) -- 0:02:14
405000 -- (-659.492) [-658.418] (-650.315) (-660.985) * [-649.081] (-653.222) (-656.980) (-655.274) -- 0:02:15
Average standard deviation of split frequencies: 0.014265
406000 -- [-653.986] (-651.147) (-654.942) (-650.606) * (-658.060) (-656.186) [-648.845] (-661.539) -- 0:02:14
407000 -- (-657.679) (-656.925) [-657.448] (-650.832) * (-656.017) (-650.169) [-645.877] (-659.395) -- 0:02:14
408000 -- (-654.576) (-658.355) (-655.486) [-658.365] * (-659.470) [-651.405] (-647.517) (-656.899) -- 0:02:13
409000 -- (-662.530) (-655.220) (-649.686) [-651.486] * (-663.113) (-653.196) (-648.247) [-649.555] -- 0:02:14
410000 -- [-652.645] (-658.565) (-650.349) (-653.517) * (-660.310) (-645.325) (-650.312) [-655.725] -- 0:02:13
Average standard deviation of split frequencies: 0.014759
411000 -- (-663.601) (-654.681) [-649.356] (-651.887) * (-652.297) (-659.280) [-651.271] (-654.422) -- 0:02:13
412000 -- (-660.387) (-651.400) (-652.988) [-650.980] * (-657.897) (-662.782) [-650.266] (-657.716) -- 0:02:12
413000 -- (-660.534) [-652.144] (-659.793) (-649.131) * [-653.240] (-652.097) (-653.466) (-654.781) -- 0:02:12
414000 -- (-669.354) (-658.592) [-647.949] (-659.166) * (-655.229) (-658.423) [-652.917] (-654.080) -- 0:02:13
415000 -- (-657.198) (-661.783) (-652.114) [-652.597] * (-661.178) (-649.931) [-651.190] (-661.049) -- 0:02:12
Average standard deviation of split frequencies: 0.014812
416000 -- (-659.503) (-653.669) [-649.060] (-652.522) * (-664.340) (-652.302) [-650.998] (-647.045) -- 0:02:11
417000 -- (-652.603) (-661.281) (-650.114) [-652.190] * (-650.271) [-654.191] (-650.578) (-649.687) -- 0:02:11
418000 -- (-673.392) (-651.001) (-648.703) [-652.446] * (-650.994) (-653.931) (-652.407) [-649.571] -- 0:02:12
419000 -- (-661.337) (-655.266) (-653.311) [-652.021] * (-657.266) (-653.863) [-653.617] (-660.393) -- 0:02:11
420000 -- [-651.409] (-668.381) (-649.239) (-655.382) * [-656.102] (-654.101) (-667.186) (-651.686) -- 0:02:11
Average standard deviation of split frequencies: 0.014888
421000 -- (-654.634) (-674.802) (-654.409) [-652.023] * (-653.972) (-648.165) [-648.307] (-652.805) -- 0:02:10
422000 -- (-647.525) (-652.104) [-650.787] (-650.026) * (-652.151) (-652.748) [-649.495] (-650.480) -- 0:02:10
423000 -- (-645.557) (-658.025) (-653.320) [-650.528] * (-654.157) (-652.426) [-656.452] (-650.074) -- 0:02:10
424000 -- (-659.083) (-655.538) [-645.054] (-659.030) * (-654.136) (-658.218) [-647.730] (-653.769) -- 0:02:10
425000 -- (-661.081) (-657.416) (-655.197) [-654.348] * (-653.644) [-650.852] (-655.236) (-653.902) -- 0:02:09
Average standard deviation of split frequencies: 0.014465
426000 -- [-653.588] (-649.776) (-651.956) (-660.139) * (-653.229) (-650.296) (-652.405) [-646.318] -- 0:02:09
427000 -- (-663.307) (-657.076) [-652.681] (-651.861) * (-658.684) (-660.183) (-654.789) [-651.747] -- 0:02:10
428000 -- (-660.295) (-650.337) [-650.094] (-652.345) * [-660.122] (-650.983) (-665.270) (-656.975) -- 0:02:09
429000 -- (-654.939) [-654.954] (-650.253) (-653.728) * (-650.494) (-661.298) [-650.654] (-650.032) -- 0:02:09
430000 -- (-657.908) (-655.223) [-652.056] (-645.731) * (-661.461) (-655.310) [-649.901] (-650.746) -- 0:02:08
Average standard deviation of split frequencies: 0.014152
431000 -- (-653.156) (-654.454) (-665.326) [-650.785] * (-655.285) (-655.018) [-653.095] (-651.824) -- 0:02:08
432000 -- (-651.612) [-654.708] (-654.847) (-654.980) * [-652.667] (-646.472) (-657.043) (-650.367) -- 0:02:08
433000 -- (-649.357) [-651.267] (-655.185) (-654.637) * (-665.107) (-651.879) [-653.469] (-647.421) -- 0:02:08
434000 -- [-649.481] (-651.187) (-662.610) (-654.205) * (-664.971) (-655.471) (-659.185) [-648.784] -- 0:02:07
435000 -- (-659.617) (-653.712) (-649.020) [-651.775] * (-661.612) (-651.741) (-652.983) [-648.263] -- 0:02:07
Average standard deviation of split frequencies: 0.013747
436000 -- (-651.868) (-654.713) [-650.439] (-661.757) * (-655.336) [-651.556] (-661.923) (-652.806) -- 0:02:08
437000 -- (-664.838) [-651.975] (-646.427) (-653.380) * (-662.770) [-648.479] (-656.916) (-659.655) -- 0:02:07
438000 -- (-650.939) (-653.644) (-647.025) [-652.386] * (-668.036) [-651.365] (-656.874) (-658.869) -- 0:02:07
439000 -- (-652.768) (-649.341) (-654.222) [-653.098] * (-663.626) (-647.914) [-651.907] (-650.822) -- 0:02:06
440000 -- (-646.458) [-651.447] (-654.772) (-656.939) * (-662.039) [-650.291] (-650.153) (-654.096) -- 0:02:07
Average standard deviation of split frequencies: 0.013372
441000 -- (-657.872) (-657.798) [-658.989] (-651.044) * (-660.940) (-658.720) (-655.900) [-651.736] -- 0:02:06
442000 -- (-651.609) (-656.724) [-658.825] (-649.138) * (-650.011) (-651.352) (-661.082) [-650.182] -- 0:02:06
443000 -- [-651.118] (-650.890) (-658.193) (-653.392) * [-651.633] (-661.529) (-658.760) (-652.120) -- 0:02:05
444000 -- (-656.954) (-653.707) [-655.035] (-663.285) * (-661.237) (-651.263) (-659.601) [-656.489] -- 0:02:05
445000 -- (-656.781) (-660.332) [-649.786] (-650.544) * (-659.007) (-650.502) [-655.534] (-663.005) -- 0:02:05
Average standard deviation of split frequencies: 0.013212
446000 -- (-654.352) (-662.411) [-650.770] (-652.086) * (-659.699) [-656.702] (-656.829) (-653.215) -- 0:02:05
447000 -- (-652.803) (-655.425) (-653.933) [-651.438] * [-652.864] (-652.614) (-655.069) (-646.794) -- 0:02:04
448000 -- [-652.291] (-660.557) (-655.620) (-658.760) * [-651.238] (-653.191) (-655.572) (-648.415) -- 0:02:04
449000 -- (-656.371) (-662.993) (-662.439) [-647.997] * (-660.419) (-651.372) (-658.374) [-649.953] -- 0:02:05
450000 -- (-649.618) (-653.854) [-650.346] (-650.810) * (-659.836) (-655.362) (-665.584) [-648.126] -- 0:02:04
Average standard deviation of split frequencies: 0.013225
451000 -- (-649.975) [-653.687] (-648.065) (-653.668) * (-657.602) (-653.415) [-656.309] (-653.505) -- 0:02:04
452000 -- (-651.071) (-658.616) (-650.697) [-650.692] * (-659.947) (-656.368) [-656.870] (-652.059) -- 0:02:03
453000 -- (-655.250) (-658.184) (-653.646) [-657.679] * [-646.752] (-654.267) (-652.111) (-660.080) -- 0:02:03
454000 -- [-647.802] (-659.713) (-649.674) (-651.741) * (-657.585) (-649.892) (-657.527) [-653.753] -- 0:02:03
455000 -- [-652.387] (-648.880) (-651.542) (-653.715) * [-652.917] (-670.588) (-647.925) (-651.085) -- 0:02:03
Average standard deviation of split frequencies: 0.013218
456000 -- [-651.664] (-653.085) (-666.683) (-650.834) * (-652.840) [-650.115] (-674.785) (-661.064) -- 0:02:02
457000 -- [-657.430] (-654.609) (-653.532) (-650.805) * [-651.660] (-650.967) (-666.918) (-655.471) -- 0:02:02
458000 -- [-655.949] (-656.435) (-655.878) (-656.747) * (-655.402) (-650.958) (-654.905) [-647.314] -- 0:02:03
459000 -- (-652.057) [-652.791] (-654.231) (-652.323) * (-655.405) (-652.926) (-658.821) [-657.308] -- 0:02:02
460000 -- (-657.453) (-650.174) [-651.126] (-673.224) * (-653.380) [-650.416] (-654.278) (-652.995) -- 0:02:02
Average standard deviation of split frequencies: 0.013157
461000 -- (-652.996) (-655.105) (-650.599) [-652.366] * (-660.515) (-654.597) [-648.642] (-652.413) -- 0:02:01
462000 -- (-664.825) [-648.485] (-654.283) (-659.914) * (-653.659) [-646.493] (-669.115) (-653.996) -- 0:02:02
463000 -- (-648.684) (-646.955) (-651.914) [-648.741] * (-656.638) (-655.664) [-654.286] (-648.434) -- 0:02:01
464000 -- (-654.663) [-650.062] (-649.629) (-655.218) * (-658.483) (-648.396) [-659.310] (-651.189) -- 0:02:01
465000 -- (-656.560) (-653.618) (-651.031) [-647.103] * (-653.460) (-661.965) [-650.028] (-649.907) -- 0:02:00
Average standard deviation of split frequencies: 0.013440
466000 -- (-652.872) [-651.907] (-660.692) (-659.964) * (-660.405) (-656.207) [-658.820] (-655.167) -- 0:02:00
467000 -- (-661.389) [-647.858] (-650.435) (-659.522) * (-652.884) (-664.600) [-650.114] (-655.206) -- 0:02:00
468000 -- (-656.576) (-653.335) [-657.060] (-654.239) * (-650.465) (-651.845) [-651.173] (-650.401) -- 0:02:00
469000 -- (-658.343) (-657.074) (-651.258) [-647.965] * (-650.631) (-654.148) [-653.097] (-648.262) -- 0:02:00
470000 -- (-657.343) (-657.134) [-652.059] (-659.753) * (-648.166) (-655.294) [-653.638] (-653.112) -- 0:01:59
Average standard deviation of split frequencies: 0.013163
471000 -- (-667.357) (-657.188) [-649.957] (-654.058) * (-647.729) [-653.692] (-656.360) (-645.034) -- 0:02:00
472000 -- (-661.892) (-654.429) (-653.758) [-651.028] * (-651.999) (-653.938) (-657.083) [-650.654] -- 0:01:59
473000 -- (-662.119) (-659.481) (-659.701) [-647.602] * (-661.270) (-658.249) (-653.201) [-648.481] -- 0:01:59
474000 -- [-650.169] (-656.655) (-654.112) (-655.502) * [-656.117] (-665.728) (-657.769) (-656.124) -- 0:01:58
475000 -- [-652.281] (-655.396) (-650.959) (-659.880) * [-648.148] (-668.708) (-659.553) (-650.893) -- 0:01:59
Average standard deviation of split frequencies: 0.011884
476000 -- [-655.949] (-656.117) (-651.626) (-660.099) * [-647.074] (-671.568) (-657.185) (-649.753) -- 0:01:58
477000 -- (-660.325) (-661.071) (-652.449) [-650.654] * (-655.265) (-665.736) (-651.856) [-648.190] -- 0:01:58
478000 -- (-647.174) (-663.735) [-653.256] (-657.544) * (-660.647) (-659.485) [-655.137] (-646.778) -- 0:01:57
479000 -- (-655.436) (-650.506) [-656.029] (-658.731) * (-661.859) (-661.841) (-654.977) [-653.174] -- 0:01:57
480000 -- (-657.031) (-655.298) [-653.412] (-659.428) * (-648.048) (-659.257) [-654.201] (-659.289) -- 0:01:58
Average standard deviation of split frequencies: 0.011769
481000 -- (-668.449) [-648.834] (-664.628) (-651.180) * (-648.796) (-660.435) (-657.853) [-648.994] -- 0:01:57
482000 -- (-655.538) (-650.334) (-652.777) [-648.128] * (-652.188) (-655.994) (-657.208) [-653.323] -- 0:01:57
483000 -- (-650.016) (-661.365) (-655.720) [-651.798] * (-653.392) (-656.705) (-650.451) [-651.425] -- 0:01:56
484000 -- (-648.890) [-649.245] (-659.513) (-653.287) * (-654.675) (-656.214) [-647.748] (-651.411) -- 0:01:57
485000 -- [-649.984] (-654.317) (-660.321) (-657.800) * (-651.055) [-653.520] (-658.135) (-657.556) -- 0:01:56
Average standard deviation of split frequencies: 0.011917
486000 -- (-653.208) [-650.800] (-651.132) (-657.238) * (-648.192) (-652.329) (-649.607) [-650.585] -- 0:01:56
487000 -- (-650.532) [-653.628] (-646.985) (-652.477) * (-655.461) [-652.109] (-651.242) (-665.514) -- 0:01:55
488000 -- [-644.353] (-650.522) (-664.455) (-649.520) * (-660.082) (-659.554) [-649.653] (-659.178) -- 0:01:55
489000 -- (-654.456) (-664.902) (-655.019) [-655.641] * [-646.853] (-656.751) (-653.900) (-659.749) -- 0:01:55
490000 -- (-651.392) (-659.647) [-651.007] (-650.845) * [-646.560] (-653.382) (-652.411) (-656.197) -- 0:01:55
Average standard deviation of split frequencies: 0.011529
491000 -- (-659.618) (-654.801) (-650.037) [-653.454] * (-646.908) (-650.899) (-651.858) [-650.375] -- 0:01:55
492000 -- [-651.105] (-652.084) (-655.963) (-654.144) * [-656.742] (-645.279) (-656.351) (-653.238) -- 0:01:54
493000 -- (-652.474) (-659.421) [-651.775] (-669.915) * (-650.662) [-651.377] (-657.662) (-651.204) -- 0:01:55
494000 -- (-653.704) (-652.336) [-646.970] (-662.403) * (-655.704) (-656.308) [-648.268] (-652.196) -- 0:01:54
495000 -- (-646.811) [-653.747] (-654.851) (-658.158) * (-668.367) [-648.546] (-655.284) (-657.776) -- 0:01:54
Average standard deviation of split frequencies: 0.012152
496000 -- (-661.466) (-658.090) (-645.635) [-651.657] * (-652.741) (-652.356) [-658.583] (-656.722) -- 0:01:53
497000 -- (-673.493) (-653.366) [-651.449] (-656.279) * (-658.067) [-652.658] (-650.909) (-655.809) -- 0:01:53
498000 -- [-651.491] (-661.536) (-647.909) (-652.805) * (-654.282) [-648.622] (-653.634) (-654.122) -- 0:01:53
499000 -- (-656.130) (-654.991) [-660.142] (-653.693) * [-648.262] (-647.983) (-649.037) (-648.998) -- 0:01:53
500000 -- (-654.928) (-652.290) (-660.419) [-651.952] * (-648.483) (-652.458) (-652.021) [-651.912] -- 0:01:53
Average standard deviation of split frequencies: 0.011904
501000 -- [-653.330] (-657.524) (-652.188) (-657.472) * [-655.570] (-649.545) (-652.536) (-657.565) -- 0:01:52
502000 -- (-660.538) [-658.073] (-656.337) (-653.853) * (-659.018) (-652.483) (-653.624) [-647.375] -- 0:01:53
503000 -- (-666.354) (-653.236) [-656.348] (-647.299) * (-651.247) (-654.251) [-654.541] (-646.927) -- 0:01:52
504000 -- [-656.863] (-653.650) (-652.108) (-665.199) * (-659.160) [-650.090] (-653.310) (-665.296) -- 0:01:52
505000 -- [-654.915] (-656.884) (-653.624) (-651.238) * [-649.059] (-656.463) (-649.964) (-649.061) -- 0:01:51
Average standard deviation of split frequencies: 0.012111
506000 -- (-653.145) [-650.079] (-652.261) (-651.959) * [-654.446] (-656.606) (-655.896) (-648.580) -- 0:01:52
507000 -- (-649.741) [-651.341] (-658.342) (-673.637) * [-645.457] (-651.855) (-651.889) (-652.686) -- 0:01:51
508000 -- [-657.490] (-665.468) (-654.420) (-652.732) * (-657.016) [-646.434] (-656.901) (-655.813) -- 0:01:51
509000 -- (-651.052) (-660.681) [-652.610] (-648.905) * [-652.824] (-653.949) (-656.237) (-659.344) -- 0:01:50
510000 -- (-657.262) (-656.728) (-655.092) [-649.731] * (-654.026) (-656.168) (-651.836) [-649.564] -- 0:01:50
Average standard deviation of split frequencies: 0.011473
511000 -- (-645.996) (-662.291) (-660.137) [-651.034] * (-650.329) (-652.760) (-652.492) [-657.254] -- 0:01:51
512000 -- (-652.573) (-655.599) [-648.475] (-662.422) * (-655.838) [-656.047] (-647.520) (-658.867) -- 0:01:50
513000 -- (-652.813) (-653.270) (-653.073) [-652.532] * (-662.981) [-646.739] (-659.747) (-650.657) -- 0:01:50
514000 -- (-657.304) (-650.733) (-664.431) [-647.484] * (-665.494) [-655.591] (-654.199) (-647.892) -- 0:01:49
515000 -- (-651.446) (-651.900) [-663.179] (-655.528) * (-671.065) (-652.950) (-647.945) [-650.318] -- 0:01:50
Average standard deviation of split frequencies: 0.011550
516000 -- [-650.710] (-655.495) (-651.805) (-654.196) * (-664.428) (-652.988) [-653.929] (-653.766) -- 0:01:49
517000 -- [-651.402] (-655.252) (-653.583) (-651.312) * (-655.366) (-657.536) (-668.254) [-653.202] -- 0:01:49
518000 -- (-655.622) [-656.380] (-652.705) (-653.364) * [-661.230] (-645.207) (-655.674) (-645.064) -- 0:01:48
519000 -- [-654.529] (-658.008) (-646.400) (-650.138) * [-653.866] (-648.734) (-654.745) (-649.923) -- 0:01:49
520000 -- [-654.419] (-656.387) (-646.565) (-658.339) * (-655.688) (-653.195) (-654.235) [-652.591] -- 0:01:48
Average standard deviation of split frequencies: 0.011188
521000 -- (-655.496) [-648.521] (-660.767) (-657.750) * [-654.863] (-649.960) (-651.835) (-653.774) -- 0:01:48
522000 -- [-652.315] (-657.931) (-644.922) (-647.458) * (-654.714) (-657.641) [-653.958] (-653.102) -- 0:01:48
523000 -- (-650.964) [-655.730] (-648.029) (-657.253) * (-650.448) (-665.623) [-656.292] (-650.581) -- 0:01:47
524000 -- (-656.103) (-651.880) [-649.404] (-652.380) * (-659.515) (-659.793) [-650.402] (-651.501) -- 0:01:48
525000 -- [-652.388] (-651.994) (-651.638) (-651.470) * (-653.290) (-669.408) (-646.249) [-650.606] -- 0:01:47
Average standard deviation of split frequencies: 0.011011
526000 -- (-658.493) (-651.833) (-653.366) [-650.013] * (-656.768) (-656.712) (-655.485) [-650.803] -- 0:01:47
527000 -- (-649.417) (-651.431) [-657.993] (-658.543) * (-654.365) (-650.446) [-650.002] (-661.318) -- 0:01:46
528000 -- [-659.576] (-654.122) (-653.011) (-652.788) * [-656.584] (-658.631) (-657.159) (-665.543) -- 0:01:47
529000 -- (-648.950) [-648.828] (-652.555) (-656.638) * [-653.667] (-655.940) (-658.384) (-659.402) -- 0:01:46
530000 -- (-658.725) [-653.154] (-651.758) (-657.070) * (-651.614) (-660.156) [-648.003] (-655.307) -- 0:01:46
Average standard deviation of split frequencies: 0.010723
531000 -- (-654.119) [-646.600] (-652.000) (-656.546) * (-657.503) (-646.465) (-651.049) [-649.604] -- 0:01:45
532000 -- (-653.978) (-652.651) (-648.560) [-654.449] * (-652.610) (-657.917) (-660.149) [-647.387] -- 0:01:46
533000 -- [-653.761] (-657.660) (-648.016) (-658.342) * (-657.929) (-647.682) [-649.891] (-654.666) -- 0:01:46
534000 -- (-657.146) [-650.206] (-646.161) (-657.407) * (-657.895) [-652.124] (-651.667) (-658.248) -- 0:01:45
535000 -- [-651.540] (-645.146) (-655.377) (-654.522) * (-648.338) (-654.403) [-650.255] (-655.955) -- 0:01:45
Average standard deviation of split frequencies: 0.010554
536000 -- (-661.155) (-655.280) [-650.158] (-647.235) * (-650.343) (-666.183) (-655.679) [-651.273] -- 0:01:44
537000 -- (-661.844) (-649.543) [-647.384] (-649.194) * (-655.234) (-663.939) [-648.649] (-650.866) -- 0:01:45
538000 -- (-665.333) (-654.615) [-650.516] (-658.025) * (-658.403) (-651.732) (-653.647) [-648.676] -- 0:01:44
539000 -- (-655.831) [-651.012] (-658.210) (-650.195) * (-657.106) (-653.468) [-655.185] (-655.241) -- 0:01:44
540000 -- (-652.354) (-648.491) (-654.108) [-652.245] * (-656.799) (-652.230) (-667.129) [-650.885] -- 0:01:43
Average standard deviation of split frequencies: 0.011023
541000 -- (-648.985) [-650.856] (-654.081) (-668.553) * (-650.738) (-655.466) (-656.459) [-654.732] -- 0:01:44
542000 -- (-654.418) [-647.876] (-650.528) (-653.158) * (-657.021) [-650.336] (-655.110) (-653.436) -- 0:01:43
543000 -- (-655.222) [-653.273] (-649.673) (-647.297) * [-647.500] (-651.460) (-656.329) (-654.610) -- 0:01:43
544000 -- [-653.155] (-644.117) (-654.410) (-653.132) * (-652.129) [-654.476] (-665.894) (-663.292) -- 0:01:43
545000 -- (-650.411) (-656.222) [-654.870] (-653.765) * (-658.066) (-646.167) (-664.742) [-644.401] -- 0:01:42
Average standard deviation of split frequencies: 0.011409
546000 -- (-653.367) (-649.871) [-659.688] (-660.712) * (-662.200) [-650.026] (-652.532) (-647.482) -- 0:01:43
547000 -- (-661.012) (-649.469) [-655.735] (-657.504) * (-647.335) (-659.383) (-658.649) [-652.648] -- 0:01:42
548000 -- (-655.623) (-648.967) (-668.980) [-652.630] * (-651.106) (-652.125) [-651.659] (-663.518) -- 0:01:42
549000 -- (-657.287) [-651.031] (-662.372) (-656.713) * (-655.858) [-647.829] (-661.392) (-659.989) -- 0:01:41
550000 -- (-665.921) (-651.677) (-652.210) [-646.782] * (-658.023) [-653.551] (-658.541) (-650.762) -- 0:01:42
Average standard deviation of split frequencies: 0.010945
551000 -- (-649.859) [-654.850] (-650.110) (-656.816) * (-654.338) [-646.567] (-664.388) (-656.697) -- 0:01:41
552000 -- [-654.502] (-650.858) (-655.473) (-660.893) * (-650.177) (-656.976) [-651.124] (-657.851) -- 0:01:41
553000 -- [-652.086] (-652.621) (-648.202) (-662.585) * [-653.439] (-664.409) (-659.072) (-651.479) -- 0:01:41
554000 -- (-656.598) [-648.008] (-644.349) (-655.760) * (-656.203) (-659.781) (-655.715) [-655.983] -- 0:01:40
555000 -- (-651.910) [-658.621] (-652.590) (-662.717) * (-656.685) (-647.643) (-660.821) [-654.889] -- 0:01:41
Average standard deviation of split frequencies: 0.010235
556000 -- (-654.116) (-656.681) (-651.950) [-650.551] * (-657.051) [-646.357] (-662.136) (-651.662) -- 0:01:40
557000 -- (-650.623) (-652.384) (-656.150) [-649.624] * (-650.380) (-657.844) [-650.729] (-653.525) -- 0:01:40
558000 -- (-655.024) [-650.609] (-654.130) (-656.833) * (-654.050) (-659.487) [-653.312] (-652.380) -- 0:01:39
559000 -- (-652.542) (-647.250) [-654.169] (-651.068) * (-648.392) (-657.976) (-655.114) [-653.362] -- 0:01:40
560000 -- (-661.153) (-656.120) [-652.776] (-658.853) * (-648.907) [-647.191] (-655.316) (-656.886) -- 0:01:39
Average standard deviation of split frequencies: 0.009489
561000 -- (-656.460) (-651.681) [-655.553] (-660.511) * (-654.584) (-653.427) [-652.434] (-652.428) -- 0:01:39
562000 -- (-656.030) (-650.567) [-649.793] (-652.057) * [-651.207] (-651.119) (-660.783) (-655.035) -- 0:01:38
563000 -- (-657.932) (-658.237) (-649.068) [-652.740] * (-656.514) (-659.404) [-657.276] (-659.422) -- 0:01:38
564000 -- (-655.877) (-654.960) (-649.939) [-645.731] * (-655.909) (-656.317) [-645.981] (-661.112) -- 0:01:38
565000 -- (-651.702) (-656.282) (-647.389) [-646.642] * (-655.070) (-646.634) (-659.709) [-651.908] -- 0:01:38
Average standard deviation of split frequencies: 0.009994
566000 -- [-651.429] (-650.061) (-648.478) (-649.092) * (-654.149) (-655.958) (-656.415) [-653.537] -- 0:01:38
567000 -- [-655.824] (-652.243) (-645.477) (-652.765) * (-658.625) (-651.311) (-649.350) [-647.110] -- 0:01:37
568000 -- (-647.118) (-650.437) [-649.966] (-648.560) * (-651.033) (-645.480) (-654.024) [-649.009] -- 0:01:38
569000 -- (-651.709) [-648.718] (-658.355) (-647.303) * (-653.965) (-665.735) (-657.026) [-646.727] -- 0:01:37
570000 -- [-649.955] (-652.861) (-651.814) (-652.143) * [-647.670] (-659.915) (-651.843) (-651.240) -- 0:01:37
Average standard deviation of split frequencies: 0.010208
571000 -- (-656.419) (-646.901) (-668.665) [-654.714] * (-654.084) [-651.128] (-648.923) (-657.789) -- 0:01:36
572000 -- (-652.032) [-647.576] (-657.855) (-654.984) * (-660.358) (-655.866) [-651.187] (-654.456) -- 0:01:36
573000 -- (-650.475) (-649.999) (-655.901) [-646.484] * (-648.914) [-650.324] (-653.973) (-651.414) -- 0:01:36
574000 -- (-660.619) (-649.288) (-654.788) [-651.001] * [-650.502] (-653.563) (-655.206) (-648.760) -- 0:01:36
575000 -- (-658.748) (-647.870) (-647.134) [-656.830] * [-647.015] (-654.257) (-654.915) (-652.525) -- 0:01:36
Average standard deviation of split frequencies: 0.009821
576000 -- (-653.405) [-651.810] (-652.662) (-647.638) * (-653.044) (-652.907) (-658.530) [-647.382] -- 0:01:35
577000 -- (-659.421) [-655.243] (-648.730) (-656.162) * (-655.822) (-653.705) [-649.105] (-653.486) -- 0:01:36
578000 -- [-651.119] (-656.357) (-657.259) (-648.042) * (-653.367) [-651.116] (-656.182) (-655.518) -- 0:01:35
579000 -- (-658.547) [-655.314] (-655.372) (-655.201) * (-662.179) (-659.593) (-653.739) [-653.723] -- 0:01:35
580000 -- (-653.205) [-651.964] (-659.910) (-654.523) * [-652.426] (-661.588) (-646.093) (-650.437) -- 0:01:34
Average standard deviation of split frequencies: 0.010032
581000 -- (-655.645) [-660.030] (-659.708) (-660.608) * (-655.304) (-660.682) [-647.163] (-654.861) -- 0:01:34
582000 -- [-654.496] (-655.198) (-668.550) (-646.740) * (-650.600) (-653.204) (-647.348) [-656.770] -- 0:01:34
583000 -- (-651.963) (-654.535) (-654.177) [-651.704] * (-647.597) (-658.565) [-651.017] (-659.123) -- 0:01:34
584000 -- (-648.577) [-654.484] (-661.818) (-656.844) * (-652.871) (-658.871) (-656.117) [-652.434] -- 0:01:34
585000 -- [-652.122] (-654.174) (-654.462) (-660.553) * (-657.173) [-649.286] (-659.506) (-653.877) -- 0:01:33
Average standard deviation of split frequencies: 0.009941
586000 -- (-648.973) (-659.359) [-648.612] (-657.851) * (-656.603) [-653.119] (-654.759) (-654.516) -- 0:01:33
587000 -- (-655.559) (-654.118) (-659.689) [-655.372] * [-648.907] (-664.872) (-654.812) (-657.905) -- 0:01:33
588000 -- (-648.058) [-654.241] (-656.153) (-652.363) * (-650.668) (-657.884) [-648.735] (-653.425) -- 0:01:33
589000 -- (-647.696) (-655.397) [-647.152] (-653.976) * (-652.723) (-655.117) [-648.556] (-652.820) -- 0:01:32
590000 -- [-648.803] (-662.777) (-656.619) (-656.214) * (-654.452) (-659.653) (-649.169) [-644.597] -- 0:01:32
Average standard deviation of split frequencies: 0.009634
591000 -- (-651.243) (-659.054) [-648.390] (-647.691) * (-656.711) (-647.680) (-653.527) [-650.742] -- 0:01:32
592000 -- (-659.129) (-666.467) (-651.347) [-655.022] * [-661.506] (-647.865) (-654.359) (-650.619) -- 0:01:32
593000 -- (-649.265) (-648.438) (-656.461) [-646.209] * (-652.149) (-658.974) (-650.783) [-658.990] -- 0:01:31
594000 -- (-652.216) (-654.593) (-649.168) [-646.732] * [-648.170] (-648.661) (-645.643) (-654.769) -- 0:01:31
595000 -- (-651.555) [-654.610] (-652.376) (-651.577) * (-655.683) (-646.508) [-647.785] (-658.038) -- 0:01:31
Average standard deviation of split frequencies: 0.009830
596000 -- (-646.549) (-660.559) (-670.575) [-651.392] * (-650.234) [-646.751] (-657.289) (-649.798) -- 0:01:31
597000 -- [-653.516] (-660.529) (-659.194) (-655.300) * [-647.509] (-651.062) (-651.632) (-655.661) -- 0:01:31
598000 -- [-651.245] (-663.774) (-653.263) (-654.728) * [-654.101] (-656.894) (-650.478) (-650.766) -- 0:01:30
599000 -- (-651.390) (-650.496) [-651.135] (-652.750) * (-650.887) (-651.968) [-656.687] (-652.875) -- 0:01:30
600000 -- (-656.898) (-651.646) (-662.740) [-654.274] * (-656.748) [-657.206] (-651.015) (-653.471) -- 0:01:30
Average standard deviation of split frequencies: 0.009418
601000 -- (-658.725) [-651.986] (-662.505) (-653.942) * (-654.163) (-658.684) (-652.708) [-653.925] -- 0:01:30
602000 -- [-651.432] (-647.934) (-653.971) (-652.912) * (-660.447) (-651.650) [-650.178] (-651.907) -- 0:01:29
603000 -- (-655.268) (-656.652) [-655.035] (-659.023) * (-667.619) (-652.930) [-646.981] (-652.998) -- 0:01:29
604000 -- (-659.918) (-658.484) (-650.225) [-652.688] * (-657.054) (-649.252) (-668.681) [-645.468] -- 0:01:29
605000 -- [-652.062] (-654.817) (-647.434) (-666.694) * (-651.377) (-650.712) [-652.282] (-659.254) -- 0:01:29
Average standard deviation of split frequencies: 0.009779
606000 -- [-661.359] (-658.265) (-659.030) (-651.666) * (-652.913) [-648.022] (-656.590) (-651.670) -- 0:01:29
607000 -- (-659.234) [-654.710] (-659.840) (-654.649) * [-651.694] (-649.343) (-654.141) (-656.367) -- 0:01:28
608000 -- (-655.436) (-650.250) (-651.082) [-650.009] * [-656.841] (-648.586) (-658.304) (-655.002) -- 0:01:28
609000 -- (-660.879) [-652.547] (-663.862) (-654.527) * (-650.312) (-654.668) [-646.256] (-654.948) -- 0:01:28
610000 -- (-650.463) (-654.182) [-650.774] (-649.256) * (-651.232) [-650.374] (-650.431) (-664.224) -- 0:01:28
Average standard deviation of split frequencies: 0.010476
611000 -- [-647.855] (-660.429) (-657.130) (-647.254) * (-650.886) (-663.960) [-661.413] (-650.707) -- 0:01:27
612000 -- (-653.618) [-651.970] (-652.985) (-657.138) * (-654.459) [-649.189] (-656.192) (-656.683) -- 0:01:27
613000 -- (-654.899) (-653.999) [-654.304] (-653.952) * (-655.118) [-652.374] (-652.959) (-660.734) -- 0:01:27
614000 -- (-647.555) [-650.970] (-658.727) (-653.681) * (-648.949) (-652.856) [-650.752] (-658.852) -- 0:01:27
615000 -- (-655.618) (-655.046) [-651.833] (-659.293) * [-652.152] (-672.819) (-654.732) (-653.980) -- 0:01:27
Average standard deviation of split frequencies: 0.010276
616000 -- (-663.301) (-657.499) (-653.070) [-659.733] * (-654.152) (-660.685) (-654.324) [-651.259] -- 0:01:26
617000 -- (-656.630) [-652.148] (-652.391) (-646.165) * (-654.504) [-657.228] (-664.838) (-658.526) -- 0:01:26
618000 -- (-655.071) [-653.764] (-653.209) (-648.007) * (-654.805) [-651.365] (-663.307) (-654.589) -- 0:01:26
619000 -- [-647.240] (-657.413) (-651.321) (-650.982) * (-660.202) [-655.841] (-651.984) (-656.062) -- 0:01:26
620000 -- (-659.484) [-649.930] (-650.812) (-652.162) * (-656.039) (-650.934) (-648.803) [-652.835] -- 0:01:25
Average standard deviation of split frequencies: 0.010308
621000 -- [-649.017] (-653.318) (-652.776) (-651.148) * [-654.574] (-651.208) (-654.468) (-653.582) -- 0:01:25
622000 -- (-657.925) [-651.380] (-652.679) (-655.246) * (-661.731) (-648.041) [-652.864] (-650.532) -- 0:01:25
623000 -- (-652.108) (-658.514) [-648.260] (-657.650) * (-656.931) (-650.434) [-651.024] (-660.204) -- 0:01:25
624000 -- (-652.716) (-648.749) [-652.998] (-650.352) * (-659.351) [-650.713] (-655.830) (-658.594) -- 0:01:24
625000 -- (-653.429) (-650.800) [-648.544] (-651.312) * (-657.172) [-656.467] (-663.052) (-655.149) -- 0:01:24
Average standard deviation of split frequencies: 0.010489
626000 -- (-648.262) (-653.634) (-654.354) [-651.482] * (-651.482) (-652.179) (-650.945) [-643.680] -- 0:01:24
627000 -- (-652.858) [-652.741] (-661.934) (-648.360) * (-650.353) [-650.615] (-653.694) (-666.083) -- 0:01:24
628000 -- (-657.844) (-650.242) [-650.283] (-653.236) * (-666.047) [-652.146] (-658.758) (-649.430) -- 0:01:24
629000 -- (-645.586) (-656.516) (-658.242) [-648.001] * (-660.645) (-650.011) (-659.061) [-653.753] -- 0:01:23
630000 -- [-655.429] (-650.187) (-654.844) (-653.212) * (-657.281) (-657.281) (-654.000) [-649.303] -- 0:01:23
Average standard deviation of split frequencies: 0.010785
631000 -- (-653.763) (-649.744) (-652.770) [-650.650] * (-654.357) [-651.625] (-655.539) (-656.672) -- 0:01:23
632000 -- (-656.007) (-662.133) [-653.451] (-654.154) * [-648.490] (-652.831) (-656.427) (-657.405) -- 0:01:23
633000 -- (-658.840) [-650.077] (-652.962) (-644.169) * (-659.456) [-660.225] (-649.114) (-664.620) -- 0:01:22
634000 -- [-648.808] (-657.972) (-655.801) (-648.273) * [-656.745] (-659.712) (-649.271) (-654.282) -- 0:01:22
635000 -- (-653.083) (-651.681) (-651.075) [-649.773] * [-653.629] (-649.129) (-658.056) (-654.479) -- 0:01:22
Average standard deviation of split frequencies: 0.010589
636000 -- (-666.730) [-653.575] (-655.512) (-656.140) * (-651.932) (-652.708) [-653.880] (-652.660) -- 0:01:22
637000 -- (-651.755) (-652.203) [-648.228] (-662.645) * (-656.354) (-654.989) (-660.393) [-655.133] -- 0:01:22
638000 -- (-650.806) (-650.223) [-648.025] (-652.404) * [-654.548] (-655.833) (-657.323) (-652.992) -- 0:01:21
639000 -- [-650.152] (-649.939) (-649.509) (-652.457) * (-650.837) (-646.280) (-665.041) [-656.156] -- 0:01:21
640000 -- (-651.353) [-652.273] (-660.268) (-660.978) * [-654.516] (-654.673) (-654.387) (-652.937) -- 0:01:21
Average standard deviation of split frequencies: 0.010091
641000 -- (-653.001) [-656.135] (-652.669) (-652.114) * (-654.721) [-658.286] (-654.516) (-655.327) -- 0:01:21
642000 -- (-653.709) (-655.718) (-651.459) [-654.318] * (-656.577) (-649.570) (-657.731) [-650.002] -- 0:01:20
643000 -- (-653.162) (-650.751) [-651.693] (-654.819) * [-648.157] (-655.837) (-650.971) (-651.092) -- 0:01:20
644000 -- (-650.102) [-659.676] (-654.523) (-651.141) * [-653.083] (-654.169) (-648.542) (-654.433) -- 0:01:20
645000 -- [-647.271] (-657.970) (-652.012) (-664.286) * (-650.262) (-662.689) (-652.455) [-646.806] -- 0:01:20
Average standard deviation of split frequencies: 0.010425
646000 -- (-664.681) (-650.560) [-651.116] (-655.888) * [-651.319] (-667.720) (-654.263) (-653.393) -- 0:01:20
647000 -- (-650.909) (-663.539) (-655.625) [-651.103] * (-653.506) (-650.988) (-655.851) [-652.926] -- 0:01:19
648000 -- (-648.700) (-660.988) (-657.588) [-650.053] * (-655.037) (-649.309) (-651.521) [-651.674] -- 0:01:19
649000 -- (-656.184) (-648.320) (-646.562) [-653.735] * (-655.435) [-648.461] (-651.027) (-654.286) -- 0:01:19
650000 -- (-651.551) [-656.111] (-657.084) (-661.281) * (-666.204) [-650.797] (-658.850) (-661.427) -- 0:01:19
Average standard deviation of split frequencies: 0.010453
651000 -- (-657.848) (-657.295) [-650.741] (-649.182) * (-652.995) (-651.671) [-653.897] (-651.375) -- 0:01:18
652000 -- [-656.241] (-655.258) (-653.451) (-649.753) * (-649.209) (-657.121) (-653.984) [-653.352] -- 0:01:18
653000 -- [-653.448] (-650.532) (-656.540) (-650.644) * [-650.049] (-647.847) (-655.155) (-663.591) -- 0:01:18
654000 -- (-658.057) [-648.454] (-656.059) (-649.433) * (-656.347) (-675.760) (-653.553) [-653.643] -- 0:01:18
655000 -- [-656.999] (-656.605) (-651.303) (-657.117) * (-648.147) (-652.790) (-654.428) [-658.951] -- 0:01:17
Average standard deviation of split frequencies: 0.010625
656000 -- (-657.721) (-656.221) (-649.546) [-646.757] * (-653.388) [-652.356] (-660.509) (-651.547) -- 0:01:17
657000 -- (-654.329) (-652.483) [-664.305] (-658.570) * (-655.577) (-653.433) (-650.482) [-653.726] -- 0:01:17
658000 -- [-650.690] (-654.168) (-662.625) (-659.087) * (-651.250) (-657.476) (-654.738) [-652.616] -- 0:01:17
659000 -- (-659.688) (-658.377) [-654.348] (-665.218) * (-649.364) (-651.571) (-656.878) [-647.948] -- 0:01:17
660000 -- [-644.378] (-651.161) (-657.371) (-651.597) * (-651.130) (-654.796) [-648.985] (-656.297) -- 0:01:16
Average standard deviation of split frequencies: 0.010040
661000 -- [-649.346] (-651.303) (-661.203) (-660.060) * (-663.558) (-657.673) (-651.081) [-660.355] -- 0:01:16
662000 -- (-656.779) (-657.465) (-656.645) [-650.802] * [-652.334] (-656.166) (-663.251) (-651.102) -- 0:01:16
663000 -- [-653.432] (-655.839) (-652.156) (-652.072) * [-652.794] (-651.773) (-657.879) (-651.824) -- 0:01:16
664000 -- [-651.117] (-663.130) (-650.586) (-654.693) * (-653.024) (-653.035) [-656.706] (-655.462) -- 0:01:15
665000 -- (-648.053) (-646.236) [-652.637] (-651.801) * (-654.931) (-661.416) [-653.367] (-649.520) -- 0:01:15
Average standard deviation of split frequencies: 0.010971
666000 -- (-656.616) [-656.522] (-652.608) (-650.483) * [-650.768] (-651.062) (-658.051) (-650.559) -- 0:01:15
667000 -- (-654.277) (-651.839) [-645.483] (-662.474) * [-651.976] (-655.549) (-667.350) (-653.077) -- 0:01:15
668000 -- (-651.713) [-651.693] (-658.854) (-653.198) * (-664.424) (-649.629) (-653.565) [-652.042] -- 0:01:15
669000 -- (-656.675) (-655.386) [-652.905] (-654.342) * (-657.388) (-656.900) (-651.789) [-655.580] -- 0:01:14
670000 -- [-647.062] (-645.394) (-658.133) (-660.433) * (-658.259) (-653.340) (-653.063) [-653.276] -- 0:01:14
Average standard deviation of split frequencies: 0.010694
671000 -- (-649.334) (-654.685) (-652.528) [-648.215] * [-647.184] (-650.215) (-657.569) (-646.913) -- 0:01:14
672000 -- [-657.524] (-651.719) (-655.384) (-651.234) * (-657.208) [-645.968] (-650.854) (-657.678) -- 0:01:14
673000 -- (-651.819) [-648.064] (-650.413) (-655.204) * (-652.851) [-651.528] (-657.613) (-653.384) -- 0:01:13
674000 -- (-663.204) (-650.156) [-644.904] (-653.531) * (-653.494) (-649.298) (-655.589) [-653.819] -- 0:01:13
675000 -- (-654.094) (-660.058) [-647.226] (-657.461) * [-652.427] (-656.871) (-659.583) (-652.989) -- 0:01:13
Average standard deviation of split frequencies: 0.011456
676000 -- (-660.254) [-653.291] (-652.298) (-651.242) * (-657.203) (-656.446) (-665.689) [-647.910] -- 0:01:13
677000 -- (-654.072) [-652.313] (-664.641) (-655.676) * (-653.167) [-644.538] (-655.834) (-653.592) -- 0:01:12
678000 -- (-651.704) (-652.361) (-653.358) [-651.765] * (-664.806) [-652.441] (-658.294) (-663.737) -- 0:01:12
679000 -- (-662.628) [-648.037] (-653.659) (-654.145) * (-665.143) (-667.104) (-662.665) [-647.164] -- 0:01:12
680000 -- [-656.994] (-657.292) (-656.652) (-659.421) * (-659.842) (-654.597) (-656.795) [-657.553] -- 0:01:12
Average standard deviation of split frequencies: 0.011675
681000 -- [-648.302] (-651.770) (-658.514) (-649.218) * (-659.049) (-655.454) [-654.486] (-650.357) -- 0:01:12
682000 -- (-654.265) [-649.763] (-651.659) (-658.745) * (-655.298) [-650.097] (-656.343) (-654.886) -- 0:01:11
683000 -- (-657.184) (-650.297) (-658.727) [-649.537] * (-659.264) [-649.021] (-663.385) (-653.527) -- 0:01:11
684000 -- (-650.489) (-658.372) [-649.466] (-650.963) * (-658.885) [-654.128] (-653.700) (-652.272) -- 0:01:11
685000 -- (-650.272) (-658.019) (-655.723) [-648.290] * (-645.291) [-653.974] (-656.733) (-649.788) -- 0:01:11
Average standard deviation of split frequencies: 0.011927
686000 -- (-656.300) (-653.689) (-657.628) [-657.521] * (-652.523) (-648.482) (-663.870) [-646.695] -- 0:01:10
687000 -- (-654.917) (-656.646) [-648.859] (-657.787) * (-648.817) [-648.519] (-656.528) (-649.572) -- 0:01:10
688000 -- (-658.946) (-653.766) [-652.686] (-649.225) * (-654.560) (-648.442) [-653.544] (-651.116) -- 0:01:10
689000 -- [-652.835] (-651.858) (-656.230) (-656.362) * (-652.194) (-650.287) (-657.219) [-646.088] -- 0:01:10
690000 -- [-646.116] (-652.503) (-651.961) (-654.882) * (-653.533) [-650.279] (-660.199) (-655.990) -- 0:01:10
Average standard deviation of split frequencies: 0.012091
691000 -- (-652.783) (-650.744) (-658.333) [-656.515] * (-664.732) (-651.401) (-650.170) [-652.758] -- 0:01:09
692000 -- (-658.785) (-650.065) (-654.148) [-655.216] * [-654.606] (-649.234) (-656.520) (-659.876) -- 0:01:09
693000 -- (-657.641) [-652.213] (-650.416) (-665.452) * (-647.880) (-665.497) [-652.725] (-647.152) -- 0:01:09
694000 -- [-650.510] (-661.624) (-659.802) (-658.166) * (-658.332) (-658.484) [-651.651] (-659.339) -- 0:01:09
695000 -- (-654.461) [-655.472] (-655.251) (-656.616) * (-651.111) [-653.172] (-651.248) (-668.731) -- 0:01:08
Average standard deviation of split frequencies: 0.011756
696000 -- (-655.939) [-650.354] (-650.706) (-651.758) * [-650.334] (-647.966) (-657.374) (-652.782) -- 0:01:08
697000 -- [-652.162] (-659.536) (-655.226) (-650.103) * [-649.329] (-646.901) (-647.759) (-657.698) -- 0:01:08
698000 -- (-654.323) [-653.660] (-654.293) (-649.561) * (-662.436) (-657.871) [-647.583] (-660.016) -- 0:01:08
699000 -- [-652.255] (-659.238) (-657.862) (-651.763) * (-650.207) [-647.311] (-655.274) (-652.109) -- 0:01:08
700000 -- [-658.784] (-645.963) (-656.045) (-649.094) * [-650.557] (-655.289) (-666.648) (-652.557) -- 0:01:07
Average standard deviation of split frequencies: 0.011438
701000 -- (-661.617) (-663.609) [-650.111] (-648.747) * (-655.532) [-654.724] (-669.146) (-659.653) -- 0:01:07
702000 -- (-659.267) [-652.094] (-661.446) (-657.657) * (-647.139) [-656.998] (-657.732) (-653.321) -- 0:01:07
703000 -- (-652.879) (-650.569) (-656.201) [-647.445] * (-650.297) [-654.978] (-653.584) (-659.678) -- 0:01:07
704000 -- (-650.838) (-647.291) (-653.989) [-653.137] * (-666.934) (-655.810) (-652.519) [-657.562] -- 0:01:06
705000 -- (-654.792) (-657.631) (-653.450) [-657.674] * (-658.123) (-664.599) (-662.074) [-644.522] -- 0:01:06
Average standard deviation of split frequencies: 0.011446
706000 -- (-653.424) (-653.274) (-665.848) [-658.559] * (-664.504) (-658.228) (-672.493) [-653.692] -- 0:01:06
707000 -- (-653.662) [-651.869] (-646.831) (-662.378) * [-652.513] (-657.363) (-651.620) (-656.644) -- 0:01:06
708000 -- [-652.265] (-645.370) (-649.346) (-653.822) * [-652.018] (-659.672) (-653.155) (-653.930) -- 0:01:05
709000 -- (-653.930) (-658.616) (-652.577) [-648.868] * (-651.049) [-652.955] (-651.160) (-655.760) -- 0:01:05
710000 -- (-647.278) (-657.407) (-651.982) [-651.120] * (-652.583) [-654.709] (-653.109) (-653.880) -- 0:01:05
Average standard deviation of split frequencies: 0.011182
711000 -- (-660.849) [-652.767] (-651.769) (-661.601) * (-663.714) (-660.137) [-651.768] (-660.160) -- 0:01:05
712000 -- [-648.763] (-653.605) (-651.878) (-647.869) * (-654.555) (-666.965) [-646.677] (-659.329) -- 0:01:05
713000 -- [-648.283] (-657.953) (-651.255) (-654.221) * (-656.390) (-653.569) [-651.233] (-657.665) -- 0:01:04
714000 -- (-655.342) [-648.024] (-656.399) (-652.385) * (-661.843) (-651.808) [-654.994] (-646.808) -- 0:01:04
715000 -- [-647.957] (-654.311) (-653.909) (-652.553) * [-649.158] (-646.818) (-649.954) (-654.946) -- 0:01:04
Average standard deviation of split frequencies: 0.010863
716000 -- [-658.148] (-664.493) (-661.327) (-648.138) * (-654.263) (-655.387) (-649.745) [-647.650] -- 0:01:04
717000 -- [-648.280] (-654.618) (-665.661) (-648.762) * (-655.096) [-657.217] (-656.721) (-650.825) -- 0:01:03
718000 -- (-654.522) (-658.807) [-659.915] (-658.511) * [-652.582] (-661.551) (-652.285) (-657.237) -- 0:01:03
719000 -- (-650.177) (-659.854) [-653.451] (-656.046) * (-651.702) (-659.876) (-651.153) [-655.976] -- 0:01:03
720000 -- (-657.266) (-658.614) [-658.744] (-649.386) * (-657.200) [-658.622] (-654.695) (-661.754) -- 0:01:03
Average standard deviation of split frequencies: 0.010746
721000 -- [-651.286] (-658.556) (-650.630) (-653.112) * (-649.962) (-656.203) [-650.867] (-648.314) -- 0:01:03
722000 -- (-656.812) (-654.805) [-654.570] (-649.860) * (-655.838) (-664.047) (-653.461) [-653.070] -- 0:01:02
723000 -- (-660.932) (-651.566) [-652.612] (-651.300) * [-643.776] (-660.674) (-654.188) (-655.455) -- 0:01:02
724000 -- (-664.149) (-654.742) [-660.105] (-658.832) * (-653.472) (-652.000) (-653.027) [-667.999] -- 0:01:02
725000 -- (-660.133) [-657.427] (-654.452) (-659.551) * (-661.319) (-661.506) [-646.914] (-656.334) -- 0:01:02
Average standard deviation of split frequencies: 0.010806
726000 -- (-657.553) (-659.712) (-652.110) [-647.427] * (-658.121) (-660.757) (-654.635) [-650.388] -- 0:01:01
727000 -- (-659.366) (-660.493) (-651.759) [-649.625] * (-659.099) (-652.348) [-655.286] (-653.453) -- 0:01:01
728000 -- [-653.883] (-661.062) (-654.627) (-656.314) * [-645.698] (-650.394) (-656.186) (-651.426) -- 0:01:01
729000 -- (-651.433) (-655.435) [-646.732] (-661.650) * [-645.942] (-669.059) (-647.212) (-664.169) -- 0:01:01
730000 -- (-659.535) (-651.032) (-650.139) [-645.539] * [-649.911] (-654.141) (-654.036) (-649.888) -- 0:01:01
Average standard deviation of split frequencies: 0.011106
731000 -- (-652.495) (-654.687) [-652.564] (-643.138) * (-649.095) [-652.981] (-651.887) (-651.086) -- 0:01:00
732000 -- (-651.262) (-660.073) [-661.406] (-657.347) * (-651.283) [-653.311] (-648.029) (-652.275) -- 0:01:00
733000 -- (-652.045) (-660.125) (-656.096) [-653.458] * (-654.095) (-662.425) (-653.188) [-651.984] -- 0:01:00
734000 -- (-649.982) [-649.187] (-650.532) (-660.898) * (-661.980) [-655.284] (-658.211) (-661.288) -- 0:01:00
735000 -- (-656.594) (-658.583) (-651.605) [-644.579] * (-656.165) (-661.495) [-649.710] (-654.924) -- 0:00:59
Average standard deviation of split frequencies: 0.010568
736000 -- (-647.037) (-653.767) (-660.204) [-650.626] * [-652.115] (-661.102) (-648.058) (-655.374) -- 0:00:59
737000 -- (-656.635) (-658.396) (-656.949) [-647.133] * [-653.029] (-656.847) (-652.736) (-648.577) -- 0:00:59
738000 -- (-651.059) (-651.292) [-654.949] (-661.219) * (-652.833) (-651.219) [-654.224] (-649.712) -- 0:00:59
739000 -- (-656.955) [-655.778] (-656.075) (-657.365) * (-659.000) [-651.990] (-651.070) (-654.244) -- 0:00:58
740000 -- [-646.540] (-648.063) (-650.651) (-656.844) * [-651.568] (-654.367) (-657.284) (-655.060) -- 0:00:59
Average standard deviation of split frequencies: 0.010593
741000 -- (-652.457) [-648.464] (-656.882) (-657.666) * (-654.040) (-656.474) (-652.973) [-652.385] -- 0:00:58
742000 -- [-661.524] (-651.487) (-653.303) (-654.938) * (-649.420) [-651.876] (-664.629) (-657.272) -- 0:00:58
743000 -- (-665.047) [-646.274] (-659.506) (-653.908) * (-659.006) [-648.781] (-661.597) (-657.278) -- 0:00:58
744000 -- (-649.144) (-653.154) [-654.170] (-659.156) * (-649.296) [-648.044] (-656.954) (-653.574) -- 0:00:58
745000 -- (-651.992) (-657.034) [-650.225] (-648.348) * [-651.886] (-651.281) (-654.415) (-657.787) -- 0:00:57
Average standard deviation of split frequencies: 0.010065
746000 -- [-649.758] (-647.970) (-658.698) (-654.152) * (-658.679) (-650.284) [-657.106] (-658.852) -- 0:00:57
747000 -- (-658.864) [-653.903] (-659.865) (-650.841) * [-649.308] (-650.745) (-661.718) (-652.000) -- 0:00:57
748000 -- [-654.102] (-657.281) (-650.375) (-657.528) * (-651.629) (-657.391) (-657.144) [-648.333] -- 0:00:56
749000 -- (-650.779) (-654.321) [-652.085] (-646.941) * [-650.638] (-661.606) (-654.687) (-652.098) -- 0:00:56
750000 -- [-653.144] (-655.215) (-654.091) (-651.892) * (-660.005) (-658.366) [-653.925] (-648.318) -- 0:00:56
Average standard deviation of split frequencies: 0.010496
751000 -- (-653.523) (-657.903) [-648.334] (-652.354) * (-655.758) [-654.372] (-651.304) (-649.695) -- 0:00:56
752000 -- (-657.741) (-654.505) [-655.827] (-648.885) * (-650.709) (-662.917) (-654.234) [-645.956] -- 0:00:56
753000 -- (-650.129) [-651.335] (-653.973) (-651.518) * [-652.504] (-653.881) (-653.084) (-645.745) -- 0:00:56
754000 -- (-654.726) (-663.188) [-653.728] (-652.687) * (-653.438) [-653.770] (-656.227) (-657.205) -- 0:00:55
755000 -- (-656.248) [-649.921] (-652.720) (-658.563) * (-657.243) (-658.261) [-654.861] (-651.434) -- 0:00:55
Average standard deviation of split frequencies: 0.010066
756000 -- (-650.733) (-656.152) [-652.346] (-653.286) * (-656.628) [-651.223] (-646.725) (-656.637) -- 0:00:55
757000 -- (-650.410) (-656.239) (-653.403) [-661.572] * (-656.945) (-655.849) [-653.399] (-652.302) -- 0:00:55
758000 -- [-647.876] (-669.013) (-655.044) (-649.552) * (-649.764) (-657.790) [-651.994] (-656.047) -- 0:00:54
759000 -- (-647.647) (-660.472) (-662.390) [-653.768] * [-650.686] (-650.478) (-657.476) (-650.982) -- 0:00:54
760000 -- (-651.905) (-648.006) (-652.236) [-651.863] * [-657.599] (-662.341) (-652.844) (-653.695) -- 0:00:54
Average standard deviation of split frequencies: 0.010624
761000 -- (-646.617) (-651.178) [-654.554] (-663.346) * (-666.325) [-650.979] (-657.059) (-650.042) -- 0:00:54
762000 -- (-659.223) (-658.887) (-654.183) [-657.601] * (-657.129) (-660.616) (-657.213) [-650.286] -- 0:00:54
763000 -- (-660.048) (-651.367) [-652.089] (-664.094) * (-653.959) (-653.776) [-652.292] (-653.612) -- 0:00:53
764000 -- (-655.868) (-646.474) (-657.718) [-650.676] * (-655.255) (-655.620) [-652.220] (-655.077) -- 0:00:53
765000 -- (-663.087) [-649.922] (-658.274) (-651.880) * (-648.047) (-653.744) (-654.980) [-645.769] -- 0:00:53
Average standard deviation of split frequencies: 0.010858
766000 -- (-653.971) (-665.131) [-646.161] (-651.600) * [-651.372] (-648.940) (-649.424) (-670.142) -- 0:00:53
767000 -- (-659.259) [-648.454] (-652.163) (-661.620) * (-651.182) (-650.657) [-649.233] (-661.122) -- 0:00:52
768000 -- (-658.024) (-644.558) [-653.210] (-655.044) * (-655.507) [-652.995] (-655.561) (-658.076) -- 0:00:52
769000 -- (-651.165) (-663.553) (-656.829) [-649.705] * (-662.731) (-660.878) [-653.042] (-651.857) -- 0:00:52
770000 -- (-658.507) [-650.728] (-652.722) (-656.548) * (-653.812) [-653.607] (-649.152) (-656.578) -- 0:00:51
Average standard deviation of split frequencies: 0.010617
771000 -- (-649.717) [-654.743] (-661.683) (-655.023) * (-653.824) (-651.276) (-652.571) [-655.239] -- 0:00:51
772000 -- (-649.256) (-660.235) [-647.903] (-651.162) * (-646.581) (-652.195) (-656.350) [-650.036] -- 0:00:51
773000 -- [-653.062] (-657.037) (-660.326) (-651.433) * (-653.917) [-649.841] (-655.915) (-648.382) -- 0:00:51
774000 -- (-647.157) (-654.523) (-652.184) [-653.493] * (-651.410) (-648.511) [-658.791] (-652.340) -- 0:00:51
775000 -- (-647.449) [-654.339] (-659.924) (-661.402) * (-656.374) (-653.141) (-650.746) [-646.915] -- 0:00:51
Average standard deviation of split frequencies: 0.010501
776000 -- [-649.036] (-657.933) (-655.722) (-652.742) * (-659.209) (-656.105) (-652.623) [-652.779] -- 0:00:50
777000 -- (-653.312) (-652.209) (-657.562) [-648.982] * (-649.380) (-656.818) [-649.123] (-657.879) -- 0:00:50
778000 -- (-657.182) [-649.709] (-653.765) (-655.901) * (-657.032) [-655.265] (-650.993) (-659.022) -- 0:00:50
779000 -- (-655.034) (-657.858) [-651.728] (-660.984) * [-647.968] (-651.791) (-660.248) (-667.678) -- 0:00:49
780000 -- (-657.078) (-661.256) [-647.070] (-652.543) * [-649.552] (-645.608) (-656.392) (-656.030) -- 0:00:49
Average standard deviation of split frequencies: 0.010179
781000 -- (-653.964) (-653.768) [-652.619] (-661.905) * (-651.679) [-659.311] (-653.401) (-665.039) -- 0:00:49
782000 -- (-661.199) [-650.894] (-660.760) (-655.443) * (-653.947) [-651.755] (-651.852) (-663.629) -- 0:00:49
783000 -- (-656.774) (-649.384) [-649.769] (-660.009) * (-654.016) (-657.375) [-648.402] (-659.937) -- 0:00:49
784000 -- (-655.567) (-653.920) (-650.682) [-647.974] * (-654.248) (-658.959) (-657.507) [-658.881] -- 0:00:49
785000 -- (-652.507) (-653.246) (-650.914) [-656.927] * (-654.721) (-654.871) [-652.802] (-655.059) -- 0:00:48
Average standard deviation of split frequencies: 0.009725
786000 -- (-652.857) (-655.267) [-659.494] (-663.737) * (-654.121) (-650.786) (-656.194) [-653.531] -- 0:00:48
787000 -- (-657.244) (-660.527) [-649.887] (-651.919) * [-647.464] (-651.554) (-655.049) (-652.707) -- 0:00:48
788000 -- [-656.801] (-656.092) (-655.316) (-653.566) * (-653.504) (-649.719) (-663.617) [-650.400] -- 0:00:48
789000 -- (-654.971) (-652.508) [-650.718] (-656.453) * [-651.292] (-654.397) (-652.638) (-659.302) -- 0:00:47
790000 -- (-649.383) [-653.552] (-655.246) (-658.633) * (-651.769) [-651.572] (-653.746) (-655.489) -- 0:00:47
Average standard deviation of split frequencies: 0.009454
791000 -- [-652.667] (-650.828) (-651.493) (-656.146) * (-656.990) (-656.763) (-650.844) [-653.870] -- 0:00:47
792000 -- (-654.086) (-655.659) [-652.226] (-656.518) * (-654.796) (-648.901) [-656.381] (-654.465) -- 0:00:47
793000 -- (-658.208) (-656.388) (-663.455) [-648.601] * (-659.995) (-651.703) (-652.489) [-649.612] -- 0:00:46
794000 -- (-652.451) (-661.845) [-647.684] (-646.544) * (-647.230) [-664.630] (-650.809) (-657.339) -- 0:00:46
795000 -- (-645.569) [-647.589] (-656.391) (-666.831) * [-652.983] (-647.696) (-659.718) (-650.272) -- 0:00:46
Average standard deviation of split frequencies: 0.009391
796000 -- (-650.673) (-654.131) [-653.722] (-646.724) * (-654.943) (-660.637) [-651.699] (-650.764) -- 0:00:46
797000 -- [-655.279] (-654.469) (-650.868) (-652.099) * (-657.546) (-651.972) [-654.499] (-655.873) -- 0:00:46
798000 -- (-649.205) [-651.809] (-655.198) (-649.933) * (-664.954) (-652.340) (-655.046) [-658.094] -- 0:00:45
799000 -- (-650.723) (-656.280) (-658.238) [-655.119] * [-660.007] (-654.538) (-655.745) (-648.970) -- 0:00:45
800000 -- (-656.495) (-647.410) (-654.791) [-648.729] * (-649.028) (-650.985) [-653.865] (-664.871) -- 0:00:45
Average standard deviation of split frequencies: 0.009084
801000 -- (-657.797) (-659.585) [-651.624] (-665.506) * (-652.672) (-652.782) [-649.235] (-651.907) -- 0:00:45
802000 -- (-655.473) (-652.059) [-646.761] (-659.236) * [-653.437] (-653.379) (-648.094) (-651.431) -- 0:00:44
803000 -- (-669.149) (-653.801) [-657.026] (-659.199) * (-653.703) (-649.429) (-661.855) [-650.513] -- 0:00:44
804000 -- (-665.865) [-656.194] (-658.638) (-652.518) * (-649.294) (-651.453) (-662.836) [-660.915] -- 0:00:44
805000 -- [-655.697] (-656.075) (-667.177) (-649.086) * [-649.093] (-650.072) (-651.983) (-657.177) -- 0:00:44
Average standard deviation of split frequencies: 0.008898
806000 -- (-659.926) [-651.102] (-659.383) (-653.170) * (-662.987) (-655.392) [-655.038] (-651.798) -- 0:00:44
807000 -- (-667.537) (-655.254) [-654.314] (-649.027) * (-648.878) [-651.046] (-651.019) (-653.669) -- 0:00:43
808000 -- (-656.944) (-649.497) [-657.241] (-651.933) * [-651.331] (-650.077) (-654.712) (-656.922) -- 0:00:43
809000 -- [-654.233] (-658.675) (-653.110) (-644.470) * (-660.140) (-659.880) (-654.712) [-651.128] -- 0:00:43
810000 -- (-659.331) [-655.387] (-656.552) (-652.670) * (-652.394) [-648.681] (-650.303) (-661.937) -- 0:00:43
Average standard deviation of split frequencies: 0.009096
811000 -- (-660.599) (-655.018) [-647.797] (-652.432) * (-653.536) (-652.021) (-658.935) [-657.116] -- 0:00:42
812000 -- (-655.843) [-656.484] (-652.386) (-658.167) * (-659.804) [-655.519] (-661.977) (-655.124) -- 0:00:42
813000 -- (-652.715) (-658.809) (-651.113) [-649.374] * (-658.755) (-655.053) [-654.721] (-652.573) -- 0:00:42
814000 -- [-647.521] (-659.635) (-648.386) (-649.066) * (-657.441) (-661.331) [-654.853] (-647.926) -- 0:00:42
815000 -- (-653.702) [-652.769] (-656.238) (-656.493) * (-656.745) [-657.275] (-653.919) (-656.032) -- 0:00:41
Average standard deviation of split frequencies: 0.008996
816000 -- (-651.640) [-647.421] (-663.479) (-657.659) * [-649.179] (-653.324) (-665.289) (-658.483) -- 0:00:41
817000 -- (-665.528) (-653.379) [-652.105] (-656.736) * (-663.177) (-652.802) (-654.104) [-645.422] -- 0:00:41
818000 -- (-652.059) [-651.778] (-651.601) (-660.787) * [-650.434] (-658.651) (-652.213) (-660.524) -- 0:00:41
819000 -- (-655.651) [-649.677] (-655.788) (-650.398) * (-658.243) [-650.824] (-655.530) (-663.358) -- 0:00:41
820000 -- [-648.187] (-651.780) (-656.564) (-654.028) * (-659.967) [-645.576] (-657.320) (-649.447) -- 0:00:40
Average standard deviation of split frequencies: 0.008739
821000 -- (-650.915) [-653.174] (-656.051) (-659.658) * (-648.517) (-658.260) (-656.425) [-654.283] -- 0:00:40
822000 -- (-651.837) (-653.399) [-649.229] (-653.767) * (-650.325) (-658.110) [-650.912] (-652.971) -- 0:00:40
823000 -- (-659.379) [-659.790] (-653.995) (-653.095) * (-653.613) (-649.696) (-649.557) [-646.474] -- 0:00:40
824000 -- (-648.454) [-649.074] (-653.055) (-653.571) * (-649.927) (-650.585) (-657.439) [-650.219] -- 0:00:39
825000 -- [-656.265] (-654.056) (-646.782) (-653.088) * (-656.884) [-654.869] (-656.781) (-649.694) -- 0:00:39
Average standard deviation of split frequencies: 0.008683
826000 -- (-647.430) (-651.664) (-651.391) [-654.337] * (-649.672) (-657.329) [-648.412] (-649.302) -- 0:00:39
827000 -- (-655.752) (-653.167) [-651.782] (-656.260) * (-664.381) (-659.667) [-653.767] (-658.747) -- 0:00:39
828000 -- (-649.770) (-652.151) [-649.924] (-656.775) * [-652.706] (-648.748) (-655.945) (-650.127) -- 0:00:39
829000 -- [-652.338] (-649.652) (-655.069) (-656.102) * (-652.757) [-650.694] (-654.680) (-649.932) -- 0:00:38
830000 -- [-647.085] (-657.825) (-655.628) (-657.569) * (-651.435) (-650.578) [-655.112] (-651.857) -- 0:00:38
Average standard deviation of split frequencies: 0.008958
831000 -- [-648.048] (-650.823) (-658.002) (-646.620) * (-658.125) (-657.907) [-655.938] (-654.285) -- 0:00:38
832000 -- [-652.299] (-648.621) (-657.901) (-652.559) * (-648.014) (-652.168) [-650.935] (-658.173) -- 0:00:38
833000 -- [-656.947] (-654.937) (-651.723) (-657.689) * [-652.631] (-651.092) (-649.140) (-658.681) -- 0:00:37
834000 -- [-649.076] (-657.186) (-650.976) (-657.823) * (-648.909) [-650.507] (-655.239) (-659.357) -- 0:00:37
835000 -- (-653.847) [-652.500] (-647.692) (-658.500) * (-660.850) (-659.701) [-651.442] (-661.892) -- 0:00:37
Average standard deviation of split frequencies: 0.008498
836000 -- (-658.914) (-658.043) [-656.018] (-654.188) * [-651.730] (-653.421) (-661.189) (-653.232) -- 0:00:37
837000 -- (-655.040) (-655.499) [-653.510] (-651.820) * (-651.829) (-662.757) (-659.385) [-650.771] -- 0:00:37
838000 -- (-657.611) (-656.980) [-652.127] (-652.438) * (-659.411) [-653.465] (-656.220) (-653.034) -- 0:00:36
839000 -- (-654.497) (-656.799) (-659.455) [-650.506] * (-658.105) (-657.733) (-660.568) [-649.987] -- 0:00:36
840000 -- (-653.945) (-653.327) (-653.293) [-650.787] * (-656.491) (-655.719) (-653.378) [-647.308] -- 0:00:36
Average standard deviation of split frequencies: 0.008411
841000 -- [-655.387] (-652.039) (-652.679) (-655.296) * [-650.667] (-647.421) (-647.612) (-646.616) -- 0:00:36
842000 -- (-653.019) [-654.468] (-651.303) (-653.309) * [-653.851] (-655.218) (-660.271) (-658.850) -- 0:00:35
843000 -- (-650.673) (-653.880) [-648.859] (-661.761) * (-655.816) [-650.524] (-659.285) (-663.485) -- 0:00:35
844000 -- (-648.821) (-653.508) (-651.574) [-652.974] * [-652.751] (-652.367) (-670.628) (-658.873) -- 0:00:35
845000 -- [-650.738] (-649.646) (-659.398) (-655.382) * [-659.712] (-654.322) (-660.312) (-653.505) -- 0:00:35
Average standard deviation of split frequencies: 0.008358
846000 -- (-652.901) [-652.478] (-655.408) (-649.953) * (-667.649) [-647.380] (-666.912) (-650.244) -- 0:00:34
847000 -- [-650.392] (-657.781) (-651.815) (-652.167) * (-653.232) [-653.343] (-655.443) (-652.734) -- 0:00:34
848000 -- [-644.369] (-650.542) (-657.059) (-654.530) * (-653.482) (-652.169) (-654.292) [-649.430] -- 0:00:34
849000 -- (-657.136) (-653.779) (-662.543) [-648.986] * (-652.839) [-656.125] (-652.594) (-651.927) -- 0:00:34
850000 -- (-660.311) [-645.431] (-661.898) (-659.554) * (-657.484) (-654.262) (-655.131) [-651.021] -- 0:00:34
Average standard deviation of split frequencies: 0.008748
851000 -- (-655.672) (-648.709) (-652.712) [-655.343] * (-648.423) [-650.063] (-653.589) (-659.110) -- 0:00:33
852000 -- (-656.260) [-651.911] (-646.264) (-652.206) * (-657.381) [-653.230] (-657.590) (-658.706) -- 0:00:33
853000 -- (-656.270) (-649.324) [-654.433] (-655.869) * (-655.653) [-650.882] (-652.355) (-652.904) -- 0:00:33
854000 -- (-657.559) (-650.174) (-653.260) [-649.013] * (-652.459) [-651.106] (-650.514) (-659.395) -- 0:00:33
855000 -- (-651.358) (-645.035) (-659.101) [-651.802] * (-650.216) [-648.216] (-663.360) (-653.695) -- 0:00:32
Average standard deviation of split frequencies: 0.009205
856000 -- (-651.241) [-655.535] (-656.731) (-655.332) * (-654.349) (-655.708) (-654.111) [-652.125] -- 0:00:32
857000 -- [-646.425] (-656.822) (-654.115) (-655.862) * (-660.224) [-648.927] (-653.605) (-653.283) -- 0:00:32
858000 -- [-649.914] (-653.843) (-655.232) (-646.226) * (-645.617) (-658.259) (-659.325) [-655.230] -- 0:00:32
859000 -- (-654.525) [-653.269] (-656.199) (-650.408) * [-651.275] (-669.104) (-650.542) (-656.166) -- 0:00:32
860000 -- (-656.230) (-651.812) (-654.461) [-654.182] * (-653.495) [-652.721] (-657.484) (-655.417) -- 0:00:31
Average standard deviation of split frequencies: 0.009702
861000 -- (-653.081) (-657.558) [-651.484] (-656.526) * (-656.471) [-654.655] (-653.816) (-652.284) -- 0:00:31
862000 -- [-658.693] (-662.420) (-655.137) (-654.358) * (-656.252) (-654.227) [-646.665] (-650.992) -- 0:00:31
863000 -- (-653.487) (-657.660) [-654.703] (-657.522) * [-654.859] (-663.179) (-650.223) (-654.833) -- 0:00:31
864000 -- (-649.588) [-650.775] (-652.957) (-651.425) * (-655.430) [-654.006] (-651.578) (-652.380) -- 0:00:30
865000 -- (-664.163) [-648.328] (-649.283) (-655.051) * (-653.393) [-659.578] (-649.307) (-652.259) -- 0:00:30
Average standard deviation of split frequencies: 0.009643
866000 -- (-654.823) (-656.297) (-658.106) [-650.777] * (-657.675) (-665.337) (-654.252) [-654.599] -- 0:00:30
867000 -- (-651.609) (-660.864) (-648.907) [-652.870] * (-660.864) (-654.840) [-649.762] (-655.655) -- 0:00:30
868000 -- (-649.799) (-654.708) [-653.266] (-660.846) * (-658.458) (-652.371) [-653.129] (-653.107) -- 0:00:29
869000 -- (-654.877) (-658.640) (-653.592) [-657.050] * [-651.167] (-661.305) (-654.656) (-646.882) -- 0:00:29
870000 -- (-644.853) (-651.383) (-649.181) [-653.251] * (-652.726) [-650.394] (-649.387) (-656.415) -- 0:00:29
Average standard deviation of split frequencies: 0.009475
871000 -- (-656.831) [-650.841] (-656.738) (-655.261) * (-655.651) [-649.000] (-660.082) (-649.098) -- 0:00:29
872000 -- (-655.249) (-659.556) (-647.511) [-646.627] * (-657.319) (-647.531) (-649.470) [-648.165] -- 0:00:29
873000 -- (-651.098) (-651.246) [-656.489] (-651.086) * (-650.544) (-661.681) [-649.088] (-654.462) -- 0:00:28
874000 -- [-650.367] (-647.082) (-657.418) (-657.747) * (-654.014) [-653.014] (-659.980) (-658.309) -- 0:00:28
875000 -- (-654.307) (-663.735) (-663.032) [-651.534] * [-648.035] (-670.681) (-652.297) (-650.351) -- 0:00:28
Average standard deviation of split frequencies: 0.008879
876000 -- (-653.030) [-654.162] (-666.732) (-648.694) * [-657.789] (-660.284) (-657.469) (-653.604) -- 0:00:28
877000 -- (-658.378) (-655.457) (-655.011) [-653.412] * (-648.562) (-656.522) (-654.434) [-648.216] -- 0:00:27
878000 -- (-654.179) [-646.880] (-655.332) (-656.947) * (-655.721) (-657.004) (-656.329) [-657.020] -- 0:00:27
879000 -- (-652.396) (-655.614) (-660.803) [-654.191] * [-647.183] (-654.762) (-650.704) (-655.998) -- 0:00:27
880000 -- [-651.311] (-651.127) (-662.776) (-651.437) * (-648.056) [-652.317] (-655.706) (-666.816) -- 0:00:27
Average standard deviation of split frequencies: 0.008603
881000 -- [-651.283] (-651.332) (-664.294) (-656.236) * (-658.075) [-649.895] (-655.061) (-657.226) -- 0:00:27
882000 -- (-651.309) [-652.164] (-654.756) (-654.457) * (-656.992) [-655.274] (-650.227) (-659.306) -- 0:00:26
883000 -- (-660.162) (-656.274) (-660.747) [-655.369] * (-656.577) (-656.317) [-657.695] (-651.450) -- 0:00:26
884000 -- (-651.692) [-650.755] (-649.301) (-659.193) * [-655.449] (-654.492) (-657.781) (-653.355) -- 0:00:26
885000 -- [-659.596] (-654.554) (-654.297) (-652.110) * [-660.042] (-647.235) (-660.685) (-652.747) -- 0:00:26
Average standard deviation of split frequencies: 0.008437
886000 -- (-653.318) [-647.489] (-658.932) (-652.938) * [-647.237] (-655.841) (-650.798) (-647.982) -- 0:00:25
887000 -- (-655.600) (-656.834) (-654.127) [-660.674] * (-656.940) (-658.272) (-652.552) [-654.428] -- 0:00:25
888000 -- (-650.925) (-656.625) [-654.959] (-650.589) * (-650.626) (-648.779) [-651.621] (-655.271) -- 0:00:25
889000 -- (-656.718) (-659.861) [-650.179] (-647.001) * (-653.184) (-659.676) [-652.421] (-649.942) -- 0:00:25
890000 -- (-654.959) (-655.695) [-650.956] (-645.029) * (-657.045) (-653.665) [-648.042] (-652.195) -- 0:00:24
Average standard deviation of split frequencies: 0.007788
891000 -- (-654.764) (-651.859) (-648.535) [-649.657] * [-654.342] (-656.361) (-657.524) (-649.475) -- 0:00:24
892000 -- [-652.379] (-653.571) (-650.984) (-659.957) * (-666.006) (-649.833) (-658.186) [-651.447] -- 0:00:24
893000 -- (-663.497) (-650.167) (-650.364) [-655.980] * [-651.495] (-652.492) (-656.063) (-651.117) -- 0:00:24
894000 -- [-655.991] (-659.194) (-659.687) (-659.923) * [-651.160] (-654.795) (-657.910) (-652.958) -- 0:00:24
895000 -- (-654.683) (-653.164) (-652.446) [-657.779] * [-656.331] (-645.668) (-653.066) (-655.336) -- 0:00:23
Average standard deviation of split frequencies: 0.007704
896000 -- (-659.775) (-652.904) (-654.480) [-653.530] * (-659.843) (-658.701) (-652.952) [-651.751] -- 0:00:23
897000 -- (-649.042) (-653.562) [-648.720] (-659.057) * (-655.652) (-653.221) (-658.502) [-656.963] -- 0:00:23
898000 -- (-658.639) (-655.201) [-652.321] (-652.429) * (-652.566) [-649.626] (-652.396) (-655.220) -- 0:00:23
899000 -- (-647.865) [-649.784] (-658.609) (-657.392) * (-654.251) [-654.748] (-659.948) (-656.694) -- 0:00:22
900000 -- (-651.235) (-658.862) [-651.012] (-659.756) * [-650.324] (-658.769) (-658.344) (-659.295) -- 0:00:22
Average standard deviation of split frequencies: 0.008000
901000 -- (-646.746) (-653.758) [-655.080] (-654.711) * (-655.036) (-647.941) [-654.322] (-652.015) -- 0:00:22
902000 -- (-651.699) (-658.268) (-650.762) [-650.634] * (-655.215) [-650.944] (-661.276) (-648.228) -- 0:00:22
903000 -- (-649.681) (-659.911) (-644.673) [-657.091] * [-661.701] (-650.552) (-665.844) (-657.856) -- 0:00:22
904000 -- (-651.714) (-652.318) (-653.437) [-653.795] * (-656.385) (-654.089) (-654.881) [-650.347] -- 0:00:21
905000 -- (-647.914) (-655.404) (-656.789) [-652.662] * (-655.882) (-655.327) (-659.959) [-656.535] -- 0:00:21
Average standard deviation of split frequencies: 0.007879
906000 -- [-650.953] (-654.122) (-664.663) (-659.460) * [-655.547] (-656.004) (-651.531) (-658.750) -- 0:00:21
907000 -- [-658.381] (-655.316) (-658.788) (-660.275) * [-652.585] (-655.582) (-655.070) (-649.433) -- 0:00:21
908000 -- (-660.823) (-657.636) (-658.395) [-651.332] * (-654.509) (-654.498) [-651.536] (-659.492) -- 0:00:20
909000 -- (-661.921) (-654.621) [-644.922] (-656.174) * (-658.633) [-657.438] (-652.495) (-657.375) -- 0:00:20
910000 -- (-657.300) (-650.564) [-648.348] (-653.902) * (-661.601) (-649.799) [-659.971] (-657.545) -- 0:00:20
Average standard deviation of split frequencies: 0.007543
911000 -- (-656.402) (-650.351) (-660.059) [-654.430] * (-656.856) (-652.664) (-650.626) [-652.983] -- 0:00:20
912000 -- (-664.501) [-649.605] (-651.420) (-655.090) * (-658.824) (-653.812) (-661.093) [-646.577] -- 0:00:19
913000 -- (-647.140) [-651.504] (-651.235) (-647.801) * (-653.655) (-647.512) (-654.781) [-657.851] -- 0:00:19
914000 -- (-664.371) [-648.827] (-654.061) (-645.579) * (-654.788) (-648.685) (-652.128) [-662.963] -- 0:00:19
915000 -- (-656.516) (-659.412) [-654.961] (-656.209) * (-654.553) (-662.608) (-649.865) [-654.341] -- 0:00:19
Average standard deviation of split frequencies: 0.007205
916000 -- (-661.012) (-653.456) [-650.091] (-663.277) * (-659.229) (-659.860) [-650.911] (-649.330) -- 0:00:19
917000 -- (-652.638) [-652.202] (-654.763) (-652.831) * (-646.765) (-657.494) [-647.253] (-654.503) -- 0:00:18
918000 -- (-658.028) (-658.867) (-654.085) [-653.784] * (-647.460) [-650.066] (-651.101) (-657.761) -- 0:00:18
919000 -- (-651.829) (-658.314) (-657.377) [-651.820] * [-647.989] (-651.325) (-653.837) (-657.286) -- 0:00:18
920000 -- (-657.037) (-648.838) (-662.336) [-659.883] * (-651.508) (-654.956) (-651.388) [-653.239] -- 0:00:18
Average standard deviation of split frequencies: 0.007424
921000 -- [-644.493] (-654.286) (-652.111) (-647.976) * (-651.023) [-651.132] (-656.510) (-655.442) -- 0:00:17
922000 -- (-657.068) [-653.939] (-652.097) (-649.562) * (-652.078) (-659.358) [-652.692] (-656.895) -- 0:00:17
923000 -- (-645.906) (-650.284) (-658.536) [-654.301] * (-654.090) (-655.250) (-656.738) [-654.871] -- 0:00:17
924000 -- [-648.871] (-651.343) (-655.193) (-649.597) * [-647.974] (-659.701) (-650.508) (-655.866) -- 0:00:17
925000 -- (-652.068) (-663.446) (-655.515) [-649.496] * (-648.693) (-663.144) (-656.111) [-652.937] -- 0:00:17
Average standard deviation of split frequencies: 0.007236
926000 -- [-650.444] (-648.465) (-651.776) (-651.107) * [-654.041] (-651.168) (-653.013) (-653.221) -- 0:00:16
927000 -- (-653.535) (-657.752) [-651.165] (-645.486) * (-661.738) (-661.307) (-655.872) [-650.494] -- 0:00:16
928000 -- (-667.512) (-666.853) (-648.591) [-650.076] * (-652.305) (-664.264) (-654.798) [-651.082] -- 0:00:16
929000 -- (-655.081) (-663.835) (-661.261) [-653.655] * (-653.388) [-648.045] (-660.850) (-653.140) -- 0:00:16
930000 -- [-651.179] (-658.989) (-655.170) (-651.203) * (-653.267) (-649.878) [-648.679] (-658.935) -- 0:00:15
Average standard deviation of split frequencies: 0.007525
931000 -- (-657.221) (-664.604) [-652.366] (-654.274) * (-653.020) (-654.856) (-652.748) [-651.233] -- 0:00:15
932000 -- (-652.958) [-649.970] (-650.175) (-655.711) * (-654.879) [-650.666] (-652.600) (-655.527) -- 0:00:15
933000 -- (-654.361) (-654.133) [-652.387] (-657.266) * (-658.158) [-647.306] (-660.037) (-654.163) -- 0:00:15
934000 -- (-660.174) [-657.919] (-651.343) (-657.106) * (-652.077) (-662.008) [-653.004] (-650.575) -- 0:00:14
935000 -- [-657.895] (-651.071) (-653.450) (-658.095) * (-655.682) (-649.409) (-650.643) [-647.174] -- 0:00:14
Average standard deviation of split frequencies: 0.007878
936000 -- [-655.004] (-651.628) (-650.907) (-655.540) * (-653.569) [-649.331] (-647.005) (-652.450) -- 0:00:14
937000 -- [-646.688] (-646.007) (-660.725) (-647.273) * [-647.833] (-652.723) (-658.938) (-653.110) -- 0:00:14
938000 -- (-671.617) (-646.164) [-654.749] (-652.165) * (-651.466) [-651.562] (-655.898) (-649.987) -- 0:00:14
939000 -- (-659.554) (-666.136) [-650.177] (-659.240) * (-656.622) (-648.533) [-648.590] (-648.013) -- 0:00:13
940000 -- (-658.418) (-655.123) [-647.057] (-664.543) * [-648.100] (-647.561) (-654.005) (-664.548) -- 0:00:13
Average standard deviation of split frequencies: 0.007947
941000 -- (-657.575) [-648.685] (-647.698) (-659.454) * (-653.284) (-655.071) [-655.358] (-662.819) -- 0:00:13
942000 -- [-656.967] (-657.430) (-652.422) (-652.987) * (-659.197) [-650.801] (-658.028) (-655.259) -- 0:00:13
943000 -- (-657.695) [-650.709] (-648.468) (-659.855) * (-652.343) (-651.034) (-653.742) [-647.893] -- 0:00:12
944000 -- (-652.602) [-653.142] (-660.368) (-649.768) * (-655.709) (-655.404) [-648.941] (-652.155) -- 0:00:12
945000 -- (-650.293) (-650.555) [-653.494] (-658.532) * (-667.397) (-659.994) (-653.127) [-655.421] -- 0:00:12
Average standard deviation of split frequencies: 0.007937
946000 -- (-658.380) (-652.077) (-655.797) [-648.560] * [-656.478] (-656.988) (-655.437) (-660.427) -- 0:00:12
947000 -- (-659.992) (-655.339) (-655.044) [-650.666] * (-653.873) (-652.783) [-650.781] (-650.466) -- 0:00:12
948000 -- (-655.094) (-658.142) [-656.403] (-661.211) * [-656.395] (-650.481) (-660.723) (-655.683) -- 0:00:11
949000 -- [-649.555] (-654.792) (-664.507) (-658.324) * (-647.553) (-654.119) [-650.391] (-651.587) -- 0:00:11
950000 -- [-649.488] (-663.178) (-656.611) (-649.440) * (-670.320) (-650.327) [-659.966] (-657.514) -- 0:00:11
Average standard deviation of split frequencies: 0.007509
951000 -- [-656.894] (-654.311) (-657.524) (-658.764) * (-648.985) [-648.018] (-654.284) (-659.506) -- 0:00:11
952000 -- (-654.506) (-653.311) (-668.238) [-650.344] * (-645.602) (-647.415) [-651.248] (-660.371) -- 0:00:10
953000 -- [-651.590] (-648.287) (-658.973) (-648.475) * (-651.222) (-654.517) (-655.015) [-658.786] -- 0:00:10
954000 -- (-647.165) (-660.731) (-659.920) [-656.468] * (-656.538) (-654.082) [-655.778] (-656.938) -- 0:00:10
955000 -- (-654.944) (-662.517) (-656.761) [-655.612] * (-652.399) (-650.142) (-651.270) [-660.917] -- 0:00:10
Average standard deviation of split frequencies: 0.006868
956000 -- (-651.661) [-655.990] (-652.713) (-663.305) * [-646.609] (-649.996) (-658.339) (-659.129) -- 0:00:09
957000 -- [-649.649] (-660.325) (-658.777) (-662.693) * (-664.469) (-656.807) [-653.711] (-655.739) -- 0:00:09
958000 -- (-651.824) (-660.238) (-657.409) [-663.427] * (-649.407) [-650.327] (-660.705) (-657.780) -- 0:00:09
959000 -- (-648.536) (-653.176) (-655.917) [-650.055] * [-648.793] (-654.163) (-659.455) (-648.850) -- 0:00:09
960000 -- (-650.766) [-651.590] (-647.929) (-662.703) * (-649.301) (-650.371) (-663.691) [-649.785] -- 0:00:09
Average standard deviation of split frequencies: 0.006730
961000 -- [-652.574] (-657.772) (-652.315) (-659.063) * [-649.821] (-659.640) (-662.967) (-662.958) -- 0:00:08
962000 -- [-653.218] (-655.390) (-648.959) (-664.392) * (-649.443) (-655.900) [-651.115] (-660.184) -- 0:00:08
963000 -- (-651.441) (-649.100) [-654.026] (-649.383) * [-648.629] (-657.115) (-656.080) (-657.563) -- 0:00:08
964000 -- [-652.798] (-648.727) (-666.713) (-667.785) * [-660.638] (-660.961) (-650.221) (-652.589) -- 0:00:08
965000 -- [-653.047] (-650.691) (-658.132) (-652.580) * (-653.282) (-646.890) (-670.716) [-652.055] -- 0:00:07
Average standard deviation of split frequencies: 0.006309
966000 -- [-653.008] (-654.866) (-651.712) (-653.771) * (-647.941) [-661.256] (-656.090) (-650.235) -- 0:00:07
967000 -- (-647.034) (-665.106) (-650.264) [-653.223] * (-656.824) (-654.452) [-652.612] (-648.263) -- 0:00:07
968000 -- (-656.553) (-654.843) [-652.232] (-661.866) * (-652.405) (-650.879) [-654.221] (-657.041) -- 0:00:07
969000 -- (-651.870) (-660.758) [-653.112] (-656.778) * (-653.309) [-656.209] (-653.546) (-654.020) -- 0:00:07
970000 -- (-653.748) (-652.192) [-647.922] (-652.110) * (-654.445) (-652.884) [-647.303] (-658.357) -- 0:00:06
Average standard deviation of split frequencies: 0.006036
971000 -- (-647.622) (-656.444) (-661.678) [-653.573] * [-646.539] (-650.293) (-646.273) (-657.550) -- 0:00:06
972000 -- (-653.560) (-648.722) [-653.155] (-658.596) * (-653.710) (-649.640) (-651.146) [-649.590] -- 0:00:06
973000 -- (-657.530) (-662.363) [-654.128] (-658.647) * [-651.663] (-650.168) (-646.447) (-659.015) -- 0:00:06
974000 -- (-652.778) [-653.012] (-657.489) (-672.423) * (-651.424) (-649.341) (-655.651) [-660.699] -- 0:00:05
975000 -- (-658.084) [-653.330] (-653.293) (-662.520) * [-651.371] (-663.337) (-654.867) (-652.323) -- 0:00:05
Average standard deviation of split frequencies: 0.006520
976000 -- (-654.373) [-650.160] (-657.996) (-670.955) * [-653.003] (-664.000) (-652.118) (-650.621) -- 0:00:05
977000 -- (-658.286) (-661.531) [-648.607] (-666.561) * (-653.959) (-659.135) [-651.603] (-653.121) -- 0:00:05
978000 -- (-652.113) (-651.033) (-653.718) [-657.272] * (-650.495) [-649.795] (-654.940) (-650.559) -- 0:00:04
979000 -- (-652.279) (-651.960) [-651.682] (-659.073) * (-661.149) (-652.498) (-660.499) [-650.901] -- 0:00:04
980000 -- (-663.219) (-654.025) [-651.233] (-661.359) * [-649.882] (-653.951) (-658.714) (-654.560) -- 0:00:04
Average standard deviation of split frequencies: 0.006558
981000 -- (-648.485) [-650.544] (-653.324) (-654.224) * (-652.460) [-654.398] (-655.983) (-656.624) -- 0:00:04
982000 -- (-654.762) (-650.660) [-650.284] (-658.412) * (-651.847) (-654.174) (-655.062) [-652.415] -- 0:00:04
983000 -- [-649.060] (-654.986) (-648.284) (-656.212) * [-653.617] (-650.787) (-658.185) (-649.999) -- 0:00:03
984000 -- (-653.936) (-655.825) [-649.932] (-667.103) * (-657.510) [-645.436] (-655.884) (-666.393) -- 0:00:03
985000 -- (-656.570) (-656.410) [-647.488] (-652.156) * (-652.933) [-652.460] (-655.097) (-656.885) -- 0:00:03
Average standard deviation of split frequencies: 0.006352
986000 -- [-654.562] (-654.569) (-651.821) (-660.419) * [-652.673] (-651.837) (-661.531) (-662.659) -- 0:00:03
987000 -- [-654.569] (-659.214) (-649.201) (-662.504) * (-653.510) (-653.882) (-659.050) [-654.440] -- 0:00:02
988000 -- [-651.403] (-653.466) (-652.612) (-656.641) * [-648.442] (-664.465) (-646.669) (-649.768) -- 0:00:02
989000 -- (-652.721) [-655.089] (-650.502) (-655.087) * [-649.002] (-656.458) (-655.435) (-648.774) -- 0:00:02
990000 -- (-663.850) (-655.058) (-654.592) [-654.952] * [-651.371] (-658.696) (-652.208) (-653.558) -- 0:00:02
Average standard deviation of split frequencies: 0.006424
991000 -- (-649.548) (-657.110) [-649.581] (-647.636) * (-654.693) (-654.750) (-651.225) [-648.676] -- 0:00:02
992000 -- (-656.350) (-660.717) [-644.667] (-654.578) * (-659.756) (-659.966) [-652.995] (-654.236) -- 0:00:01
993000 -- (-651.437) [-655.543] (-653.765) (-652.006) * [-651.939] (-658.998) (-653.436) (-650.399) -- 0:00:01
994000 -- (-650.709) (-649.519) (-653.122) [-653.714] * (-648.840) [-651.733] (-657.109) (-649.319) -- 0:00:01
995000 -- (-652.387) (-653.571) [-651.749] (-652.655) * (-648.973) [-652.048] (-649.814) (-655.128) -- 0:00:01
Average standard deviation of split frequencies: 0.006660
996000 -- (-650.072) (-655.603) (-649.293) [-659.589] * (-658.410) (-652.955) [-648.071] (-652.516) -- 0:00:00
997000 -- [-649.873] (-662.932) (-649.258) (-656.929) * (-654.847) (-644.942) [-657.584] (-661.872) -- 0:00:00
998000 -- (-655.421) (-656.038) (-651.194) [-646.286] * (-650.199) (-651.686) (-651.585) [-654.494] -- 0:00:00
999000 -- (-659.444) (-654.436) (-651.175) [-651.348] * (-657.291) [-654.052] (-661.673) (-647.583) -- 0:00:00
1000000 -- (-654.515) (-657.154) [-648.364] (-662.206) * (-646.847) (-654.168) [-649.116] (-650.721) -- 0:00:00
Average standard deviation of split frequencies: 0.006595
Analysis completed in 3 mins 47 seconds
Analysis used 226.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -641.52
Likelihood of best state for "cold" chain of run 2 was -641.72
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
69.9 % ( 70 %) Dirichlet(Revmat{all})
85.4 % ( 76 %) Slider(Revmat{all})
36.7 % ( 29 %) Dirichlet(Pi{all})
37.2 % ( 31 %) Slider(Pi{all})
79.0 % ( 50 %) Multiplier(Alpha{1,2})
74.1 % ( 53 %) Multiplier(Alpha{3})
80.8 % ( 61 %) Slider(Pinvar{all})
57.3 % ( 63 %) ExtSPR(Tau{all},V{all})
59.9 % ( 55 %) ExtTBR(Tau{all},V{all})
67.3 % ( 74 %) NNI(Tau{all},V{all})
51.6 % ( 47 %) ParsSPR(Tau{all},V{all})
27.3 % ( 21 %) Multiplier(V{all})
67.9 % ( 75 %) Nodeslider(V{all})
27.3 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.1 % ( 68 %) Dirichlet(Revmat{all})
84.8 % ( 81 %) Slider(Revmat{all})
35.9 % ( 27 %) Dirichlet(Pi{all})
37.5 % ( 28 %) Slider(Pi{all})
79.7 % ( 61 %) Multiplier(Alpha{1,2})
74.4 % ( 54 %) Multiplier(Alpha{3})
80.0 % ( 65 %) Slider(Pinvar{all})
57.4 % ( 58 %) ExtSPR(Tau{all},V{all})
59.8 % ( 69 %) ExtTBR(Tau{all},V{all})
67.4 % ( 71 %) NNI(Tau{all},V{all})
51.5 % ( 46 %) ParsSPR(Tau{all},V{all})
27.3 % ( 24 %) Multiplier(V{all})
67.7 % ( 64 %) Nodeslider(V{all})
27.6 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.71 0.48 0.30
2 | 166399 0.73 0.50
3 | 166476 166649 0.74
4 | 166764 166997 166715
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.71 0.48 0.30
2 | 166197 0.73 0.50
3 | 167170 166605 0.74
4 | 166796 166294 166938
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -650.03
| 1 2 |
| 1 |
| 2 2 22 2 1 |
| * * 2 |
| 2 21 * 2 1 *1 1 2 2 |
| 1 1 1 1 1 12 2 1 |
| 1 1 1 1 2 * 2 2 2 1 1 11 *|
|2* 2 2 22 2 1 2 2 2 2 2 2 22 |
| 2 1 1 2 2 2 21 11 21 1 2 1 |
| 1 * 1 1 1 1 1 2 1 |
| 2 1 2 1 1 2 2 2 |
| 12 2 * 1 111 1 |
|1 2 2 2 |
| 2 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -653.83
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -647.96 -659.51
2 -647.57 -660.84
--------------------------------------
TOTAL -647.75 -660.38
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.093485 0.000608 0.051158 0.145246 0.089709 1233.22 1367.11 1.000
r(A<->C){all} 0.111862 0.004368 0.009992 0.243902 0.098514 413.26 503.82 1.001
r(A<->G){all} 0.171980 0.006443 0.037016 0.329354 0.161453 225.19 301.97 1.000
r(A<->T){all} 0.077741 0.003039 0.000138 0.182334 0.065728 331.14 359.21 1.001
r(C<->G){all} 0.037897 0.001388 0.000020 0.113160 0.025969 697.58 699.51 1.000
r(C<->T){all} 0.508286 0.010090 0.325719 0.712712 0.508815 435.29 452.39 1.000
r(G<->T){all} 0.092233 0.002688 0.007593 0.190577 0.083772 411.27 426.56 1.001
pi(A){all} 0.242394 0.000480 0.200817 0.286125 0.241944 1203.67 1209.77 1.000
pi(C){all} 0.249892 0.000504 0.207480 0.294509 0.249084 1209.08 1313.81 1.000
pi(G){all} 0.193492 0.000418 0.154276 0.233573 0.192852 1261.49 1296.09 1.000
pi(T){all} 0.314222 0.000559 0.268362 0.361642 0.314476 1042.28 1117.31 1.000
alpha{1,2} 0.581252 0.488578 0.000266 2.017942 0.334177 980.51 1125.10 1.000
alpha{3} 1.213948 1.083572 0.000506 3.216179 0.937521 817.45 964.24 1.000
pinvar{all} 0.568679 0.038574 0.160037 0.885355 0.610529 534.04 648.46 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
---------------
1 -- .********
2 -- .*.......
3 -- ..*......
4 -- ...*.....
5 -- ....*....
6 -- .....*...
7 -- ......*..
8 -- .......*.
9 -- ........*
10 -- ...*..*..
11 -- .******.*
12 -- .*.****.*
13 -- .*.******
14 -- ..*******
15 -- ..*....*.
16 -- .....*..*
17 -- ...**.*..
18 -- ....*...*
19 -- ....**...
20 -- ...*..*.*
21 -- ...****.*
22 -- ...*.**..
23 -- ...******
---------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
10 2887 0.961692 0.002355 0.960027 0.963358 2
11 1063 0.354097 0.004240 0.351099 0.357095 2
12 989 0.329447 0.008951 0.323118 0.335776 2
13 687 0.228847 0.006124 0.224517 0.233178 2
14 554 0.184544 0.020728 0.169887 0.199201 2
15 437 0.145570 0.006124 0.141239 0.149900 2
16 390 0.129913 0.002827 0.127915 0.131912 2
17 385 0.128248 0.008009 0.122585 0.133911 2
18 364 0.121252 0.001884 0.119920 0.122585 2
19 362 0.120586 0.007537 0.115256 0.125916 2
20 351 0.116922 0.012719 0.107928 0.125916 2
21 350 0.116589 0.000000 0.116589 0.116589 2
22 344 0.114590 0.001884 0.113258 0.115923 2
23 333 0.110926 0.008951 0.104597 0.117255 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.015382 0.000061 0.002787 0.030662 0.013927 1.001 2
length{all}[2] 0.011153 0.000032 0.002129 0.022261 0.010206 1.000 2
length{all}[3] 0.020693 0.000074 0.006649 0.038455 0.019217 1.000 2
length{all}[4] 0.002063 0.000005 0.000000 0.006445 0.001405 1.000 2
length{all}[5] 0.002049 0.000004 0.000000 0.006138 0.001400 1.000 2
length{all}[6] 0.002125 0.000005 0.000000 0.006633 0.001392 1.001 2
length{all}[7] 0.002102 0.000005 0.000001 0.006313 0.001443 1.000 2
length{all}[8] 0.017213 0.000067 0.003935 0.032976 0.015890 1.000 2
length{all}[9] 0.002049 0.000005 0.000002 0.006411 0.001369 1.000 2
length{all}[10] 0.004190 0.000010 0.000109 0.010464 0.003394 1.000 2
length{all}[11] 0.005262 0.000019 0.000018 0.013949 0.004282 1.001 2
length{all}[12] 0.004543 0.000012 0.000000 0.010655 0.003778 1.000 2
length{all}[13] 0.004692 0.000017 0.000008 0.013163 0.003399 0.999 2
length{all}[14] 0.005415 0.000020 0.000041 0.014131 0.004219 1.000 2
length{all}[15] 0.004070 0.000013 0.000002 0.010843 0.003187 1.000 2
length{all}[16] 0.001983 0.000004 0.000007 0.006098 0.001459 0.999 2
length{all}[17] 0.002054 0.000005 0.000003 0.006272 0.001386 1.000 2
length{all}[18] 0.002026 0.000005 0.000002 0.006261 0.001313 0.998 2
length{all}[19] 0.002092 0.000005 0.000006 0.006651 0.001370 0.997 2
length{all}[20] 0.002227 0.000006 0.000001 0.006332 0.001546 0.997 2
length{all}[21] 0.003176 0.000009 0.000013 0.009789 0.002199 0.997 2
length{all}[22] 0.002053 0.000004 0.000006 0.006015 0.001483 0.997 2
length{all}[23] 0.004601 0.000016 0.000023 0.011782 0.003375 1.015 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006595
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.015
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C5 (5)
|
+------------------------------------------------------------------------ C6 (6)
|
|------------------------------------------------------------------------ C8 (8)
|
|------------------------------------------------------------------------ C9 (9)
|
| /------------------------------------ C4 (4)
\-----------------96----------------+
\------------------------------------ C7 (7)
Phylogram (based on average branch lengths):
/---------------------------------------------------- C1 (1)
|
|-------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
|
|----- C5 (5)
|
+----- C6 (6)
|
|------------------------------------------------------------ C8 (8)
|
|----- C9 (9)
|
| /----- C4 (4)
\------------+
\----- C7 (7)
|-----------------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1892 trees sampled):
50 % credible set contains 481 trees
90 % credible set contains 1592 trees
95 % credible set contains 1742 trees
99 % credible set contains 1862 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C2,C3,C5,C6,C8,C9,(C4,C7))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **9** sequences, **121** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -648.03, AIC-c = 1332.28 (18 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.087
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.429
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
----
## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=9, Len=121
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC
*********:*:*************.:****
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT
***.**********************************************
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQQLSDIGYSFDYGK
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 SYDNSDPQSLSDIGYSFDYGK
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 SYDTSDPQLLSDIGYSFDYGK
***.**** ************
>BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------------------------------------------ATGATGCGTGTGCAAAGACCACCCACACTCCTGCTTCTCTTACTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAACACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGATACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------------------------------------------ATGATGCGTGTGCAAAGACCACCCACACTTCTGCTCATATTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTTCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTTCTCATCTTACTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACCCCTATACCTGAGCACTGTTCTACCCTTGCTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACAGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGCAGTTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATGCCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATGCCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ---------------------------------------------------------ATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTACTAGTTGCTAATGCTTTTTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTTATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGATACCTCTTACGACAATTCTGACCCTCAGTCTCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG >TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 ATGATGAGTATGAGGTCGAGAAGATCCATGTTCATTGAGCATTTTAACGAACTTATGATGCGTGTGCAAAGACCACCCACACTCTTGCTCATTTTATTAGTTGCTAATGCTTTCTCAAAGCCCATTGGCACTCCTATACCTGAGCACTGTTCTACCCTTGTTGGTAGAGAGTTTCAATCTTGTATTCGACAAGCACAGTTTGATACGGCTGGCATGTACACTAATCGCGTCATCGTGCTCGATCGAGCACGTACTCATCGCTATCCTATTGATCGTGACACTACTACTGCTCACGACACCTCTTACGACACTTCTGACCCTCAGTTGCTGTCTGATATTGGTTACTCCTTTGATTATGGGAAG
>BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLLLLVANAFSKPIGTPIPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK >BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 ------------------MMRVQRPPTLLLILLVANAFSKPIGTSIPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK >BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLFLILLVANAFSKPIGTPIPEHC STLAGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQQLSDIGYSFDYGK >HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK >TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK >TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK >LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPMPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK >YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5 -------------------MRVQRPPTLLLILLVANAFSKPIGTPIPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDNSDPQSLSDIGYSFDYGK >TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5 MMSMRSRRSMFIEHFNELMMRVQRPPTLLLILLVANAFSKPIGTPIPEHC STLVGREFQSCIRQAQFDTAGMYTNRVIVLDRARTHRYPIDRDTTTAHDT SYDTSDPQLLSDIGYSFDYGK
Reading sequence file /data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/fasta/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1
Found 9 sequences of length 363
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 1.9%
Found 5 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 1
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 14 polymorphic sites
**p-Value(s)**
----------
NSS: 1.72e-01 (1000 permutations)
Max Chi^2: 6.90e-01 (1000 permutations)
PHI (Permutation): 1.90e-01 (1000 permutations)
PHI (Normal): 5.44e-02
#NEXUS
[ID: 4389161250]
begin taxa;
dimensions ntax=9;
taxlabels
BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5
HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5
TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
;
end;
begin trees;
translate
1 BY140562_orf3_AWH65922_1_2014_06_28_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
2 BY140535_orf3_AWH65911_1_2014_06_26_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
3 BtPa_GD2013_NA_AIA62344_1_2013_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
4 HKU5_1_LMH03f_NS3a_YP_001039963_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
5 TT06f_NS3a_ABN10894_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
6 TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
7 LMH03f_NS3a_ABN10876_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5,
8 YD13403_orf3_AWH65933_1_2013_06_03_China_Unknown_Pipistrellus_bat_coronavirus_HKU5,
9 TT07f_NS3a_ABN10903_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.392705e-02,2:1.020632e-02,3:1.921686e-02,5:1.400109e-03,6:1.391693e-03,8:1.589043e-02,9:1.368947e-03,(4:1.405241e-03,7:1.443454e-03)0.962:3.393578e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.392705e-02,2:1.020632e-02,3:1.921686e-02,5:1.400109e-03,6:1.391693e-03,8:1.589043e-02,9:1.368947e-03,(4:1.405241e-03,7:1.443454e-03):3.393578e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -647.82 -660.96
2 -647.93 -665.33
--------------------------------------
TOTAL -647.87 -664.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.094619 0.000665 0.050248 0.148044 0.091328 1421.47 1441.77 1.000
r(A<->C){all} 0.105840 0.003778 0.008375 0.228855 0.094510 316.81 425.09 1.000
r(A<->G){all} 0.172186 0.006908 0.032141 0.335241 0.159813 318.51 361.90 1.000
r(A<->T){all} 0.080640 0.002776 0.001671 0.178999 0.071481 327.85 469.68 1.001
r(C<->G){all} 0.039367 0.001549 0.000008 0.119285 0.027322 349.85 497.00 1.001
r(C<->T){all} 0.505276 0.010267 0.310899 0.698400 0.505749 446.42 470.40 1.000
r(G<->T){all} 0.096691 0.003135 0.005646 0.203415 0.087039 462.70 479.18 1.002
pi(A){all} 0.241701 0.000468 0.199043 0.283782 0.241689 1119.63 1226.01 1.000
pi(C){all} 0.250569 0.000503 0.208812 0.296062 0.249816 1173.45 1223.01 1.001
pi(G){all} 0.192929 0.000398 0.155918 0.233177 0.192453 1288.05 1294.35 1.000
pi(T){all} 0.314801 0.000550 0.271634 0.361426 0.313900 1199.69 1217.12 1.000
alpha{1,2} 0.600158 0.564324 0.000015 2.072402 0.337430 1044.67 1169.53 1.000
alpha{3} 1.197001 1.047704 0.000705 3.243417 0.934710 925.73 1004.67 1.000
pinvar{all} 0.572390 0.037415 0.169863 0.876821 0.605757 745.32 758.27 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,C3,C5,C6,C8,C9,(C4,C7))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **9** sequences, **121** codons, and **1** partitions from `/data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result/original_alignment/fubar/results/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1/TT03f_NS3a_ABN10885_1_NA_China_Bat_Pipistrellus_bat_coronavirus_HKU5.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -648.03, AIC-c = 1332.28 (18 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.087 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.429 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results ---- ## FUBAR inferred no sites under subject to positive selection at posterior probability >= 0.9
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
