--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:25:14 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/11res/rmlB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1363.54 -1366.43 2 -1363.54 -1366.66 -------------------------------------- TOTAL -1363.54 -1366.55 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897703 0.090334 0.346355 1.480789 0.861307 1466.17 1483.58 1.000 r(A<->C){all} 0.164386 0.019525 0.000169 0.447856 0.128052 88.37 165.12 1.000 r(A<->G){all} 0.171182 0.020389 0.000105 0.451545 0.134775 453.30 473.82 1.000 r(A<->T){all} 0.161557 0.019262 0.000037 0.445107 0.126177 190.89 212.45 1.021 r(C<->G){all} 0.163240 0.021572 0.000100 0.463016 0.117682 117.60 165.59 1.002 r(C<->T){all} 0.175586 0.021828 0.000162 0.476840 0.137348 221.95 244.04 1.012 r(G<->T){all} 0.164048 0.019741 0.000057 0.452387 0.125172 236.66 245.33 1.000 pi(A){all} 0.235676 0.000177 0.210036 0.261400 0.235627 1407.65 1454.32 1.001 pi(C){all} 0.316860 0.000219 0.287623 0.344544 0.316534 1131.41 1214.70 1.000 pi(G){all} 0.273956 0.000201 0.246402 0.300802 0.273766 1281.54 1290.58 1.000 pi(T){all} 0.173508 0.000143 0.150317 0.196709 0.173103 1248.42 1287.01 1.000 alpha{1,2} 0.432779 0.237202 0.000118 1.423052 0.255054 1003.82 1207.02 1.000 alpha{3} 0.461632 0.243672 0.000147 1.481021 0.295598 1054.36 1098.21 1.000 pinvar{all} 0.998461 0.000003 0.994966 0.999999 0.999024 1078.15 1202.02 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1288.148682 Model 2: PositiveSelection -1288.148725 Model 0: one-ratio -1288.148743 Model 7: beta -1288.148682 Model 8: beta&w>1 -1288.148682 Model 0 vs 1 1.2199999991935329E-4 Model 2 vs 1 8.600000001024455E-5 Model 8 vs 7 0.0
>C1 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG LRATIDWYRNNESWWRPLKDAVEARYEERGRoo >C2 LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >C3 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG LRATIDWYRNNESWWRPLKDAVEARYEERGRoo >C4 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG LRATIDWYRNNESWWRPLKDAVEARYEERGRoo >C5 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG LRATIDWYRNNESWWRPLKDAVEARYEERGRoo >C6 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG LRATIDWYRNNESWWRPLKDAVEARYEERGRoo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=335 C1 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD C2 LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD C3 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD C4 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD C5 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD C6 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD ************************************************ C1 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV C2 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV C3 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV C4 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV C5 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV C6 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV ************************************************** C1 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS C2 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS C3 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS C4 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS C5 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS C6 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ************************************************** C1 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG C2 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG C3 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG C4 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG C5 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG C6 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG ************************************************** C1 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT C2 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT C3 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT C4 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT C5 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT C6 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT ************************************************** C1 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD C2 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD C3 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD C4 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD C5 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD C6 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD ************************************************** C1 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo C2 EGLRATIDWYRNNESWWRPLKDAVEARYEERGR-- C3 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo C4 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo C5 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo C6 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo ********************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 333 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 333 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10020] Library Relaxation: Multi_proc [96] Relaxation Summary: [10020]--->[10020] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.506 Mb, Max= 30.892 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA C2 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA C3 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA C4 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA C5 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA C6 MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA ************************************************** C1 VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG C2 VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG C3 VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG C4 VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG C5 VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG C6 VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG ************************************************** C1 TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT C2 TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT C3 TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT C4 TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT C5 TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT C6 TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT ************************************************** C1 KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR C2 KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR C3 KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR C4 KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR C5 KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR C6 KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR ************************************************** C1 PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL C2 PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL C3 PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL C4 PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL C5 PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL C6 PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL ************************************************** C1 RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG C2 RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG C3 RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG C4 RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG C5 RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG C6 RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG ************************************************** C1 LRATIDWYRNNESWWRPLKDAVEARYEERGR C2 LRATIDWYRNNESWWRPLKDAVEARYEERGR C3 LRATIDWYRNNESWWRPLKDAVEARYEERGR C4 LRATIDWYRNNESWWRPLKDAVEARYEERGR C5 LRATIDWYRNNESWWRPLKDAVEARYEERGR C6 LRATIDWYRNNESWWRPLKDAVEARYEERGR ******************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA C2 TTGACCATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA C3 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA C4 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA C5 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA C6 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA ******************************************** C1 TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC C2 TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC C3 TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC C4 TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC C5 TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC C6 TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC ************************************************** C1 TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC C2 TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC C3 TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC C4 TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC C5 TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC C6 TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC ************************************************** C1 CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT C2 CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT C3 CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT C4 CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT C5 CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT C6 CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT ************************************************** C1 CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC C2 CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC C3 CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC C4 CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC C5 CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC C6 CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ************************************************** C1 ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC C2 ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC C3 ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC C4 ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC C5 ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC C6 ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ************************************************** C1 ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT C2 ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT C3 ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT C4 ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT C5 ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT C6 ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT ************************************************** C1 GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC C2 GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC C3 GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC C4 GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC C5 GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC C6 GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC ************************************************** C1 CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG C2 CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG C3 CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG C4 CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG C5 CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG C6 CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG ************************************************** C1 GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA C2 GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA C3 GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA C4 GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA C5 GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA C6 GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA ************************************************** C1 CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC C2 CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC C3 CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC C4 CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC C5 CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC C6 CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC ************************************************** C1 AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC C2 AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC C3 AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC C4 AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC C5 AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC C6 AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC ************************************************** C1 CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA C2 CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA C3 CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA C4 CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA C5 CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA C6 CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA ************************************************** C1 CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA C2 CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA C3 CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA C4 CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA C5 CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA C6 CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA ************************************************** C1 TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC C2 TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC C3 TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC C4 TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC C5 TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC C6 TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC ************************************************** C1 GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA C2 GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA C3 GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA C4 GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA C5 GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA C6 GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA ************************************************** C1 CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA C2 CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA C3 CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA C4 CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA C5 CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA C6 CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA ************************************************** C1 CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC C2 CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC C3 CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC C4 CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC C5 CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC C6 CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC ************************************************** C1 GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG C2 GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG C3 GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG C4 GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG C5 GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG C6 GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG ************************************************** C1 GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- C2 GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- C3 GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- C4 GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- C5 GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- C6 GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ************************************************* C1 ----- C2 ----- C3 ----- C4 ----- C5 ----- C6 ----- >C1 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >C2 TTGACCATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >C3 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >C4 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >C5 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >C6 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >C1 ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >C2 LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >C3 ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >C4 ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >C5 ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >C6 ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1005 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579789426 Setting output file names to "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 2009010337 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0826122305 Seed = 543160335 Swapseed = 1579789426 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 7 unique site patterns Division 2 has 7 unique site patterns Division 3 has 7 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2230.699382 -- -24.965149 Chain 2 -- -2230.699382 -- -24.965149 Chain 3 -- -2230.699382 -- -24.965149 Chain 4 -- -2230.699382 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2230.699382 -- -24.965149 Chain 2 -- -2230.699384 -- -24.965149 Chain 3 -- -2230.699043 -- -24.965149 Chain 4 -- -2230.699384 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2230.699] (-2230.699) (-2230.699) (-2230.699) * [-2230.699] (-2230.699) (-2230.699) (-2230.699) 500 -- (-1384.490) [-1366.848] (-1372.110) (-1389.401) * [-1372.428] (-1375.730) (-1389.295) (-1382.474) -- 0:00:00 1000 -- (-1373.328) [-1372.838] (-1377.947) (-1378.945) * (-1368.708) (-1376.232) [-1370.585] (-1385.240) -- 0:00:00 1500 -- (-1372.835) (-1374.990) [-1367.116] (-1379.236) * (-1376.074) (-1384.761) [-1370.977] (-1379.843) -- 0:00:00 2000 -- (-1370.994) (-1378.811) [-1366.519] (-1373.753) * (-1370.872) [-1373.614] (-1368.114) (-1370.719) -- 0:00:00 2500 -- (-1376.463) (-1382.956) (-1370.703) [-1371.062] * (-1369.907) [-1375.790] (-1381.009) (-1371.871) -- 0:00:00 3000 -- (-1373.491) (-1370.287) [-1375.869] (-1367.419) * (-1369.242) [-1370.136] (-1378.424) (-1372.513) -- 0:00:00 3500 -- (-1378.367) (-1375.158) (-1374.016) [-1372.348] * [-1368.333] (-1375.544) (-1380.882) (-1370.776) -- 0:00:00 4000 -- (-1374.047) (-1383.065) [-1373.823] (-1373.222) * [-1372.582] (-1371.748) (-1375.081) (-1371.099) -- 0:00:00 4500 -- (-1366.975) [-1371.339] (-1378.362) (-1372.546) * (-1370.219) [-1371.338] (-1374.266) (-1376.743) -- 0:00:00 5000 -- (-1380.960) (-1377.035) [-1377.878] (-1374.513) * [-1374.897] (-1372.069) (-1372.051) (-1372.514) -- 0:00:00 Average standard deviation of split frequencies: 0.121422 5500 -- [-1376.162] (-1368.509) (-1374.560) (-1368.355) * [-1372.638] (-1371.070) (-1372.281) (-1369.263) -- 0:00:00 6000 -- (-1370.165) (-1370.683) [-1369.795] (-1384.179) * (-1374.331) [-1372.947] (-1377.391) (-1370.958) -- 0:00:00 6500 -- (-1381.978) [-1373.495] (-1372.632) (-1373.434) * (-1380.745) [-1372.574] (-1373.220) (-1372.391) -- 0:00:00 7000 -- [-1371.546] (-1374.308) (-1379.459) (-1376.577) * (-1373.990) [-1379.821] (-1377.617) (-1374.486) -- 0:00:00 7500 -- (-1375.153) [-1377.613] (-1376.765) (-1373.013) * (-1381.750) [-1372.537] (-1369.181) (-1378.433) -- 0:00:00 8000 -- [-1370.614] (-1371.562) (-1376.275) (-1371.387) * (-1373.465) [-1368.663] (-1378.617) (-1374.710) -- 0:00:00 8500 -- [-1367.889] (-1370.160) (-1372.581) (-1377.414) * (-1369.721) (-1369.911) [-1375.413] (-1371.960) -- 0:00:00 9000 -- [-1368.908] (-1372.034) (-1372.741) (-1370.743) * (-1363.523) (-1375.428) [-1376.443] (-1373.261) -- 0:00:00 9500 -- (-1371.105) (-1371.185) [-1370.785] (-1371.011) * (-1363.960) (-1377.986) [-1367.071] (-1371.073) -- 0:00:00 10000 -- (-1368.693) (-1377.121) [-1369.452] (-1373.658) * [-1364.859] (-1376.433) (-1375.041) (-1371.323) -- 0:00:00 Average standard deviation of split frequencies: 0.103856 10500 -- (-1371.261) (-1369.270) (-1373.829) [-1373.395] * (-1364.157) [-1370.553] (-1364.851) (-1373.614) -- 0:01:34 11000 -- (-1375.319) (-1370.681) (-1376.488) [-1375.737] * (-1364.300) (-1369.080) [-1364.076] (-1375.074) -- 0:01:29 11500 -- (-1367.780) (-1376.338) (-1378.287) [-1368.904] * (-1365.773) (-1371.931) [-1362.669] (-1371.048) -- 0:01:25 12000 -- [-1371.133] (-1376.192) (-1371.747) (-1374.318) * (-1362.763) (-1380.791) [-1362.532] (-1380.708) -- 0:01:22 12500 -- [-1369.880] (-1375.945) (-1374.093) (-1369.326) * [-1362.761] (-1373.639) (-1365.721) (-1373.677) -- 0:01:19 13000 -- (-1373.484) [-1373.403] (-1373.259) (-1365.189) * (-1362.674) (-1381.620) (-1367.192) [-1372.550] -- 0:01:15 13500 -- (-1373.553) (-1367.978) [-1372.152] (-1364.416) * (-1363.750) (-1378.963) (-1363.363) [-1372.473] -- 0:01:13 14000 -- (-1379.540) [-1372.118] (-1366.534) (-1365.121) * [-1364.920] (-1370.295) (-1363.355) (-1374.491) -- 0:01:10 14500 -- [-1370.626] (-1379.558) (-1376.107) (-1363.529) * (-1366.496) (-1381.190) (-1365.372) [-1371.957] -- 0:01:07 15000 -- [-1367.437] (-1367.226) (-1380.480) (-1364.985) * (-1365.500) (-1371.738) [-1362.745] (-1373.868) -- 0:01:05 Average standard deviation of split frequencies: 0.071331 15500 -- (-1374.892) [-1368.484] (-1377.356) (-1362.751) * (-1364.241) [-1372.874] (-1365.711) (-1377.192) -- 0:01:03 16000 -- (-1371.110) (-1371.036) [-1375.586] (-1363.671) * [-1363.032] (-1375.294) (-1362.557) (-1374.594) -- 0:01:01 16500 -- (-1376.090) [-1368.957] (-1378.390) (-1363.179) * (-1363.751) (-1376.544) [-1362.236] (-1378.078) -- 0:00:59 17000 -- [-1375.016] (-1374.295) (-1375.567) (-1362.638) * (-1364.597) (-1372.188) (-1362.291) [-1376.529] -- 0:00:57 17500 -- [-1372.647] (-1371.110) (-1370.977) (-1363.622) * [-1363.597] (-1378.816) (-1363.786) (-1375.044) -- 0:00:56 18000 -- (-1368.897) [-1370.871] (-1369.319) (-1363.634) * (-1365.456) (-1373.932) [-1365.991] (-1372.748) -- 0:00:54 18500 -- (-1370.880) [-1370.123] (-1378.534) (-1363.853) * (-1364.777) [-1369.222] (-1365.359) (-1374.604) -- 0:00:53 19000 -- (-1374.830) (-1378.498) [-1375.752] (-1362.795) * [-1363.067] (-1368.920) (-1364.237) (-1376.240) -- 0:00:51 19500 -- (-1369.851) (-1382.723) (-1382.653) [-1364.045] * (-1364.145) [-1371.511] (-1363.074) (-1381.249) -- 0:00:50 20000 -- [-1375.288] (-1386.949) (-1369.398) (-1365.527) * (-1363.341) (-1366.809) (-1363.218) [-1370.562] -- 0:00:49 Average standard deviation of split frequencies: 0.048154 20500 -- (-1366.737) (-1365.196) (-1374.354) [-1367.414] * (-1364.672) (-1371.666) (-1368.163) [-1370.684] -- 0:00:47 21000 -- (-1371.964) (-1362.270) [-1370.524] (-1365.682) * (-1369.156) (-1374.018) [-1363.074] (-1372.839) -- 0:00:46 21500 -- (-1369.750) [-1363.425] (-1382.388) (-1365.735) * (-1371.759) (-1374.491) (-1363.981) [-1371.915] -- 0:00:45 22000 -- (-1382.576) (-1362.871) [-1363.581] (-1364.850) * (-1364.602) [-1368.062] (-1364.849) (-1377.034) -- 0:00:44 22500 -- (-1377.780) (-1366.944) [-1363.601] (-1371.498) * (-1366.829) (-1369.080) [-1364.637] (-1371.249) -- 0:00:43 23000 -- (-1384.681) (-1368.599) (-1362.951) [-1366.181] * [-1365.017] (-1375.393) (-1364.398) (-1373.523) -- 0:00:42 23500 -- (-1372.279) (-1363.396) [-1365.783] (-1365.582) * (-1364.866) (-1379.395) (-1365.922) [-1379.761] -- 0:01:23 24000 -- (-1374.490) (-1364.152) [-1368.643] (-1364.363) * (-1366.288) (-1373.744) (-1364.631) [-1374.146] -- 0:01:21 24500 -- (-1374.982) [-1366.244] (-1365.051) (-1364.705) * [-1365.121] (-1367.726) (-1365.014) (-1376.697) -- 0:01:19 25000 -- (-1372.902) (-1366.183) [-1364.171] (-1363.655) * (-1369.471) [-1369.245] (-1367.288) (-1372.748) -- 0:01:18 Average standard deviation of split frequencies: 0.036262 25500 -- (-1380.159) [-1362.917] (-1366.935) (-1364.983) * (-1366.677) [-1371.387] (-1365.671) (-1378.746) -- 0:01:16 26000 -- (-1369.539) (-1365.843) (-1367.029) [-1363.551] * [-1363.507] (-1371.956) (-1363.550) (-1377.192) -- 0:01:14 26500 -- (-1379.519) (-1362.864) [-1363.709] (-1362.293) * (-1363.403) (-1375.411) (-1363.662) [-1368.955] -- 0:01:13 27000 -- (-1374.553) [-1366.101] (-1365.217) (-1362.971) * (-1363.665) (-1374.809) (-1366.617) [-1374.729] -- 0:01:12 27500 -- [-1376.507] (-1367.313) (-1363.875) (-1364.590) * (-1363.054) (-1376.571) [-1364.427] (-1373.125) -- 0:01:10 28000 -- (-1369.815) [-1365.634] (-1363.882) (-1363.443) * [-1364.034] (-1371.772) (-1365.141) (-1373.278) -- 0:01:09 28500 -- (-1376.863) [-1363.591] (-1366.127) (-1363.490) * (-1363.667) [-1366.459] (-1363.001) (-1375.759) -- 0:01:08 29000 -- (-1366.970) [-1363.899] (-1366.804) (-1363.311) * (-1363.070) [-1368.253] (-1362.912) (-1377.446) -- 0:01:06 29500 -- [-1373.719] (-1365.227) (-1363.923) (-1362.800) * [-1362.770] (-1373.728) (-1363.173) (-1380.911) -- 0:01:05 30000 -- (-1369.715) (-1365.081) [-1366.850] (-1363.875) * [-1362.372] (-1376.978) (-1361.927) (-1374.520) -- 0:01:04 Average standard deviation of split frequencies: 0.033050 30500 -- (-1374.462) (-1366.909) [-1365.096] (-1364.657) * [-1362.874] (-1373.497) (-1365.336) (-1371.993) -- 0:01:03 31000 -- [-1372.831] (-1367.904) (-1362.944) (-1365.361) * [-1362.501] (-1370.974) (-1366.430) (-1377.020) -- 0:01:02 31500 -- (-1378.897) (-1366.608) [-1362.960] (-1363.075) * (-1365.328) [-1373.874] (-1365.971) (-1378.409) -- 0:01:01 32000 -- (-1382.049) (-1363.386) [-1364.742] (-1367.085) * (-1364.793) (-1372.209) (-1364.317) [-1370.840] -- 0:01:00 32500 -- (-1375.190) [-1364.308] (-1364.221) (-1368.870) * [-1363.573] (-1368.483) (-1365.338) (-1370.503) -- 0:00:59 33000 -- [-1368.458] (-1364.667) (-1364.036) (-1368.714) * (-1364.954) [-1365.682] (-1368.772) (-1376.416) -- 0:00:58 33500 -- (-1373.426) [-1364.601] (-1366.965) (-1362.873) * [-1368.397] (-1373.068) (-1367.847) (-1366.537) -- 0:00:57 34000 -- [-1371.987] (-1366.201) (-1366.205) (-1362.179) * (-1371.187) (-1373.866) (-1363.373) [-1372.921] -- 0:00:56 34500 -- (-1374.195) (-1363.466) (-1367.111) [-1363.519] * (-1368.654) [-1372.204] (-1364.056) (-1376.604) -- 0:00:55 35000 -- (-1377.891) (-1362.793) [-1363.373] (-1362.793) * (-1365.543) (-1370.490) [-1363.859] (-1378.967) -- 0:00:55 Average standard deviation of split frequencies: 0.036166 35500 -- (-1375.504) (-1363.630) (-1365.298) [-1362.622] * (-1365.880) (-1377.094) (-1363.371) [-1381.043] -- 0:00:54 36000 -- [-1367.924] (-1363.853) (-1366.934) (-1362.317) * (-1366.255) (-1379.212) [-1363.489] (-1377.966) -- 0:00:53 36500 -- (-1372.414) (-1363.418) (-1365.428) [-1364.331] * (-1365.011) (-1372.970) [-1364.551] (-1375.905) -- 0:00:52 37000 -- [-1371.745] (-1362.700) (-1367.509) (-1362.463) * (-1363.757) (-1374.062) [-1365.085] (-1371.313) -- 0:01:18 37500 -- (-1381.688) [-1363.466] (-1366.694) (-1362.925) * (-1364.780) [-1371.651] (-1363.498) (-1375.264) -- 0:01:17 38000 -- (-1368.288) (-1363.038) (-1366.529) [-1364.856] * (-1363.524) (-1378.780) (-1363.418) [-1373.514] -- 0:01:15 38500 -- (-1375.652) [-1362.797] (-1367.527) (-1362.917) * (-1365.335) (-1368.777) (-1364.992) [-1372.518] -- 0:01:14 39000 -- [-1377.184] (-1363.101) (-1367.300) (-1365.824) * (-1363.755) [-1374.498] (-1364.553) (-1371.866) -- 0:01:13 39500 -- [-1375.802] (-1364.238) (-1365.451) (-1366.597) * [-1363.652] (-1372.629) (-1363.231) (-1374.294) -- 0:01:12 40000 -- (-1375.825) (-1362.674) [-1369.230] (-1366.101) * (-1363.860) [-1367.647] (-1364.242) (-1371.719) -- 0:01:12 Average standard deviation of split frequencies: 0.038833 40500 -- (-1371.267) (-1362.665) (-1366.856) [-1364.628] * (-1364.748) (-1378.766) (-1363.094) [-1367.714] -- 0:01:11 41000 -- (-1372.242) (-1363.889) (-1363.899) [-1362.972] * (-1364.020) (-1373.983) [-1363.392] (-1374.126) -- 0:01:10 41500 -- (-1372.430) (-1364.381) [-1364.197] (-1363.384) * (-1364.591) [-1369.816] (-1362.333) (-1368.652) -- 0:01:09 42000 -- (-1370.402) (-1364.274) (-1364.601) [-1363.154] * (-1364.145) (-1371.898) (-1364.554) [-1369.969] -- 0:01:08 42500 -- [-1370.441] (-1362.440) (-1365.328) (-1365.417) * [-1363.336] (-1375.459) (-1362.686) (-1372.654) -- 0:01:07 43000 -- [-1365.591] (-1367.243) (-1373.092) (-1375.368) * (-1363.632) [-1375.173] (-1362.608) (-1368.837) -- 0:01:06 43500 -- [-1372.476] (-1364.973) (-1368.375) (-1365.860) * (-1367.252) (-1374.244) (-1363.003) [-1377.652] -- 0:01:05 44000 -- [-1375.100] (-1366.461) (-1367.918) (-1365.904) * (-1366.221) [-1371.314] (-1362.435) (-1376.656) -- 0:01:05 44500 -- [-1372.275] (-1364.755) (-1363.830) (-1366.996) * (-1365.156) [-1377.253] (-1363.856) (-1375.693) -- 0:01:04 45000 -- (-1378.655) [-1366.573] (-1363.675) (-1365.835) * (-1364.524) (-1369.489) (-1362.651) [-1373.111] -- 0:01:03 Average standard deviation of split frequencies: 0.036600 45500 -- (-1377.962) (-1364.973) (-1362.850) [-1363.686] * (-1366.637) [-1374.448] (-1365.219) (-1378.201) -- 0:01:02 46000 -- (-1375.747) (-1366.710) [-1361.839] (-1363.148) * (-1365.841) (-1375.540) (-1364.406) [-1372.709] -- 0:01:02 46500 -- [-1375.424] (-1364.841) (-1365.337) (-1362.754) * [-1365.088] (-1377.638) (-1364.920) (-1373.935) -- 0:01:01 47000 -- (-1370.469) (-1364.896) (-1364.764) [-1363.851] * (-1364.507) (-1373.242) (-1367.869) [-1371.111] -- 0:01:00 47500 -- (-1379.353) [-1365.087] (-1363.609) (-1366.139) * (-1365.095) (-1378.061) [-1363.216] (-1373.979) -- 0:01:00 48000 -- (-1374.905) (-1362.735) [-1366.677] (-1367.062) * (-1363.371) [-1371.079] (-1365.334) (-1372.385) -- 0:00:59 48500 -- [-1372.327] (-1367.087) (-1362.298) (-1363.920) * (-1363.656) (-1373.672) [-1363.229] (-1373.252) -- 0:00:58 49000 -- (-1374.412) [-1363.810] (-1362.250) (-1365.580) * (-1363.450) (-1368.261) (-1368.465) [-1373.131] -- 0:00:58 49500 -- (-1371.728) (-1364.179) [-1362.175] (-1364.240) * (-1364.083) [-1375.414] (-1364.666) (-1376.084) -- 0:00:57 50000 -- (-1368.803) [-1362.772] (-1363.434) (-1364.996) * [-1363.664] (-1372.571) (-1363.809) (-1366.900) -- 0:00:57 Average standard deviation of split frequencies: 0.036286 50500 -- (-1379.725) (-1367.142) [-1364.319] (-1364.360) * (-1364.693) [-1371.762] (-1367.552) (-1375.884) -- 0:01:15 51000 -- (-1374.024) (-1365.984) (-1364.996) [-1363.081] * [-1365.895] (-1376.111) (-1362.256) (-1377.643) -- 0:01:14 51500 -- [-1374.616] (-1373.521) (-1366.414) (-1365.963) * (-1364.422) [-1376.430] (-1364.599) (-1370.386) -- 0:01:13 52000 -- (-1372.878) (-1365.920) (-1364.692) [-1363.636] * [-1362.505] (-1373.597) (-1366.912) (-1376.522) -- 0:01:12 52500 -- (-1374.342) (-1364.236) (-1369.755) [-1363.878] * (-1365.000) [-1370.736] (-1363.526) (-1376.005) -- 0:01:12 53000 -- (-1370.994) (-1363.775) (-1369.755) [-1363.245] * (-1362.638) (-1371.523) [-1361.979] (-1377.645) -- 0:01:11 53500 -- [-1373.764] (-1366.283) (-1365.440) (-1362.361) * [-1363.225] (-1374.152) (-1362.976) (-1369.616) -- 0:01:10 54000 -- (-1373.839) (-1366.159) (-1363.904) [-1363.106] * [-1363.748] (-1375.013) (-1363.161) (-1368.093) -- 0:01:10 54500 -- (-1369.264) (-1366.927) (-1365.616) [-1363.213] * (-1364.403) (-1374.595) [-1363.108] (-1374.544) -- 0:01:09 55000 -- (-1374.738) (-1365.016) [-1364.821] (-1363.643) * (-1363.097) (-1378.063) [-1362.323] (-1369.240) -- 0:01:08 Average standard deviation of split frequencies: 0.029684 55500 -- (-1392.515) [-1366.130] (-1365.119) (-1365.362) * (-1364.048) (-1382.525) [-1367.551] (-1368.153) -- 0:01:08 56000 -- (-1365.172) (-1363.896) (-1366.289) [-1366.535] * (-1366.104) (-1376.856) (-1369.849) [-1367.177] -- 0:01:07 56500 -- [-1364.176] (-1363.375) (-1365.469) (-1368.341) * (-1364.965) [-1372.211] (-1367.474) (-1362.650) -- 0:01:06 57000 -- [-1364.280] (-1366.595) (-1363.801) (-1363.674) * (-1365.932) (-1374.538) [-1364.161] (-1362.884) -- 0:01:06 57500 -- [-1364.746] (-1363.482) (-1366.858) (-1362.797) * [-1365.207] (-1371.451) (-1363.943) (-1367.034) -- 0:01:05 58000 -- (-1364.861) (-1364.046) [-1366.289] (-1363.358) * [-1363.375] (-1373.749) (-1363.864) (-1372.013) -- 0:01:04 58500 -- (-1365.570) (-1362.420) (-1363.684) [-1362.565] * [-1366.190] (-1377.087) (-1363.796) (-1364.190) -- 0:01:04 59000 -- (-1364.948) (-1362.886) [-1365.164] (-1362.631) * (-1363.524) [-1376.495] (-1361.952) (-1364.646) -- 0:01:03 59500 -- [-1368.202] (-1362.810) (-1364.433) (-1368.039) * (-1364.309) (-1373.567) (-1362.512) [-1364.124] -- 0:01:03 60000 -- [-1363.466] (-1363.665) (-1366.448) (-1364.048) * (-1365.252) [-1371.633] (-1362.170) (-1363.669) -- 0:01:02 Average standard deviation of split frequencies: 0.024606 60500 -- (-1365.223) [-1364.033] (-1364.081) (-1366.199) * (-1362.934) [-1371.930] (-1371.229) (-1366.948) -- 0:01:02 61000 -- (-1365.471) (-1368.373) [-1365.038] (-1365.501) * (-1363.605) [-1368.854] (-1368.869) (-1362.439) -- 0:01:01 61500 -- (-1364.115) [-1367.500] (-1364.100) (-1363.631) * [-1363.429] (-1375.492) (-1369.619) (-1365.021) -- 0:01:01 62000 -- (-1362.876) [-1366.878] (-1363.129) (-1364.084) * (-1363.612) (-1373.644) (-1368.572) [-1362.842] -- 0:01:00 62500 -- [-1362.730] (-1364.757) (-1362.723) (-1363.380) * (-1363.562) [-1372.742] (-1368.350) (-1363.455) -- 0:01:00 63000 -- (-1364.819) [-1363.241] (-1365.181) (-1364.908) * [-1364.927] (-1372.511) (-1367.649) (-1363.510) -- 0:00:59 63500 -- (-1367.720) (-1364.515) [-1363.795] (-1362.954) * (-1367.810) (-1379.797) (-1365.174) [-1363.604] -- 0:01:13 64000 -- (-1363.802) (-1362.039) [-1365.453] (-1363.683) * (-1362.791) (-1374.828) (-1363.946) [-1363.254] -- 0:01:13 64500 -- (-1363.717) (-1362.430) [-1362.580] (-1365.160) * (-1364.084) (-1372.679) (-1363.879) [-1363.933] -- 0:01:12 65000 -- (-1364.606) [-1363.703] (-1361.947) (-1364.525) * (-1366.545) (-1369.812) [-1365.537] (-1364.690) -- 0:01:11 Average standard deviation of split frequencies: 0.027499 65500 -- (-1366.894) (-1368.084) (-1362.326) [-1366.256] * [-1363.354] (-1372.756) (-1365.435) (-1365.329) -- 0:01:11 66000 -- (-1364.125) (-1364.766) (-1363.342) [-1363.431] * (-1366.320) (-1379.468) (-1366.784) [-1365.478] -- 0:01:10 66500 -- (-1364.064) [-1363.625] (-1363.470) (-1364.490) * [-1366.012] (-1376.670) (-1362.945) (-1363.982) -- 0:01:10 67000 -- (-1363.668) (-1364.296) [-1363.356] (-1364.835) * (-1368.355) [-1372.808] (-1363.769) (-1365.045) -- 0:01:09 67500 -- (-1364.638) (-1362.377) [-1363.116] (-1365.261) * (-1366.439) [-1375.450] (-1362.935) (-1362.338) -- 0:01:09 68000 -- (-1364.852) [-1362.649] (-1364.707) (-1364.777) * (-1362.708) (-1375.599) (-1363.364) [-1365.087] -- 0:01:08 68500 -- (-1365.357) (-1363.291) (-1363.408) [-1363.935] * (-1363.092) (-1369.081) (-1364.028) [-1364.814] -- 0:01:07 69000 -- (-1363.894) [-1364.105] (-1363.116) (-1369.727) * (-1363.540) (-1380.375) (-1363.544) [-1363.165] -- 0:01:07 69500 -- (-1365.939) (-1363.466) (-1365.551) [-1362.748] * (-1363.588) (-1366.904) [-1366.251] (-1365.124) -- 0:01:06 70000 -- (-1368.417) (-1362.860) [-1365.812] (-1363.800) * (-1362.958) [-1363.756] (-1365.714) (-1363.689) -- 0:01:06 Average standard deviation of split frequencies: 0.022607 70500 -- (-1364.588) [-1363.909] (-1363.261) (-1364.673) * [-1364.937] (-1362.997) (-1363.178) (-1368.048) -- 0:01:05 71000 -- (-1363.243) (-1366.668) (-1363.315) [-1362.238] * (-1366.040) [-1363.021] (-1362.576) (-1365.300) -- 0:01:05 71500 -- [-1362.520] (-1365.266) (-1364.125) (-1365.710) * [-1364.133] (-1363.001) (-1362.072) (-1362.547) -- 0:01:04 72000 -- (-1365.168) [-1363.385] (-1366.331) (-1362.657) * [-1366.358] (-1363.720) (-1364.644) (-1362.146) -- 0:01:04 72500 -- (-1365.343) (-1362.484) (-1364.182) [-1362.965] * [-1367.207] (-1363.394) (-1362.566) (-1364.630) -- 0:01:03 73000 -- [-1368.738] (-1361.995) (-1366.790) (-1363.127) * (-1366.959) [-1366.269] (-1362.492) (-1367.944) -- 0:01:03 73500 -- (-1370.181) (-1364.180) (-1367.238) [-1363.734] * [-1364.959] (-1363.423) (-1364.588) (-1365.534) -- 0:01:03 74000 -- (-1367.401) (-1364.180) (-1370.418) [-1364.100] * (-1365.861) [-1364.629] (-1363.698) (-1362.966) -- 0:01:02 74500 -- (-1363.589) (-1364.240) (-1367.068) [-1365.170] * (-1364.655) (-1364.381) [-1368.866] (-1364.402) -- 0:01:02 75000 -- [-1363.590] (-1364.651) (-1365.103) (-1365.293) * (-1363.219) (-1365.948) [-1364.290] (-1365.774) -- 0:01:01 Average standard deviation of split frequencies: 0.021709 75500 -- (-1363.035) (-1363.060) [-1364.762] (-1363.948) * (-1362.722) (-1363.900) [-1363.145] (-1363.345) -- 0:01:01 76000 -- (-1362.811) [-1363.634] (-1364.249) (-1364.477) * (-1362.692) [-1364.791] (-1363.696) (-1366.127) -- 0:01:00 76500 -- (-1365.990) (-1363.835) [-1365.706] (-1364.229) * (-1363.142) [-1363.622] (-1366.429) (-1362.228) -- 0:01:00 77000 -- (-1364.688) (-1363.139) (-1363.838) [-1370.038] * (-1364.695) (-1363.620) (-1363.672) [-1362.413] -- 0:01:11 77500 -- (-1364.482) [-1364.942] (-1364.437) (-1366.490) * (-1366.096) (-1363.892) (-1363.882) [-1362.414] -- 0:01:11 78000 -- (-1364.249) (-1365.272) (-1367.450) [-1365.675] * (-1365.059) [-1363.918] (-1363.998) (-1363.407) -- 0:01:10 78500 -- (-1363.461) (-1362.670) (-1364.150) [-1363.580] * [-1369.212] (-1364.325) (-1366.056) (-1362.073) -- 0:01:10 79000 -- (-1364.580) [-1362.650] (-1367.687) (-1363.514) * (-1363.369) (-1363.183) [-1364.661] (-1362.036) -- 0:01:09 79500 -- (-1363.263) (-1362.967) (-1366.132) [-1363.541] * (-1364.372) (-1366.376) [-1365.793] (-1362.036) -- 0:01:09 80000 -- [-1363.666] (-1363.318) (-1364.784) (-1362.972) * (-1365.042) (-1366.657) [-1363.707] (-1362.422) -- 0:01:09 Average standard deviation of split frequencies: 0.022760 80500 -- (-1365.971) (-1362.707) (-1365.258) [-1363.088] * (-1363.768) (-1364.997) [-1366.237] (-1366.682) -- 0:01:08 81000 -- [-1363.494] (-1363.080) (-1363.182) (-1362.546) * (-1363.231) (-1365.620) (-1364.263) [-1365.873] -- 0:01:08 81500 -- [-1364.978] (-1364.288) (-1363.034) (-1366.657) * [-1363.292] (-1365.746) (-1364.380) (-1365.030) -- 0:01:07 82000 -- (-1363.749) (-1367.431) (-1368.103) [-1363.861] * (-1364.591) (-1365.198) [-1364.247] (-1363.938) -- 0:01:07 82500 -- (-1364.151) (-1365.204) [-1365.944] (-1365.676) * (-1364.060) [-1365.091] (-1363.866) (-1364.358) -- 0:01:06 83000 -- (-1365.380) (-1364.618) [-1364.460] (-1368.748) * (-1364.964) [-1364.341] (-1368.387) (-1365.024) -- 0:01:06 83500 -- (-1366.292) [-1364.835] (-1367.631) (-1365.250) * (-1364.141) (-1367.666) [-1364.211] (-1364.390) -- 0:01:05 84000 -- (-1363.108) (-1364.699) [-1364.416] (-1365.316) * (-1366.217) [-1362.599] (-1366.521) (-1364.511) -- 0:01:05 84500 -- (-1364.767) (-1367.416) [-1364.300] (-1364.514) * [-1368.232] (-1363.185) (-1363.745) (-1366.143) -- 0:01:05 85000 -- (-1363.164) (-1365.222) [-1363.451] (-1366.432) * (-1365.095) (-1362.745) [-1367.076] (-1364.499) -- 0:01:04 Average standard deviation of split frequencies: 0.022214 85500 -- (-1362.965) [-1364.231] (-1364.625) (-1368.198) * (-1363.738) (-1364.061) (-1365.719) [-1365.177] -- 0:01:04 86000 -- (-1363.849) [-1363.121] (-1363.952) (-1364.630) * [-1364.101] (-1363.027) (-1365.650) (-1362.916) -- 0:01:03 86500 -- (-1366.137) [-1364.054] (-1363.013) (-1369.699) * [-1364.144] (-1369.988) (-1366.864) (-1363.994) -- 0:01:03 87000 -- (-1368.841) (-1366.875) [-1368.641] (-1368.562) * (-1368.942) (-1362.360) (-1364.813) [-1363.181] -- 0:01:02 87500 -- [-1363.384] (-1366.158) (-1366.927) (-1363.589) * [-1368.151] (-1362.439) (-1365.944) (-1362.448) -- 0:01:02 88000 -- (-1364.838) (-1365.012) [-1367.272] (-1368.692) * (-1365.260) (-1363.558) [-1364.912] (-1369.216) -- 0:01:02 88500 -- (-1364.511) (-1364.697) [-1365.717] (-1368.042) * (-1367.400) (-1364.515) (-1362.847) [-1366.137] -- 0:01:01 89000 -- (-1367.334) [-1367.258] (-1368.314) (-1362.768) * (-1363.669) (-1362.923) (-1362.999) [-1364.067] -- 0:01:01 89500 -- (-1368.035) (-1365.687) (-1367.147) [-1362.934] * (-1363.656) (-1365.805) [-1362.552] (-1365.186) -- 0:01:01 90000 -- (-1363.575) [-1366.612] (-1365.253) (-1365.171) * (-1364.590) (-1367.903) (-1362.731) [-1362.405] -- 0:01:00 Average standard deviation of split frequencies: 0.025130 90500 -- (-1364.042) [-1364.121] (-1363.702) (-1363.391) * (-1362.416) (-1365.065) [-1363.410] (-1364.433) -- 0:01:10 91000 -- [-1365.063] (-1363.007) (-1363.867) (-1369.618) * (-1362.670) (-1364.608) (-1362.557) [-1364.024] -- 0:01:09 91500 -- [-1364.869] (-1364.503) (-1365.026) (-1364.093) * (-1365.055) (-1365.243) [-1362.288] (-1365.175) -- 0:01:09 92000 -- (-1365.311) [-1364.538] (-1366.956) (-1371.571) * (-1365.103) (-1367.521) (-1366.476) [-1362.699] -- 0:01:09 92500 -- (-1364.120) (-1363.504) (-1368.502) [-1362.799] * (-1364.686) [-1365.707] (-1362.293) (-1364.308) -- 0:01:08 93000 -- (-1362.574) (-1363.325) [-1364.190] (-1363.541) * (-1362.916) (-1365.793) [-1365.001] (-1364.037) -- 0:01:08 93500 -- (-1363.509) (-1363.801) (-1363.310) [-1362.811] * [-1363.479] (-1365.539) (-1365.340) (-1365.718) -- 0:01:07 94000 -- (-1364.918) [-1363.517] (-1363.928) (-1362.527) * [-1363.474] (-1366.249) (-1366.829) (-1363.684) -- 0:01:07 94500 -- (-1367.887) (-1363.883) [-1362.521] (-1362.530) * (-1364.133) (-1365.490) [-1364.977] (-1364.142) -- 0:01:07 95000 -- (-1365.317) (-1363.419) (-1362.634) [-1366.609] * (-1363.827) [-1364.576] (-1367.695) (-1364.736) -- 0:01:06 Average standard deviation of split frequencies: 0.028917 95500 -- (-1363.261) (-1364.139) [-1362.796] (-1364.053) * [-1365.116] (-1364.594) (-1369.201) (-1362.357) -- 0:01:06 96000 -- (-1364.851) (-1362.033) [-1362.178] (-1362.571) * (-1365.680) (-1368.249) [-1367.915] (-1364.707) -- 0:01:05 96500 -- (-1365.617) [-1362.179] (-1362.202) (-1363.176) * [-1362.952] (-1365.344) (-1366.375) (-1364.141) -- 0:01:05 97000 -- (-1365.928) (-1366.101) (-1364.897) [-1364.454] * (-1366.402) [-1363.057] (-1364.235) (-1366.952) -- 0:01:05 97500 -- [-1362.005] (-1364.342) (-1363.240) (-1369.549) * (-1363.746) [-1365.508] (-1365.233) (-1362.967) -- 0:01:04 98000 -- [-1362.820] (-1364.613) (-1362.786) (-1363.857) * [-1363.819] (-1363.542) (-1366.531) (-1363.185) -- 0:01:04 98500 -- (-1362.688) (-1362.268) (-1363.087) [-1365.192] * (-1366.877) (-1369.409) (-1364.540) [-1362.761] -- 0:01:04 99000 -- [-1363.003] (-1367.518) (-1366.369) (-1365.487) * (-1368.883) [-1364.489] (-1366.664) (-1363.696) -- 0:01:03 99500 -- (-1362.818) [-1366.293] (-1365.033) (-1364.850) * (-1367.611) [-1363.729] (-1365.684) (-1365.036) -- 0:01:03 100000 -- (-1363.469) (-1365.381) [-1363.495] (-1363.783) * [-1365.782] (-1363.434) (-1365.374) (-1365.498) -- 0:01:02 Average standard deviation of split frequencies: 0.024975 100500 -- (-1363.772) (-1363.274) [-1363.521] (-1364.200) * (-1364.862) [-1363.916] (-1365.229) (-1366.231) -- 0:01:02 101000 -- (-1362.615) (-1364.055) [-1364.403] (-1365.123) * (-1365.692) (-1367.414) (-1363.394) [-1366.371] -- 0:01:02 101500 -- (-1363.989) (-1363.106) [-1365.770] (-1365.854) * (-1365.586) (-1370.173) (-1363.381) [-1363.104] -- 0:01:01 102000 -- (-1364.853) (-1364.550) [-1365.258] (-1364.855) * [-1363.796] (-1364.058) (-1364.444) (-1363.028) -- 0:01:01 102500 -- (-1362.772) [-1363.105] (-1365.055) (-1362.368) * (-1363.341) [-1366.160] (-1364.352) (-1364.906) -- 0:01:01 103000 -- (-1362.687) (-1362.491) [-1365.686] (-1362.843) * [-1364.204] (-1363.487) (-1364.352) (-1364.075) -- 0:01:00 103500 -- (-1362.752) (-1362.915) [-1363.604] (-1365.013) * (-1365.569) (-1361.927) [-1363.018] (-1366.700) -- 0:01:00 104000 -- (-1362.556) [-1363.005] (-1363.451) (-1366.400) * (-1366.237) (-1362.604) [-1364.560] (-1365.988) -- 0:01:08 104500 -- (-1363.223) [-1362.677] (-1363.529) (-1363.811) * (-1365.946) (-1362.176) (-1364.265) [-1361.933] -- 0:01:08 105000 -- (-1369.070) (-1362.825) [-1362.893] (-1365.649) * (-1365.200) (-1361.992) (-1363.194) [-1362.119] -- 0:01:08 Average standard deviation of split frequencies: 0.025624 105500 -- (-1368.993) [-1363.260] (-1363.697) (-1363.431) * (-1369.796) (-1363.678) (-1362.439) [-1362.119] -- 0:01:07 106000 -- (-1367.690) [-1363.169] (-1364.747) (-1368.959) * (-1369.798) [-1361.991] (-1363.523) (-1362.118) -- 0:01:07 106500 -- (-1368.138) (-1363.067) (-1364.833) [-1364.678] * (-1370.566) [-1364.967] (-1363.738) (-1362.997) -- 0:01:07 107000 -- (-1364.579) (-1362.756) [-1363.461] (-1363.020) * (-1371.907) [-1363.690] (-1362.055) (-1363.593) -- 0:01:06 107500 -- [-1370.672] (-1363.338) (-1363.235) (-1363.212) * (-1367.137) (-1363.589) [-1364.616] (-1363.839) -- 0:01:06 108000 -- [-1363.551] (-1363.504) (-1363.168) (-1366.449) * (-1363.769) [-1364.434] (-1364.107) (-1365.119) -- 0:01:06 108500 -- (-1363.410) (-1363.592) [-1363.146] (-1363.521) * (-1364.075) (-1366.304) (-1363.037) [-1362.793] -- 0:01:05 109000 -- [-1363.511] (-1362.970) (-1362.239) (-1364.150) * (-1362.815) (-1365.292) [-1362.816] (-1362.778) -- 0:01:05 109500 -- (-1363.391) [-1363.188] (-1364.573) (-1365.810) * (-1363.869) (-1365.078) [-1362.415] (-1362.731) -- 0:01:05 110000 -- (-1367.672) (-1363.805) [-1362.973] (-1364.888) * (-1362.150) (-1363.281) (-1362.486) [-1362.360] -- 0:01:04 Average standard deviation of split frequencies: 0.027215 110500 -- [-1364.315] (-1363.843) (-1365.809) (-1365.459) * (-1364.652) (-1365.011) [-1363.651] (-1362.108) -- 0:01:04 111000 -- (-1370.655) (-1364.220) [-1364.791] (-1365.264) * [-1362.539] (-1362.908) (-1365.793) (-1363.086) -- 0:01:04 111500 -- [-1364.293] (-1365.778) (-1367.997) (-1364.978) * [-1362.579] (-1365.209) (-1365.190) (-1365.285) -- 0:01:03 112000 -- (-1363.753) [-1365.969] (-1362.818) (-1367.043) * [-1363.837] (-1366.613) (-1362.343) (-1363.438) -- 0:01:03 112500 -- [-1363.729] (-1365.466) (-1363.036) (-1365.818) * (-1364.368) (-1367.644) (-1362.193) [-1363.556] -- 0:01:03 113000 -- (-1364.534) [-1366.854] (-1364.362) (-1368.057) * (-1363.828) (-1364.612) [-1362.442] (-1363.832) -- 0:01:02 113500 -- [-1362.729] (-1368.365) (-1363.775) (-1364.261) * (-1362.800) [-1368.330] (-1364.880) (-1362.092) -- 0:01:02 114000 -- (-1367.567) (-1366.733) (-1363.023) [-1365.498] * (-1363.270) (-1366.595) [-1364.880] (-1362.581) -- 0:01:02 114500 -- [-1367.631] (-1363.929) (-1363.142) (-1363.744) * (-1364.656) (-1364.795) [-1365.710] (-1362.079) -- 0:01:01 115000 -- (-1365.963) (-1363.739) [-1362.944] (-1372.330) * (-1363.804) (-1365.186) (-1364.794) [-1363.813] -- 0:01:01 Average standard deviation of split frequencies: 0.024383 115500 -- (-1364.094) (-1363.670) [-1363.492] (-1366.649) * (-1365.677) [-1364.015] (-1368.677) (-1367.560) -- 0:01:01 116000 -- (-1363.168) (-1361.906) (-1362.665) [-1365.417] * (-1364.024) (-1364.946) (-1367.825) [-1368.177] -- 0:01:00 116500 -- (-1362.850) (-1363.259) [-1363.006] (-1363.309) * (-1364.242) (-1362.109) [-1364.420] (-1363.014) -- 0:01:00 117000 -- (-1364.233) (-1364.283) [-1363.985] (-1363.090) * (-1363.335) (-1362.251) [-1365.919] (-1363.042) -- 0:01:00 117500 -- [-1363.417] (-1362.107) (-1365.657) (-1362.707) * [-1363.140] (-1365.026) (-1364.578) (-1366.047) -- 0:01:07 118000 -- (-1362.481) (-1362.425) (-1363.865) [-1364.998] * (-1362.437) (-1363.472) [-1365.815] (-1364.678) -- 0:01:07 118500 -- (-1366.056) (-1365.152) (-1364.226) [-1363.136] * (-1363.927) [-1362.583] (-1363.338) (-1363.878) -- 0:01:06 119000 -- (-1363.556) [-1364.061] (-1363.868) (-1363.714) * [-1366.054] (-1363.787) (-1362.275) (-1363.405) -- 0:01:06 119500 -- (-1365.628) [-1362.780] (-1363.325) (-1367.259) * (-1364.529) [-1368.180] (-1362.539) (-1364.829) -- 0:01:06 120000 -- (-1364.603) [-1362.981] (-1364.562) (-1365.047) * (-1370.620) (-1363.851) [-1364.920] (-1363.197) -- 0:01:06 Average standard deviation of split frequencies: 0.024525 120500 -- (-1365.709) (-1364.685) (-1365.932) [-1364.774] * (-1369.264) (-1364.174) (-1361.935) [-1364.508] -- 0:01:05 121000 -- (-1367.806) (-1363.182) [-1368.427] (-1364.482) * (-1366.458) [-1364.282] (-1364.009) (-1364.921) -- 0:01:05 121500 -- (-1366.167) (-1367.595) (-1364.237) [-1363.532] * (-1367.246) [-1363.101] (-1362.064) (-1362.462) -- 0:01:05 122000 -- (-1366.560) (-1366.428) (-1364.149) [-1362.010] * (-1364.006) (-1370.645) (-1361.918) [-1362.479] -- 0:01:04 122500 -- (-1369.358) (-1366.589) [-1368.369] (-1362.088) * (-1366.748) (-1366.278) [-1362.526] (-1362.346) -- 0:01:04 123000 -- [-1364.664] (-1366.309) (-1365.624) (-1366.603) * (-1366.092) (-1365.396) [-1363.949] (-1362.285) -- 0:01:04 123500 -- (-1366.038) (-1366.588) (-1365.458) [-1363.464] * (-1365.157) [-1363.149] (-1364.021) (-1364.927) -- 0:01:03 124000 -- (-1363.672) (-1363.465) (-1366.607) [-1362.739] * [-1365.609] (-1364.731) (-1362.732) (-1364.046) -- 0:01:03 124500 -- [-1363.474] (-1364.616) (-1365.455) (-1362.999) * (-1364.879) (-1365.419) [-1362.926] (-1362.536) -- 0:01:03 125000 -- (-1364.796) [-1366.622] (-1365.573) (-1365.067) * (-1368.191) (-1368.295) (-1362.368) [-1362.800] -- 0:01:03 Average standard deviation of split frequencies: 0.022804 125500 -- (-1365.238) (-1364.170) [-1364.549] (-1366.772) * (-1363.021) (-1366.604) (-1362.495) [-1367.743] -- 0:01:02 126000 -- (-1363.366) [-1362.408] (-1365.385) (-1370.993) * [-1365.129] (-1364.469) (-1363.274) (-1363.924) -- 0:01:02 126500 -- (-1364.399) (-1363.271) (-1363.212) [-1366.086] * [-1364.780] (-1366.418) (-1363.389) (-1364.859) -- 0:01:02 127000 -- (-1365.155) [-1363.226] (-1363.497) (-1363.828) * (-1364.153) [-1365.760] (-1362.725) (-1364.163) -- 0:01:01 127500 -- (-1365.293) (-1362.358) (-1364.544) [-1363.460] * [-1363.344] (-1363.013) (-1362.559) (-1363.019) -- 0:01:01 128000 -- (-1368.021) [-1365.665] (-1363.522) (-1362.206) * [-1362.338] (-1364.096) (-1366.507) (-1362.704) -- 0:01:01 128500 -- [-1363.434] (-1367.684) (-1364.744) (-1362.999) * [-1362.266] (-1362.929) (-1368.377) (-1362.551) -- 0:01:01 129000 -- (-1364.851) (-1365.009) [-1365.312] (-1364.475) * (-1368.609) (-1365.679) (-1365.026) [-1363.435] -- 0:01:00 129500 -- (-1366.556) (-1364.042) (-1366.511) [-1363.367] * [-1364.801] (-1367.527) (-1366.287) (-1366.409) -- 0:01:00 130000 -- (-1363.490) [-1364.731] (-1368.579) (-1368.804) * (-1365.336) (-1363.003) (-1364.777) [-1366.270] -- 0:01:00 Average standard deviation of split frequencies: 0.022026 130500 -- (-1365.702) [-1363.003] (-1368.489) (-1371.194) * (-1366.647) (-1363.242) [-1364.221] (-1363.243) -- 0:01:06 131000 -- [-1363.419] (-1365.993) (-1363.913) (-1363.906) * (-1366.275) (-1367.203) [-1368.256] (-1363.082) -- 0:01:06 131500 -- (-1366.828) (-1362.814) [-1362.868] (-1363.158) * (-1366.353) (-1363.135) [-1363.736] (-1365.784) -- 0:01:06 132000 -- (-1365.456) (-1364.375) [-1363.232] (-1365.677) * (-1369.100) (-1369.088) (-1365.214) [-1365.208] -- 0:01:05 132500 -- (-1364.988) (-1365.015) (-1363.536) [-1364.466] * (-1365.623) (-1366.817) [-1364.964] (-1363.337) -- 0:01:05 133000 -- (-1363.863) (-1365.127) (-1371.915) [-1364.445] * (-1366.240) (-1367.738) [-1364.492] (-1363.797) -- 0:01:05 133500 -- [-1363.240] (-1363.974) (-1368.335) (-1363.665) * (-1366.173) (-1366.717) (-1364.496) [-1362.713] -- 0:01:04 134000 -- (-1362.576) [-1363.584] (-1363.447) (-1366.219) * (-1362.280) (-1365.739) [-1366.377] (-1362.684) -- 0:01:04 134500 -- (-1364.265) [-1365.411] (-1364.319) (-1366.735) * (-1363.158) (-1364.519) [-1365.741] (-1363.318) -- 0:01:04 135000 -- (-1364.693) (-1363.556) (-1364.213) [-1363.686] * (-1369.701) [-1364.747] (-1364.672) (-1364.201) -- 0:01:04 Average standard deviation of split frequencies: 0.021375 135500 -- (-1367.137) (-1364.772) (-1364.455) [-1363.303] * [-1364.492] (-1367.076) (-1365.262) (-1366.543) -- 0:01:03 136000 -- (-1370.565) (-1364.891) (-1362.808) [-1364.573] * (-1362.442) [-1365.770] (-1364.301) (-1366.440) -- 0:01:03 136500 -- (-1364.091) (-1364.875) (-1362.499) [-1363.294] * (-1361.952) (-1363.618) [-1365.344] (-1369.005) -- 0:01:03 137000 -- (-1363.887) [-1364.315] (-1363.890) (-1363.400) * (-1362.309) (-1363.553) [-1365.601] (-1364.277) -- 0:01:02 137500 -- [-1362.212] (-1366.252) (-1362.396) (-1370.677) * (-1362.002) (-1366.297) [-1362.667] (-1364.177) -- 0:01:02 138000 -- (-1367.472) [-1366.856] (-1363.876) (-1364.069) * [-1364.367] (-1365.549) (-1363.030) (-1366.124) -- 0:01:02 138500 -- (-1364.822) [-1364.788] (-1362.631) (-1363.066) * [-1365.106] (-1364.842) (-1365.529) (-1366.089) -- 0:01:02 139000 -- [-1368.268] (-1365.385) (-1366.343) (-1363.369) * (-1361.940) (-1363.520) (-1367.159) [-1365.647] -- 0:01:01 139500 -- [-1367.692] (-1365.201) (-1364.280) (-1365.472) * (-1364.112) (-1364.353) [-1364.686] (-1366.664) -- 0:01:01 140000 -- (-1363.184) [-1364.536] (-1363.672) (-1365.128) * (-1366.129) (-1362.908) [-1363.723] (-1365.108) -- 0:01:01 Average standard deviation of split frequencies: 0.022155 140500 -- (-1362.790) [-1362.596] (-1362.861) (-1363.082) * (-1365.798) (-1363.124) (-1364.555) [-1363.652] -- 0:01:01 141000 -- (-1364.212) (-1362.797) [-1363.956] (-1363.085) * (-1363.414) (-1363.861) [-1363.188] (-1363.734) -- 0:01:00 141500 -- (-1363.813) (-1362.699) (-1364.206) [-1363.027] * (-1363.206) (-1364.592) (-1364.775) [-1362.707] -- 0:01:00 142000 -- (-1363.458) (-1362.976) (-1362.744) [-1362.951] * (-1363.602) (-1363.766) [-1369.988] (-1363.978) -- 0:01:00 142500 -- (-1365.580) (-1362.505) [-1362.382] (-1363.907) * (-1364.941) (-1363.429) [-1364.979] (-1366.522) -- 0:01:00 143000 -- (-1365.231) (-1362.848) [-1362.260] (-1365.291) * (-1365.819) (-1363.659) (-1363.799) [-1367.047] -- 0:00:59 143500 -- (-1362.486) (-1362.980) [-1366.031] (-1362.940) * (-1365.320) (-1365.526) [-1363.762] (-1366.393) -- 0:00:59 144000 -- (-1363.528) [-1362.059] (-1364.224) (-1362.939) * (-1367.362) (-1362.821) [-1365.373] (-1366.544) -- 0:01:05 144500 -- [-1363.083] (-1364.013) (-1363.734) (-1363.450) * (-1365.602) [-1365.279] (-1362.288) (-1363.185) -- 0:01:05 145000 -- (-1366.499) [-1365.221] (-1362.924) (-1362.894) * [-1366.179] (-1362.139) (-1364.350) (-1364.605) -- 0:01:04 Average standard deviation of split frequencies: 0.023621 145500 -- [-1363.548] (-1365.925) (-1364.011) (-1364.902) * (-1365.972) [-1365.283] (-1363.652) (-1363.634) -- 0:01:04 146000 -- (-1365.837) [-1367.934] (-1363.297) (-1362.804) * (-1365.233) (-1364.655) [-1366.672] (-1363.418) -- 0:01:04 146500 -- [-1365.033] (-1364.424) (-1363.397) (-1365.082) * [-1368.281] (-1364.908) (-1363.745) (-1363.056) -- 0:01:04 147000 -- (-1364.937) (-1364.091) [-1364.825] (-1365.310) * (-1364.233) [-1366.022] (-1363.136) (-1362.989) -- 0:01:03 147500 -- (-1364.939) (-1364.445) [-1365.400] (-1369.781) * [-1364.407] (-1365.813) (-1363.562) (-1362.756) -- 0:01:03 148000 -- (-1366.577) (-1364.535) (-1364.230) [-1364.473] * (-1364.236) (-1363.427) [-1362.261] (-1365.038) -- 0:01:03 148500 -- [-1365.271] (-1366.892) (-1363.815) (-1364.096) * (-1363.624) (-1364.381) (-1366.710) [-1362.683] -- 0:01:03 149000 -- (-1366.035) (-1364.653) [-1362.576] (-1368.027) * [-1363.436] (-1366.304) (-1363.056) (-1363.418) -- 0:01:02 149500 -- (-1366.020) (-1365.300) [-1361.861] (-1364.296) * (-1362.935) (-1365.701) [-1363.513] (-1363.725) -- 0:01:02 150000 -- (-1366.741) (-1364.696) (-1362.074) [-1364.945] * (-1368.950) (-1365.515) (-1363.701) [-1363.718] -- 0:01:02 Average standard deviation of split frequencies: 0.024042 150500 -- (-1364.811) [-1363.179] (-1365.047) (-1363.123) * (-1368.750) (-1365.325) [-1362.230] (-1368.053) -- 0:01:02 151000 -- [-1363.497] (-1365.889) (-1367.378) (-1362.464) * (-1364.865) [-1363.061] (-1364.356) (-1364.522) -- 0:01:01 151500 -- (-1364.496) [-1365.791] (-1365.168) (-1363.511) * (-1363.940) (-1363.360) [-1363.836] (-1364.349) -- 0:01:01 152000 -- (-1364.045) (-1363.276) [-1367.716] (-1372.322) * (-1366.716) (-1362.769) (-1364.091) [-1363.741] -- 0:01:01 152500 -- [-1363.399] (-1363.436) (-1364.515) (-1365.101) * (-1369.880) [-1362.951] (-1364.129) (-1363.479) -- 0:01:01 153000 -- (-1363.530) [-1366.546] (-1363.901) (-1365.367) * [-1363.888] (-1366.022) (-1363.302) (-1363.298) -- 0:01:00 153500 -- (-1363.371) (-1363.250) (-1363.145) [-1365.174] * [-1366.997] (-1362.314) (-1363.323) (-1363.685) -- 0:01:00 154000 -- (-1363.371) (-1368.087) (-1364.785) [-1365.640] * (-1363.907) [-1362.549] (-1363.714) (-1363.253) -- 0:01:00 154500 -- (-1364.670) (-1363.570) [-1363.484] (-1362.828) * [-1365.538] (-1363.308) (-1364.407) (-1364.839) -- 0:01:00 155000 -- (-1362.996) (-1363.405) (-1363.680) [-1366.445] * [-1364.753] (-1364.545) (-1361.810) (-1365.063) -- 0:00:59 Average standard deviation of split frequencies: 0.025952 155500 -- (-1363.997) (-1363.136) [-1364.783] (-1364.935) * (-1364.789) (-1364.852) (-1362.251) [-1366.328] -- 0:00:59 156000 -- (-1364.147) (-1366.573) (-1365.161) [-1365.191] * (-1364.831) [-1364.831] (-1362.230) (-1364.767) -- 0:00:59 156500 -- [-1365.520] (-1363.519) (-1364.732) (-1362.712) * [-1366.119] (-1366.326) (-1363.748) (-1365.152) -- 0:00:59 157000 -- (-1365.506) (-1362.929) [-1368.460] (-1363.558) * [-1364.624] (-1362.026) (-1362.471) (-1364.367) -- 0:00:59 157500 -- [-1363.942] (-1363.409) (-1367.171) (-1362.774) * (-1362.869) (-1362.253) [-1365.419] (-1362.734) -- 0:01:04 158000 -- [-1363.291] (-1364.541) (-1372.769) (-1363.098) * (-1363.320) (-1362.395) (-1362.368) [-1365.249] -- 0:01:03 158500 -- (-1362.955) [-1364.264] (-1371.539) (-1365.236) * (-1363.888) (-1362.529) (-1362.772) [-1365.313] -- 0:01:03 159000 -- [-1362.501] (-1365.595) (-1367.019) (-1363.300) * (-1364.193) (-1363.657) (-1361.875) [-1366.242] -- 0:01:03 159500 -- [-1364.596] (-1365.807) (-1371.935) (-1365.495) * (-1362.981) [-1363.765] (-1361.875) (-1364.918) -- 0:01:03 160000 -- (-1364.410) (-1363.151) [-1367.406] (-1365.345) * (-1364.234) (-1366.433) [-1363.447] (-1364.902) -- 0:01:02 Average standard deviation of split frequencies: 0.025917 160500 -- [-1364.445] (-1363.813) (-1367.956) (-1364.305) * (-1363.637) [-1366.415] (-1364.790) (-1365.656) -- 0:01:02 161000 -- [-1366.408] (-1368.358) (-1370.327) (-1364.259) * (-1364.339) (-1365.339) [-1363.005] (-1366.937) -- 0:01:02 161500 -- (-1370.732) (-1366.763) [-1363.274] (-1364.761) * (-1364.720) [-1363.581] (-1363.754) (-1368.680) -- 0:01:02 162000 -- (-1366.648) [-1364.860] (-1366.378) (-1367.868) * (-1364.290) (-1363.836) [-1366.699] (-1363.199) -- 0:01:02 162500 -- (-1365.280) (-1364.662) [-1365.160] (-1362.694) * (-1363.769) (-1363.337) (-1363.027) [-1365.651] -- 0:01:01 163000 -- (-1366.041) (-1364.031) (-1363.770) [-1362.348] * [-1363.937] (-1365.367) (-1365.038) (-1364.755) -- 0:01:01 163500 -- (-1364.467) (-1363.904) (-1363.478) [-1363.358] * (-1363.535) (-1362.735) (-1365.530) [-1365.688] -- 0:01:01 164000 -- (-1362.749) (-1366.140) [-1364.169] (-1363.792) * (-1363.713) (-1363.842) [-1363.163] (-1363.756) -- 0:01:01 164500 -- (-1363.838) (-1364.377) [-1363.514] (-1365.157) * (-1367.662) (-1365.017) [-1363.465] (-1364.543) -- 0:01:00 165000 -- (-1363.399) [-1363.828] (-1362.364) (-1365.590) * (-1364.697) (-1362.732) (-1363.909) [-1363.026] -- 0:01:00 Average standard deviation of split frequencies: 0.024422 165500 -- (-1364.508) (-1368.570) (-1364.859) [-1363.313] * [-1364.442] (-1366.602) (-1363.119) (-1363.661) -- 0:01:00 166000 -- (-1366.250) [-1364.379] (-1370.100) (-1363.089) * (-1364.358) (-1364.329) (-1362.447) [-1363.525] -- 0:01:00 166500 -- (-1367.751) [-1363.340] (-1372.431) (-1363.951) * [-1364.659] (-1363.964) (-1363.437) (-1363.892) -- 0:01:00 167000 -- (-1365.055) (-1366.100) [-1367.432] (-1365.412) * (-1362.983) (-1364.745) [-1364.011] (-1362.831) -- 0:00:59 167500 -- (-1363.954) (-1365.264) [-1364.335] (-1364.382) * (-1363.530) (-1364.826) (-1364.020) [-1366.745] -- 0:00:59 168000 -- (-1365.666) (-1365.018) (-1363.688) [-1367.078] * [-1362.463] (-1362.786) (-1366.988) (-1368.413) -- 0:00:59 168500 -- (-1366.517) (-1364.789) [-1363.589] (-1364.874) * (-1364.020) (-1363.152) (-1374.295) [-1362.602] -- 0:00:59 169000 -- (-1365.740) (-1364.456) [-1364.635] (-1364.644) * [-1363.393] (-1363.110) (-1366.440) (-1364.717) -- 0:00:59 169500 -- (-1365.789) (-1363.680) (-1370.744) [-1363.842] * (-1363.008) (-1365.126) (-1367.632) [-1362.787] -- 0:00:58 170000 -- [-1365.136] (-1363.590) (-1363.202) (-1367.840) * (-1370.781) [-1366.463] (-1364.863) (-1363.366) -- 0:00:58 Average standard deviation of split frequencies: 0.023412 170500 -- [-1367.544] (-1364.480) (-1367.947) (-1364.178) * (-1368.707) (-1367.830) [-1364.697] (-1362.627) -- 0:01:03 171000 -- [-1362.621] (-1363.544) (-1365.319) (-1364.315) * (-1362.873) [-1366.401] (-1365.845) (-1366.625) -- 0:01:03 171500 -- (-1363.322) [-1367.079] (-1366.861) (-1371.961) * (-1367.328) (-1366.442) [-1363.476] (-1364.689) -- 0:01:02 172000 -- [-1363.134] (-1369.374) (-1366.106) (-1363.706) * [-1364.495] (-1364.110) (-1362.786) (-1362.688) -- 0:01:02 172500 -- [-1364.462] (-1368.693) (-1367.400) (-1363.539) * (-1364.190) [-1364.392] (-1363.569) (-1366.650) -- 0:01:02 173000 -- (-1363.170) (-1363.542) (-1363.921) [-1363.810] * [-1363.604] (-1365.865) (-1364.426) (-1369.142) -- 0:01:02 173500 -- (-1368.189) [-1364.745] (-1364.540) (-1363.445) * (-1362.462) [-1364.314] (-1364.152) (-1367.665) -- 0:01:01 174000 -- [-1363.598] (-1364.263) (-1364.593) (-1363.389) * (-1363.139) [-1364.706] (-1369.621) (-1366.479) -- 0:01:01 174500 -- [-1364.811] (-1366.685) (-1364.795) (-1364.962) * (-1366.458) [-1363.562] (-1364.138) (-1363.870) -- 0:01:01 175000 -- (-1365.260) (-1368.311) [-1363.340] (-1363.960) * (-1366.617) (-1363.268) (-1364.668) [-1364.924] -- 0:01:01 Average standard deviation of split frequencies: 0.022231 175500 -- (-1365.259) (-1369.730) [-1364.524] (-1363.465) * (-1365.851) (-1362.177) [-1365.076] (-1365.598) -- 0:01:01 176000 -- (-1363.039) (-1365.365) (-1363.246) [-1362.738] * (-1366.992) (-1362.517) [-1363.149] (-1366.159) -- 0:01:00 176500 -- (-1363.182) (-1366.124) (-1363.612) [-1363.890] * (-1367.493) [-1362.671] (-1365.509) (-1367.754) -- 0:01:00 177000 -- (-1367.378) (-1364.437) [-1363.236] (-1362.541) * (-1368.884) (-1363.546) [-1364.841] (-1363.224) -- 0:01:00 177500 -- (-1363.427) [-1363.066] (-1363.231) (-1363.221) * (-1363.642) (-1365.476) (-1362.982) [-1363.803] -- 0:01:00 178000 -- (-1364.065) (-1362.642) (-1366.913) [-1362.717] * (-1366.653) (-1366.221) [-1362.770] (-1363.355) -- 0:01:00 178500 -- (-1363.499) (-1364.074) [-1366.873] (-1362.827) * [-1367.785] (-1366.886) (-1362.776) (-1368.142) -- 0:00:59 179000 -- [-1364.924] (-1363.395) (-1364.543) (-1362.764) * [-1367.125] (-1365.965) (-1363.036) (-1365.539) -- 0:00:59 179500 -- (-1365.209) (-1362.753) [-1365.309] (-1363.040) * (-1365.056) [-1363.592] (-1363.797) (-1365.232) -- 0:00:59 180000 -- (-1363.247) [-1362.733] (-1364.466) (-1363.544) * [-1368.859] (-1364.231) (-1365.110) (-1368.479) -- 0:00:59 Average standard deviation of split frequencies: 0.022469 180500 -- (-1366.371) [-1362.511] (-1363.840) (-1364.646) * (-1368.095) (-1366.044) (-1365.448) [-1367.355] -- 0:00:59 181000 -- (-1365.928) (-1363.535) [-1362.712] (-1364.954) * (-1364.897) (-1368.329) (-1366.040) [-1374.281] -- 0:00:58 181500 -- (-1366.867) [-1362.365] (-1363.538) (-1362.710) * [-1364.362] (-1369.541) (-1366.647) (-1367.765) -- 0:00:58 182000 -- (-1364.280) (-1362.349) [-1363.279] (-1362.779) * (-1362.544) (-1362.851) [-1362.569] (-1366.284) -- 0:00:58 182500 -- (-1364.621) (-1367.756) (-1364.288) [-1362.807] * (-1366.441) (-1363.281) [-1365.368] (-1367.597) -- 0:00:58 183000 -- (-1364.329) [-1364.958] (-1363.986) (-1363.051) * [-1362.843] (-1363.751) (-1365.512) (-1364.036) -- 0:00:58 183500 -- (-1362.458) (-1366.840) [-1365.154] (-1366.424) * (-1365.560) (-1364.147) (-1369.924) [-1363.123] -- 0:00:57 184000 -- (-1362.797) [-1367.167] (-1367.737) (-1364.615) * (-1363.645) (-1363.207) (-1367.815) [-1363.415] -- 0:01:02 184500 -- (-1363.082) (-1363.332) [-1367.160] (-1366.541) * (-1367.269) [-1364.027] (-1364.906) (-1365.071) -- 0:01:01 185000 -- (-1362.244) [-1362.385] (-1367.282) (-1363.838) * (-1366.508) (-1363.002) (-1367.274) [-1365.800] -- 0:01:01 Average standard deviation of split frequencies: 0.021476 185500 -- (-1362.751) (-1367.915) (-1367.362) [-1363.496] * (-1367.837) [-1362.918] (-1365.174) (-1369.438) -- 0:01:01 186000 -- (-1364.120) [-1362.771] (-1366.462) (-1364.337) * (-1365.911) [-1363.318] (-1366.647) (-1365.073) -- 0:01:01 186500 -- (-1364.120) (-1362.471) (-1365.606) [-1365.327] * (-1365.433) [-1362.610] (-1369.101) (-1366.732) -- 0:01:01 187000 -- [-1364.542] (-1361.958) (-1365.063) (-1363.199) * (-1363.688) (-1362.730) (-1367.031) [-1362.686] -- 0:01:00 187500 -- (-1362.718) (-1362.593) [-1369.302] (-1366.582) * (-1363.840) [-1367.406] (-1364.891) (-1362.753) -- 0:01:00 188000 -- [-1362.672] (-1362.174) (-1362.469) (-1366.628) * (-1364.343) (-1363.166) (-1362.878) [-1361.793] -- 0:01:00 188500 -- (-1365.335) (-1365.990) (-1363.003) [-1364.770] * (-1367.127) (-1362.824) (-1363.035) [-1363.355] -- 0:01:00 189000 -- (-1364.492) (-1365.528) [-1362.863] (-1365.440) * [-1364.031] (-1362.868) (-1362.233) (-1362.230) -- 0:01:00 189500 -- (-1363.858) [-1362.424] (-1362.536) (-1369.578) * (-1366.464) [-1362.839] (-1362.859) (-1362.830) -- 0:00:59 190000 -- (-1363.629) [-1362.089] (-1362.796) (-1362.794) * (-1363.347) (-1363.486) (-1365.495) [-1363.096] -- 0:00:59 Average standard deviation of split frequencies: 0.020820 190500 -- (-1364.373) (-1362.006) (-1363.194) [-1362.635] * (-1368.655) [-1367.727] (-1365.654) (-1362.066) -- 0:00:59 191000 -- (-1368.287) (-1362.279) (-1363.671) [-1364.702] * (-1365.649) (-1367.577) [-1361.980] (-1363.704) -- 0:00:59 191500 -- (-1363.372) (-1362.279) [-1365.757] (-1364.861) * (-1367.418) [-1365.792] (-1363.322) (-1362.939) -- 0:00:59 192000 -- (-1363.003) (-1366.555) [-1363.319] (-1367.022) * (-1366.565) (-1365.235) [-1362.204] (-1363.673) -- 0:00:58 192500 -- [-1364.768] (-1363.943) (-1363.550) (-1367.425) * (-1367.734) (-1367.471) [-1362.053] (-1363.597) -- 0:00:58 193000 -- (-1364.392) (-1365.872) [-1364.435] (-1365.713) * [-1366.636] (-1363.136) (-1362.084) (-1366.321) -- 0:00:58 193500 -- [-1365.656] (-1364.300) (-1364.160) (-1365.396) * (-1363.328) (-1363.838) (-1365.352) [-1362.707] -- 0:00:58 194000 -- (-1363.577) (-1363.841) (-1363.690) [-1371.135] * (-1364.622) (-1364.415) (-1363.080) [-1364.702] -- 0:00:58 194500 -- [-1366.498] (-1363.205) (-1365.511) (-1366.039) * (-1364.780) [-1363.846] (-1362.516) (-1363.928) -- 0:00:57 195000 -- (-1365.137) (-1363.277) [-1363.390] (-1367.243) * [-1363.370] (-1371.164) (-1366.434) (-1362.037) -- 0:00:57 Average standard deviation of split frequencies: 0.020380 195500 -- (-1364.023) (-1369.003) [-1363.126] (-1365.596) * [-1363.146] (-1368.410) (-1365.857) (-1362.366) -- 0:00:57 196000 -- (-1364.578) (-1366.241) [-1364.920] (-1362.671) * [-1363.536] (-1367.626) (-1363.765) (-1363.010) -- 0:00:57 196500 -- (-1364.999) (-1361.861) (-1366.068) [-1364.658] * [-1363.659] (-1362.612) (-1367.134) (-1363.711) -- 0:00:57 197000 -- (-1364.395) (-1361.909) [-1366.365] (-1366.034) * [-1363.871] (-1363.762) (-1364.241) (-1363.110) -- 0:00:57 197500 -- (-1363.415) [-1363.495] (-1364.946) (-1366.380) * (-1363.581) (-1362.963) (-1365.349) [-1362.487] -- 0:01:00 198000 -- (-1363.932) (-1362.617) [-1364.160] (-1369.280) * (-1363.133) (-1363.907) (-1365.160) [-1364.046] -- 0:01:00 198500 -- (-1363.974) [-1364.770] (-1364.403) (-1367.411) * (-1362.915) (-1363.888) (-1365.387) [-1364.382] -- 0:01:00 199000 -- (-1364.525) (-1363.343) (-1364.337) [-1367.536] * (-1363.073) [-1363.467] (-1363.747) (-1366.123) -- 0:01:00 199500 -- (-1363.369) [-1363.812] (-1365.161) (-1367.796) * (-1363.913) (-1367.987) (-1363.966) [-1362.159] -- 0:01:00 200000 -- (-1363.254) (-1363.557) (-1365.156) [-1366.800] * (-1364.686) (-1362.587) (-1364.387) [-1365.098] -- 0:00:59 Average standard deviation of split frequencies: 0.020882 200500 -- (-1365.854) (-1364.103) [-1365.505] (-1365.669) * [-1363.585] (-1364.198) (-1367.517) (-1368.957) -- 0:00:59 201000 -- [-1364.497] (-1364.201) (-1366.156) (-1365.370) * (-1363.799) (-1365.964) [-1364.822] (-1364.506) -- 0:00:59 201500 -- (-1363.227) (-1362.935) (-1365.539) [-1365.149] * [-1364.801] (-1364.668) (-1365.827) (-1363.834) -- 0:00:59 202000 -- (-1366.439) (-1365.940) (-1366.161) [-1364.613] * [-1362.653] (-1362.519) (-1366.532) (-1363.594) -- 0:00:59 202500 -- [-1364.339] (-1363.266) (-1366.646) (-1369.039) * (-1362.529) (-1365.856) (-1365.774) [-1363.963] -- 0:00:59 203000 -- (-1364.151) [-1363.129] (-1368.658) (-1363.542) * (-1366.357) (-1365.095) [-1362.890] (-1366.125) -- 0:00:58 203500 -- (-1363.496) [-1372.134] (-1364.277) (-1363.016) * [-1364.718] (-1363.199) (-1362.203) (-1366.361) -- 0:00:58 204000 -- (-1364.489) (-1369.801) (-1364.685) [-1363.186] * (-1369.049) [-1365.642] (-1362.589) (-1364.244) -- 0:00:58 204500 -- (-1364.770) (-1362.938) (-1365.959) [-1366.984] * (-1367.387) (-1367.445) [-1363.625] (-1367.487) -- 0:00:58 205000 -- [-1364.174] (-1366.753) (-1370.788) (-1365.951) * (-1375.108) (-1363.564) (-1366.549) [-1366.490] -- 0:00:58 Average standard deviation of split frequencies: 0.019632 205500 -- (-1364.516) (-1362.198) (-1370.122) [-1364.822] * (-1370.506) [-1363.829] (-1364.405) (-1364.905) -- 0:00:57 206000 -- [-1364.764] (-1364.477) (-1372.172) (-1365.392) * (-1370.137) [-1363.542] (-1363.536) (-1364.510) -- 0:00:57 206500 -- [-1363.028] (-1365.782) (-1371.896) (-1364.425) * [-1362.614] (-1367.065) (-1363.671) (-1365.574) -- 0:00:57 207000 -- (-1366.209) (-1363.026) [-1363.431] (-1363.302) * [-1363.404] (-1368.944) (-1363.732) (-1363.420) -- 0:00:57 207500 -- (-1363.212) (-1364.159) (-1366.409) [-1363.178] * (-1364.827) [-1365.523] (-1363.555) (-1363.131) -- 0:00:57 208000 -- (-1362.218) (-1364.515) (-1362.514) [-1365.189] * [-1364.221] (-1366.799) (-1364.006) (-1364.175) -- 0:00:57 208500 -- (-1362.072) (-1363.738) [-1362.394] (-1363.245) * (-1366.145) (-1366.054) (-1366.143) [-1365.472] -- 0:00:56 209000 -- (-1361.901) (-1364.989) (-1362.585) [-1363.053] * (-1364.413) (-1365.284) (-1367.613) [-1366.831] -- 0:00:56 209500 -- (-1363.734) [-1364.414] (-1363.463) (-1367.088) * (-1366.038) (-1364.904) (-1366.282) [-1363.465] -- 0:00:56 210000 -- (-1363.857) [-1364.401] (-1364.475) (-1364.431) * (-1365.740) (-1364.011) [-1366.291] (-1367.664) -- 0:00:56 Average standard deviation of split frequencies: 0.019803 210500 -- (-1364.588) (-1363.398) [-1363.212] (-1364.596) * [-1363.915] (-1362.184) (-1364.854) (-1365.579) -- 0:01:00 211000 -- [-1363.113] (-1362.938) (-1363.617) (-1363.112) * [-1362.845] (-1363.901) (-1365.742) (-1366.807) -- 0:00:59 211500 -- (-1363.548) (-1364.708) (-1362.663) [-1362.542] * [-1363.031] (-1364.176) (-1365.359) (-1366.264) -- 0:00:59 212000 -- (-1362.233) [-1364.305] (-1362.752) (-1364.732) * (-1364.440) (-1363.524) (-1363.907) [-1363.325] -- 0:00:59 212500 -- (-1364.044) (-1363.188) (-1365.255) [-1366.757] * (-1365.123) (-1365.041) (-1364.178) [-1362.811] -- 0:00:59 213000 -- (-1362.821) (-1363.145) [-1366.540] (-1369.122) * (-1365.117) (-1364.335) [-1362.995] (-1367.072) -- 0:00:59 213500 -- (-1365.354) (-1366.453) [-1364.177] (-1364.444) * (-1363.995) [-1364.514] (-1367.336) (-1363.470) -- 0:00:58 214000 -- (-1368.579) [-1363.431] (-1364.372) (-1364.384) * (-1362.831) (-1363.644) [-1364.621] (-1370.663) -- 0:00:58 214500 -- (-1365.318) (-1362.466) (-1364.381) [-1363.096] * [-1364.353] (-1363.763) (-1363.864) (-1366.464) -- 0:00:58 215000 -- [-1363.776] (-1362.225) (-1364.011) (-1363.049) * [-1369.083] (-1365.024) (-1365.521) (-1367.537) -- 0:00:58 Average standard deviation of split frequencies: 0.020561 215500 -- (-1363.585) (-1370.514) (-1363.215) [-1364.387] * (-1364.451) (-1367.806) (-1366.836) [-1367.288] -- 0:00:58 216000 -- (-1369.322) (-1365.059) (-1363.753) [-1366.376] * [-1365.185] (-1367.691) (-1366.338) (-1364.887) -- 0:00:58 216500 -- (-1365.325) (-1364.944) (-1365.732) [-1362.513] * (-1363.712) (-1361.931) [-1368.933] (-1365.117) -- 0:00:57 217000 -- (-1364.820) (-1363.936) (-1365.338) [-1365.019] * (-1365.750) (-1364.100) (-1366.329) [-1368.635] -- 0:00:57 217500 -- (-1367.899) [-1367.328] (-1366.856) (-1364.026) * [-1363.674] (-1364.093) (-1363.485) (-1367.984) -- 0:00:57 218000 -- (-1362.949) (-1363.620) (-1365.487) [-1363.861] * (-1368.966) (-1365.102) [-1365.544] (-1366.082) -- 0:00:57 218500 -- (-1363.085) (-1364.313) (-1365.717) [-1363.751] * (-1362.641) [-1362.883] (-1363.553) (-1362.287) -- 0:00:57 219000 -- [-1366.296] (-1364.108) (-1369.822) (-1366.193) * [-1362.605] (-1362.961) (-1364.933) (-1362.260) -- 0:00:57 219500 -- (-1362.896) [-1362.864] (-1363.741) (-1369.694) * (-1362.681) (-1364.632) (-1363.167) [-1364.780] -- 0:00:56 220000 -- [-1362.590] (-1366.822) (-1365.883) (-1364.859) * (-1363.498) (-1364.216) (-1362.724) [-1364.880] -- 0:00:56 Average standard deviation of split frequencies: 0.019654 220500 -- (-1365.515) (-1366.402) [-1362.825] (-1367.768) * (-1363.881) (-1363.644) (-1362.554) [-1366.282] -- 0:00:56 221000 -- (-1362.861) [-1363.466] (-1364.753) (-1367.945) * (-1365.371) (-1363.032) (-1362.247) [-1363.242] -- 0:00:56 221500 -- (-1366.107) [-1363.226] (-1363.253) (-1365.907) * [-1364.863] (-1363.016) (-1361.803) (-1363.666) -- 0:00:56 222000 -- (-1365.301) (-1365.494) (-1364.044) [-1365.742] * [-1362.672] (-1362.765) (-1362.293) (-1365.380) -- 0:00:56 222500 -- (-1364.462) (-1362.406) [-1362.763] (-1363.340) * (-1362.475) (-1362.573) [-1362.286] (-1364.650) -- 0:00:55 223000 -- (-1364.704) (-1364.245) (-1368.074) [-1363.499] * (-1363.650) (-1366.146) (-1365.207) [-1365.603] -- 0:00:55 223500 -- (-1363.324) (-1363.567) [-1365.931] (-1363.211) * (-1363.142) [-1365.434] (-1365.856) (-1368.011) -- 0:00:55 224000 -- (-1362.681) (-1363.900) [-1365.352] (-1362.689) * [-1364.300] (-1371.339) (-1374.570) (-1365.017) -- 0:00:55 224500 -- (-1363.343) (-1365.709) [-1364.946] (-1363.244) * (-1364.412) [-1365.944] (-1369.863) (-1367.021) -- 0:00:58 225000 -- [-1362.908] (-1363.945) (-1364.126) (-1362.785) * [-1365.148] (-1364.024) (-1368.558) (-1366.222) -- 0:00:58 Average standard deviation of split frequencies: 0.018460 225500 -- [-1364.570] (-1368.108) (-1363.492) (-1364.140) * [-1364.547] (-1364.592) (-1365.227) (-1367.868) -- 0:00:58 226000 -- (-1363.059) (-1365.999) [-1364.644] (-1363.656) * [-1362.714] (-1363.553) (-1365.735) (-1366.576) -- 0:00:58 226500 -- (-1363.039) [-1363.294] (-1363.654) (-1363.176) * (-1362.356) (-1363.984) (-1366.103) [-1365.305] -- 0:00:58 227000 -- (-1363.161) (-1364.233) (-1364.164) [-1362.897] * [-1362.888] (-1366.939) (-1367.964) (-1365.170) -- 0:00:57 227500 -- (-1362.944) (-1365.622) [-1364.243] (-1363.850) * (-1365.841) (-1362.896) (-1372.543) [-1364.563] -- 0:00:57 228000 -- (-1362.684) [-1362.410] (-1364.166) (-1365.731) * [-1364.205] (-1363.067) (-1364.068) (-1363.492) -- 0:00:57 228500 -- (-1364.288) (-1362.809) (-1364.752) [-1362.579] * (-1364.289) (-1365.606) [-1363.741] (-1366.702) -- 0:00:57 229000 -- (-1364.489) (-1364.432) (-1363.762) [-1362.966] * (-1365.207) (-1363.898) (-1362.911) [-1366.337] -- 0:00:57 229500 -- (-1363.600) (-1363.651) (-1363.709) [-1362.267] * (-1363.313) (-1363.999) [-1363.143] (-1363.098) -- 0:00:57 230000 -- (-1362.250) (-1364.767) [-1369.331] (-1364.374) * (-1363.181) [-1364.341] (-1363.352) (-1365.894) -- 0:00:56 Average standard deviation of split frequencies: 0.018802 230500 -- (-1365.398) [-1364.207] (-1368.033) (-1368.339) * (-1363.039) (-1362.736) [-1362.711] (-1366.392) -- 0:00:56 231000 -- [-1368.027] (-1364.148) (-1367.383) (-1362.856) * (-1365.625) (-1363.031) (-1362.806) [-1366.283] -- 0:00:56 231500 -- (-1363.849) [-1363.370] (-1364.601) (-1363.306) * [-1363.440] (-1367.207) (-1363.385) (-1364.262) -- 0:00:56 232000 -- [-1363.787] (-1363.284) (-1363.664) (-1364.221) * (-1362.879) (-1365.269) [-1362.950] (-1363.110) -- 0:00:56 232500 -- (-1363.866) (-1364.583) (-1364.094) [-1365.285] * (-1364.573) (-1363.314) [-1363.413] (-1363.629) -- 0:00:56 233000 -- [-1363.775] (-1365.639) (-1366.193) (-1364.917) * (-1367.451) (-1362.836) [-1362.418] (-1365.973) -- 0:00:55 233500 -- [-1362.587] (-1364.527) (-1366.140) (-1363.595) * (-1362.597) (-1363.578) [-1364.278] (-1364.446) -- 0:00:55 234000 -- (-1363.868) [-1362.548] (-1364.665) (-1364.225) * (-1367.289) (-1363.620) [-1362.221] (-1363.676) -- 0:00:55 234500 -- (-1363.922) [-1362.473] (-1366.540) (-1363.476) * (-1364.723) [-1362.236] (-1364.403) (-1364.505) -- 0:00:55 235000 -- [-1364.820] (-1365.742) (-1365.625) (-1370.743) * (-1363.606) (-1362.911) [-1364.855] (-1365.328) -- 0:00:55 Average standard deviation of split frequencies: 0.017977 235500 -- [-1365.164] (-1364.166) (-1365.602) (-1370.790) * (-1364.503) (-1367.342) (-1364.278) [-1365.608] -- 0:00:55 236000 -- [-1362.604] (-1365.240) (-1362.800) (-1364.158) * (-1364.273) (-1363.512) [-1363.610] (-1364.356) -- 0:00:55 236500 -- (-1363.358) (-1363.790) (-1364.303) [-1363.097] * [-1368.868] (-1364.853) (-1363.676) (-1363.401) -- 0:00:54 237000 -- (-1362.817) (-1365.697) (-1365.567) [-1362.157] * (-1367.947) (-1364.223) (-1365.579) [-1364.969] -- 0:00:54 237500 -- (-1362.831) [-1364.980] (-1365.744) (-1364.090) * (-1362.251) [-1364.357] (-1363.364) (-1366.693) -- 0:00:57 238000 -- [-1364.588] (-1366.097) (-1364.019) (-1364.164) * (-1362.342) (-1364.203) [-1365.743] (-1363.724) -- 0:00:57 238500 -- (-1364.615) (-1364.283) (-1362.695) [-1362.239] * (-1362.924) [-1362.600] (-1367.060) (-1363.174) -- 0:00:57 239000 -- (-1367.748) (-1364.978) [-1364.115] (-1362.585) * (-1362.924) [-1365.113] (-1366.624) (-1366.939) -- 0:00:57 239500 -- (-1364.374) (-1362.365) [-1364.053] (-1366.201) * (-1362.836) (-1364.139) (-1365.762) [-1362.938] -- 0:00:57 240000 -- (-1364.402) (-1363.043) (-1366.114) [-1365.985] * (-1364.415) (-1362.384) (-1365.076) [-1362.927] -- 0:00:56 Average standard deviation of split frequencies: 0.016105 240500 -- (-1367.877) (-1363.065) [-1366.381] (-1363.125) * [-1364.415] (-1364.558) (-1368.765) (-1363.390) -- 0:00:56 241000 -- (-1362.870) (-1362.514) [-1364.046] (-1362.736) * [-1364.415] (-1364.714) (-1367.820) (-1363.231) -- 0:00:56 241500 -- (-1362.938) (-1363.407) [-1362.854] (-1363.002) * (-1366.773) (-1362.039) [-1363.567] (-1366.168) -- 0:00:56 242000 -- [-1365.428] (-1363.312) (-1364.528) (-1364.062) * (-1370.947) (-1363.610) [-1363.388] (-1367.384) -- 0:00:56 242500 -- [-1363.536] (-1363.842) (-1363.937) (-1363.681) * (-1365.903) (-1363.048) [-1366.539] (-1367.402) -- 0:00:56 243000 -- [-1365.459] (-1362.916) (-1362.029) (-1363.420) * (-1365.191) (-1363.179) [-1364.088] (-1367.447) -- 0:00:56 243500 -- (-1363.092) (-1365.819) (-1362.359) [-1365.570] * (-1365.492) [-1364.206] (-1365.337) (-1364.194) -- 0:00:55 244000 -- [-1362.817] (-1364.929) (-1363.168) (-1364.922) * [-1364.009] (-1363.380) (-1362.477) (-1363.392) -- 0:00:55 244500 -- [-1367.515] (-1366.677) (-1362.957) (-1365.518) * (-1364.936) [-1366.197] (-1363.576) (-1368.174) -- 0:00:55 245000 -- (-1364.413) (-1364.922) (-1364.241) [-1365.881] * (-1366.113) (-1366.884) (-1367.160) [-1365.486] -- 0:00:55 Average standard deviation of split frequencies: 0.014479 245500 -- (-1366.239) (-1364.943) [-1363.462] (-1367.245) * (-1365.994) (-1367.910) [-1364.640] (-1362.921) -- 0:00:55 246000 -- (-1365.151) (-1366.030) (-1362.884) [-1363.136] * [-1367.865] (-1365.680) (-1362.951) (-1367.236) -- 0:00:55 246500 -- [-1365.600] (-1372.776) (-1367.466) (-1366.774) * (-1367.492) (-1365.023) [-1364.493] (-1366.120) -- 0:00:55 247000 -- (-1365.845) (-1366.667) (-1364.849) [-1366.812] * (-1363.649) (-1364.632) [-1362.993] (-1363.642) -- 0:00:54 247500 -- (-1369.204) (-1366.270) (-1367.140) [-1364.804] * (-1365.928) [-1363.666] (-1363.383) (-1362.827) -- 0:00:54 248000 -- [-1363.487] (-1368.394) (-1368.377) (-1364.794) * (-1363.680) (-1363.117) [-1366.323] (-1364.489) -- 0:00:54 248500 -- [-1364.105] (-1370.479) (-1367.808) (-1371.807) * (-1363.674) (-1362.618) (-1364.376) [-1366.585] -- 0:00:54 249000 -- (-1364.614) (-1362.969) [-1365.784] (-1364.687) * (-1363.244) [-1362.847] (-1363.182) (-1370.010) -- 0:00:54 249500 -- (-1364.902) (-1364.792) [-1366.945] (-1363.267) * (-1365.809) [-1363.103] (-1363.040) (-1363.621) -- 0:00:54 250000 -- (-1364.460) (-1363.566) [-1363.365] (-1362.538) * (-1364.948) (-1363.965) (-1362.526) [-1363.065] -- 0:00:54 Average standard deviation of split frequencies: 0.014000 250500 -- [-1363.625] (-1364.519) (-1364.309) (-1363.048) * [-1367.978] (-1372.132) (-1368.066) (-1364.865) -- 0:00:53 251000 -- (-1364.076) [-1366.694] (-1364.023) (-1362.854) * [-1365.419] (-1362.916) (-1366.545) (-1364.275) -- 0:00:56 251500 -- (-1367.052) (-1366.694) (-1367.226) [-1363.497] * (-1364.079) (-1364.939) [-1364.262] (-1363.591) -- 0:00:56 252000 -- (-1366.944) (-1364.157) (-1366.307) [-1364.270] * (-1366.906) (-1366.792) [-1363.281] (-1365.881) -- 0:00:56 252500 -- (-1362.314) (-1364.157) [-1366.678] (-1364.460) * (-1365.994) [-1366.116] (-1364.163) (-1365.367) -- 0:00:56 253000 -- (-1365.290) (-1363.288) (-1368.736) [-1362.985] * [-1364.399] (-1364.661) (-1362.580) (-1366.048) -- 0:00:56 253500 -- [-1367.464] (-1364.249) (-1363.205) (-1363.712) * (-1362.804) (-1365.791) [-1362.514] (-1366.108) -- 0:00:55 254000 -- [-1364.593] (-1363.680) (-1362.582) (-1363.881) * (-1367.661) [-1366.034] (-1363.430) (-1363.609) -- 0:00:55 254500 -- (-1363.108) (-1363.216) (-1363.075) [-1363.785] * (-1367.620) (-1364.668) [-1363.530] (-1363.889) -- 0:00:55 255000 -- (-1363.727) [-1363.099] (-1363.645) (-1365.838) * (-1362.334) [-1363.668] (-1362.528) (-1364.985) -- 0:00:55 Average standard deviation of split frequencies: 0.014322 255500 -- [-1364.843] (-1363.492) (-1364.361) (-1365.813) * (-1362.359) (-1362.750) (-1362.528) [-1364.515] -- 0:00:55 256000 -- [-1365.300] (-1364.709) (-1364.396) (-1365.371) * (-1362.357) [-1364.068] (-1362.330) (-1364.121) -- 0:00:55 256500 -- (-1365.943) [-1363.571] (-1364.523) (-1362.150) * (-1364.438) (-1369.216) [-1362.164] (-1365.471) -- 0:00:55 257000 -- (-1367.843) (-1363.569) [-1365.953] (-1362.146) * (-1365.570) (-1367.061) (-1362.827) [-1363.563] -- 0:00:54 257500 -- [-1365.742] (-1363.105) (-1362.147) (-1365.727) * (-1363.526) [-1364.153] (-1362.805) (-1364.323) -- 0:00:54 258000 -- (-1363.866) [-1363.053] (-1363.076) (-1362.814) * [-1365.017] (-1362.557) (-1368.722) (-1365.170) -- 0:00:54 258500 -- (-1367.722) (-1363.595) [-1365.836] (-1366.334) * [-1362.468] (-1362.143) (-1365.198) (-1366.619) -- 0:00:54 259000 -- (-1366.293) [-1363.872] (-1365.836) (-1365.870) * (-1364.181) [-1362.035] (-1365.934) (-1366.379) -- 0:00:54 259500 -- [-1362.803] (-1363.939) (-1367.977) (-1365.497) * (-1362.906) (-1362.583) [-1363.690] (-1362.784) -- 0:00:54 260000 -- [-1365.108] (-1362.208) (-1363.435) (-1365.539) * (-1363.766) (-1366.345) [-1363.576] (-1363.683) -- 0:00:54 Average standard deviation of split frequencies: 0.014568 260500 -- [-1364.400] (-1363.554) (-1365.970) (-1367.539) * (-1365.019) (-1364.094) [-1363.083] (-1362.855) -- 0:00:53 261000 -- (-1365.150) (-1363.803) (-1365.957) [-1370.416] * [-1363.643] (-1364.156) (-1366.687) (-1363.295) -- 0:00:53 261500 -- (-1363.795) [-1363.763] (-1368.388) (-1363.585) * (-1365.927) [-1364.964] (-1368.123) (-1363.624) -- 0:00:53 262000 -- (-1364.122) (-1364.120) (-1368.434) [-1362.710] * [-1365.711] (-1365.633) (-1369.024) (-1362.619) -- 0:00:53 262500 -- (-1364.038) [-1363.494] (-1366.019) (-1362.220) * (-1364.061) (-1364.836) (-1367.073) [-1363.331] -- 0:00:53 263000 -- [-1366.880] (-1364.592) (-1363.365) (-1362.836) * (-1371.066) [-1368.298] (-1366.585) (-1364.002) -- 0:00:53 263500 -- (-1366.984) (-1364.005) [-1363.628] (-1369.965) * (-1365.164) (-1368.671) [-1367.538] (-1363.622) -- 0:00:53 264000 -- (-1369.362) [-1363.267] (-1362.802) (-1371.121) * (-1365.588) [-1364.729] (-1367.871) (-1366.925) -- 0:00:52 264500 -- (-1365.161) (-1363.469) [-1363.189] (-1365.228) * [-1365.637] (-1366.072) (-1367.655) (-1366.215) -- 0:00:55 265000 -- (-1364.693) (-1366.405) (-1362.929) [-1363.741] * [-1368.288] (-1365.011) (-1365.829) (-1365.954) -- 0:00:55 Average standard deviation of split frequencies: 0.014670 265500 -- [-1364.287] (-1364.128) (-1363.975) (-1364.185) * (-1367.068) (-1366.955) (-1364.138) [-1363.552] -- 0:00:55 266000 -- (-1362.766) (-1365.111) (-1366.838) [-1371.954] * (-1364.401) (-1367.070) (-1364.521) [-1362.367] -- 0:00:55 266500 -- (-1362.904) (-1365.132) [-1361.772] (-1367.523) * (-1364.401) [-1365.892] (-1362.026) (-1362.739) -- 0:00:55 267000 -- (-1363.541) (-1364.555) [-1364.419] (-1366.911) * (-1364.159) (-1369.385) (-1368.220) [-1362.787] -- 0:00:54 267500 -- (-1363.527) [-1364.261] (-1365.582) (-1362.607) * [-1363.966] (-1363.574) (-1365.499) (-1365.182) -- 0:00:54 268000 -- (-1363.905) (-1364.963) (-1363.094) [-1362.184] * (-1362.470) [-1363.529] (-1368.318) (-1363.749) -- 0:00:54 268500 -- (-1365.343) [-1363.378] (-1363.297) (-1365.137) * (-1363.383) (-1364.406) (-1366.355) [-1362.865] -- 0:00:54 269000 -- (-1364.966) [-1362.821] (-1363.817) (-1363.614) * (-1365.360) (-1369.586) [-1365.152] (-1370.111) -- 0:00:54 269500 -- (-1366.375) (-1363.338) (-1365.304) [-1364.483] * [-1364.541] (-1368.331) (-1362.786) (-1368.122) -- 0:00:54 270000 -- [-1365.797] (-1366.511) (-1364.614) (-1363.583) * (-1364.934) [-1366.144] (-1362.935) (-1364.257) -- 0:00:54 Average standard deviation of split frequencies: 0.014997 270500 -- (-1362.473) (-1366.028) (-1364.652) [-1362.619] * (-1363.500) [-1363.717] (-1363.977) (-1367.814) -- 0:00:53 271000 -- (-1362.451) [-1368.106] (-1364.346) (-1362.504) * (-1364.847) [-1364.850] (-1365.109) (-1373.422) -- 0:00:53 271500 -- (-1362.018) (-1362.329) (-1365.805) [-1363.026] * (-1367.378) (-1362.367) (-1368.374) [-1366.771] -- 0:00:53 272000 -- (-1363.641) (-1364.901) (-1363.800) [-1367.972] * (-1365.625) (-1362.924) (-1366.541) [-1370.441] -- 0:00:53 272500 -- (-1366.028) [-1364.680] (-1364.120) (-1366.544) * (-1363.476) (-1364.068) (-1371.639) [-1364.463] -- 0:00:53 273000 -- (-1364.399) (-1364.634) (-1366.664) [-1362.105] * [-1365.164] (-1364.067) (-1367.780) (-1362.370) -- 0:00:53 273500 -- (-1366.029) (-1362.695) [-1367.982] (-1365.542) * (-1368.853) (-1364.762) (-1364.358) [-1362.308] -- 0:00:53 274000 -- (-1365.186) (-1363.220) (-1362.568) [-1363.833] * (-1367.352) (-1367.105) [-1364.324] (-1362.808) -- 0:00:52 274500 -- (-1363.345) (-1363.972) [-1363.499] (-1363.516) * (-1366.470) [-1369.345] (-1363.931) (-1362.675) -- 0:00:52 275000 -- [-1362.428] (-1363.693) (-1363.073) (-1362.423) * (-1366.222) [-1369.276] (-1363.969) (-1365.015) -- 0:00:52 Average standard deviation of split frequencies: 0.013759 275500 -- (-1364.459) (-1364.297) [-1363.797] (-1363.487) * (-1367.083) (-1371.860) (-1364.285) [-1365.124] -- 0:00:52 276000 -- (-1366.753) (-1365.960) [-1365.186] (-1362.482) * (-1364.373) [-1368.629] (-1364.480) (-1363.895) -- 0:00:52 276500 -- [-1363.756] (-1365.122) (-1363.881) (-1363.297) * (-1363.313) [-1366.394] (-1363.245) (-1363.886) -- 0:00:52 277000 -- (-1364.087) (-1364.877) (-1365.516) [-1363.736] * (-1362.706) [-1365.179] (-1363.714) (-1363.172) -- 0:00:52 277500 -- (-1364.884) (-1365.058) [-1363.315] (-1363.153) * (-1362.473) (-1363.568) (-1369.398) [-1364.470] -- 0:00:52 278000 -- (-1364.422) (-1365.380) (-1363.132) [-1363.005] * (-1363.742) [-1364.942] (-1366.226) (-1362.176) -- 0:00:54 278500 -- (-1365.521) [-1363.870] (-1363.428) (-1363.069) * (-1366.232) (-1363.407) [-1362.744] (-1363.799) -- 0:00:54 279000 -- (-1366.518) (-1363.780) (-1368.166) [-1367.465] * [-1362.463] (-1363.853) (-1363.379) (-1363.406) -- 0:00:54 279500 -- (-1367.004) (-1364.570) [-1364.005] (-1365.023) * (-1363.459) (-1365.580) [-1366.000] (-1363.428) -- 0:00:54 280000 -- (-1364.348) (-1363.545) (-1363.711) [-1363.971] * (-1362.649) [-1363.838] (-1372.122) (-1361.959) -- 0:00:53 Average standard deviation of split frequencies: 0.014326 280500 -- (-1361.952) (-1365.161) (-1367.461) [-1365.406] * (-1362.285) [-1364.566] (-1367.378) (-1362.960) -- 0:00:53 281000 -- [-1362.965] (-1363.929) (-1367.164) (-1367.003) * (-1362.507) [-1367.215] (-1366.984) (-1364.269) -- 0:00:53 281500 -- (-1362.552) (-1365.715) (-1364.370) [-1367.743] * (-1366.726) [-1366.009] (-1363.968) (-1365.493) -- 0:00:53 282000 -- (-1363.044) (-1365.325) (-1363.140) [-1365.478] * (-1365.255) (-1366.011) (-1362.504) [-1365.706] -- 0:00:53 282500 -- [-1364.385] (-1367.502) (-1365.771) (-1363.762) * (-1364.699) [-1365.933] (-1363.395) (-1364.606) -- 0:00:53 283000 -- [-1367.039] (-1365.150) (-1367.812) (-1362.968) * (-1364.508) [-1363.197] (-1364.411) (-1365.984) -- 0:00:53 283500 -- (-1366.101) [-1363.485] (-1363.597) (-1364.131) * (-1364.826) (-1364.133) [-1363.244] (-1363.756) -- 0:00:53 284000 -- [-1363.882] (-1363.476) (-1365.609) (-1363.348) * (-1363.466) (-1363.856) [-1363.437] (-1364.450) -- 0:00:52 284500 -- (-1364.670) (-1363.435) (-1365.739) [-1363.285] * (-1363.728) [-1362.456] (-1363.665) (-1364.061) -- 0:00:52 285000 -- (-1365.913) (-1369.151) (-1367.759) [-1363.070] * (-1363.838) [-1362.877] (-1364.051) (-1368.117) -- 0:00:52 Average standard deviation of split frequencies: 0.013644 285500 -- (-1366.357) [-1367.347] (-1365.261) (-1365.378) * (-1363.546) (-1362.712) (-1363.960) [-1362.625] -- 0:00:52 286000 -- (-1362.740) (-1364.353) [-1363.883] (-1367.289) * (-1363.908) (-1362.474) [-1364.048] (-1363.272) -- 0:00:52 286500 -- (-1362.353) (-1367.033) [-1363.059] (-1365.952) * [-1364.880] (-1364.681) (-1363.652) (-1363.737) -- 0:00:52 287000 -- [-1362.633] (-1361.889) (-1363.098) (-1367.095) * [-1364.652] (-1363.874) (-1365.719) (-1364.915) -- 0:00:52 287500 -- (-1363.863) (-1363.082) [-1365.284] (-1364.559) * (-1363.528) (-1363.060) (-1365.095) [-1362.420] -- 0:00:52 288000 -- [-1363.199] (-1366.271) (-1365.132) (-1363.434) * [-1363.670] (-1363.083) (-1364.327) (-1362.420) -- 0:00:51 288500 -- (-1363.459) [-1364.934] (-1364.917) (-1367.221) * (-1363.386) [-1363.074] (-1362.831) (-1363.410) -- 0:00:51 289000 -- (-1362.855) (-1365.057) [-1366.766] (-1371.705) * (-1366.603) [-1365.797] (-1363.556) (-1363.886) -- 0:00:51 289500 -- [-1362.222] (-1364.635) (-1366.574) (-1366.667) * (-1366.381) [-1366.270] (-1363.244) (-1370.066) -- 0:00:51 290000 -- [-1363.364] (-1363.642) (-1366.213) (-1367.837) * [-1368.277] (-1367.014) (-1363.393) (-1366.908) -- 0:00:51 Average standard deviation of split frequencies: 0.013515 290500 -- (-1364.656) (-1364.278) [-1364.134] (-1365.649) * [-1364.043] (-1363.795) (-1363.730) (-1366.349) -- 0:00:51 291000 -- (-1367.207) [-1363.679] (-1363.568) (-1364.264) * (-1363.337) [-1364.880] (-1366.766) (-1366.463) -- 0:00:51 291500 -- (-1364.582) (-1366.731) (-1363.994) [-1364.493] * (-1362.883) [-1364.958] (-1364.491) (-1370.549) -- 0:00:53 292000 -- (-1365.106) (-1365.964) (-1362.375) [-1363.719] * (-1363.613) (-1364.915) [-1364.961] (-1367.691) -- 0:00:53 292500 -- (-1364.393) [-1362.361] (-1364.271) (-1364.118) * (-1365.098) (-1365.475) [-1362.489] (-1365.097) -- 0:00:53 293000 -- (-1362.848) (-1362.641) (-1362.899) [-1364.643] * (-1366.072) (-1366.426) [-1362.798] (-1363.467) -- 0:00:53 293500 -- (-1363.701) (-1362.103) [-1363.772] (-1363.869) * (-1366.913) [-1362.388] (-1362.868) (-1363.813) -- 0:00:52 294000 -- (-1362.328) (-1364.403) [-1364.247] (-1364.217) * (-1366.953) (-1364.239) (-1364.469) [-1362.901] -- 0:00:52 294500 -- [-1363.751] (-1364.075) (-1364.572) (-1365.789) * (-1364.300) (-1363.778) (-1363.534) [-1363.953] -- 0:00:52 295000 -- (-1363.151) [-1363.138] (-1365.253) (-1364.270) * (-1362.934) [-1362.265] (-1364.438) (-1365.896) -- 0:00:52 Average standard deviation of split frequencies: 0.013914 295500 -- (-1368.992) (-1362.385) [-1365.729] (-1363.330) * [-1364.399] (-1362.194) (-1367.125) (-1366.971) -- 0:00:52 296000 -- (-1367.334) (-1362.287) (-1364.783) [-1365.745] * [-1364.966] (-1362.871) (-1365.692) (-1368.711) -- 0:00:52 296500 -- (-1364.080) [-1363.994] (-1369.361) (-1364.646) * (-1362.690) [-1363.342] (-1366.531) (-1369.483) -- 0:00:52 297000 -- (-1362.855) (-1363.040) [-1364.893] (-1365.214) * (-1363.720) (-1363.548) [-1364.914] (-1365.096) -- 0:00:52 297500 -- (-1363.593) (-1363.257) [-1364.251] (-1364.935) * (-1369.552) (-1363.732) [-1362.330] (-1365.151) -- 0:00:51 298000 -- (-1363.030) [-1363.290] (-1362.669) (-1363.631) * [-1364.758] (-1363.732) (-1366.549) (-1374.330) -- 0:00:51 298500 -- (-1363.047) (-1362.764) [-1367.045] (-1362.956) * (-1364.478) [-1363.463] (-1369.041) (-1369.960) -- 0:00:51 299000 -- [-1364.605] (-1367.375) (-1363.805) (-1364.384) * [-1363.174] (-1362.877) (-1367.063) (-1367.065) -- 0:00:51 299500 -- [-1364.395] (-1364.101) (-1363.863) (-1364.947) * [-1364.302] (-1366.231) (-1363.742) (-1364.478) -- 0:00:51 300000 -- [-1367.730] (-1364.923) (-1363.951) (-1363.608) * (-1363.079) [-1364.265] (-1364.938) (-1363.919) -- 0:00:51 Average standard deviation of split frequencies: 0.014895 300500 -- [-1363.541] (-1364.116) (-1363.995) (-1363.990) * (-1363.054) (-1363.142) [-1366.067] (-1367.965) -- 0:00:51 301000 -- (-1362.429) (-1362.588) (-1363.660) [-1363.908] * (-1365.023) (-1364.019) [-1363.063] (-1366.704) -- 0:00:51 301500 -- [-1362.296] (-1362.714) (-1363.886) (-1371.495) * (-1361.916) (-1367.777) (-1365.084) [-1366.033] -- 0:00:50 302000 -- [-1366.020] (-1364.971) (-1364.155) (-1369.351) * [-1362.972] (-1362.696) (-1364.696) (-1363.660) -- 0:00:50 302500 -- (-1366.926) [-1362.314] (-1364.395) (-1367.318) * (-1363.364) (-1362.427) [-1365.862] (-1363.233) -- 0:00:50 303000 -- (-1369.205) (-1362.635) (-1363.434) [-1366.195] * (-1362.932) [-1363.190] (-1363.525) (-1362.283) -- 0:00:50 303500 -- (-1365.646) (-1363.157) [-1362.689] (-1365.712) * (-1367.988) (-1365.068) [-1364.297] (-1363.540) -- 0:00:50 304000 -- [-1364.214] (-1363.353) (-1363.068) (-1365.309) * (-1363.694) [-1362.826] (-1364.928) (-1362.766) -- 0:00:50 304500 -- (-1365.810) (-1362.838) (-1365.135) [-1363.264] * [-1364.812] (-1365.814) (-1364.364) (-1363.757) -- 0:00:50 305000 -- (-1365.238) [-1365.940] (-1364.486) (-1363.015) * [-1365.011] (-1364.896) (-1364.985) (-1362.765) -- 0:00:52 Average standard deviation of split frequencies: 0.013351 305500 -- [-1362.975] (-1366.636) (-1366.006) (-1363.659) * (-1363.189) (-1363.542) [-1366.310] (-1363.798) -- 0:00:52 306000 -- (-1367.263) (-1363.387) (-1364.403) [-1363.491] * (-1362.992) [-1362.742] (-1363.045) (-1369.473) -- 0:00:52 306500 -- (-1362.763) (-1362.830) [-1364.916] (-1363.381) * (-1365.398) [-1362.989] (-1363.091) (-1366.058) -- 0:00:52 307000 -- (-1362.836) [-1363.213] (-1364.216) (-1363.247) * (-1363.274) [-1365.416] (-1365.092) (-1364.694) -- 0:00:51 307500 -- [-1363.564] (-1363.115) (-1366.099) (-1365.511) * (-1365.045) (-1364.792) [-1364.459] (-1366.060) -- 0:00:51 308000 -- [-1364.214] (-1363.013) (-1366.851) (-1364.650) * (-1364.148) (-1367.845) [-1364.037] (-1368.324) -- 0:00:51 308500 -- [-1365.214] (-1365.160) (-1365.739) (-1367.127) * (-1366.124) [-1364.817] (-1363.554) (-1363.672) -- 0:00:51 309000 -- (-1365.601) [-1363.700] (-1368.344) (-1366.191) * [-1362.958] (-1365.979) (-1365.765) (-1363.039) -- 0:00:51 309500 -- [-1364.605] (-1364.013) (-1363.675) (-1363.511) * (-1362.277) (-1369.847) (-1366.304) [-1363.425] -- 0:00:51 310000 -- [-1365.229] (-1362.748) (-1367.285) (-1365.780) * [-1365.566] (-1364.597) (-1370.095) (-1363.697) -- 0:00:51 Average standard deviation of split frequencies: 0.012858 310500 -- (-1364.560) (-1363.369) [-1364.654] (-1369.985) * [-1363.105] (-1367.355) (-1368.732) (-1362.756) -- 0:00:51 311000 -- (-1363.487) [-1364.373] (-1362.997) (-1371.107) * (-1365.202) (-1363.407) [-1363.943] (-1364.329) -- 0:00:50 311500 -- (-1364.240) [-1363.721] (-1364.360) (-1369.047) * (-1368.269) (-1363.680) [-1363.963] (-1371.474) -- 0:00:50 312000 -- (-1364.879) (-1364.766) [-1364.418] (-1363.900) * (-1362.493) (-1364.191) [-1362.960] (-1367.506) -- 0:00:50 312500 -- [-1363.434] (-1365.837) (-1363.290) (-1363.834) * (-1366.858) [-1362.744] (-1364.212) (-1363.870) -- 0:00:50 313000 -- (-1366.181) [-1365.304] (-1364.158) (-1363.226) * (-1366.174) [-1363.229] (-1366.575) (-1364.298) -- 0:00:50 313500 -- (-1365.099) (-1365.139) [-1362.947] (-1362.511) * (-1366.628) (-1363.203) (-1367.799) [-1363.966] -- 0:00:50 314000 -- (-1365.016) (-1366.803) [-1363.956] (-1362.840) * (-1368.565) (-1362.382) (-1364.203) [-1362.935] -- 0:00:50 314500 -- (-1364.610) [-1363.886] (-1365.005) (-1363.127) * (-1369.911) [-1362.199] (-1366.031) (-1363.117) -- 0:00:50 315000 -- (-1366.182) (-1364.720) (-1364.655) [-1362.965] * (-1364.529) (-1363.382) (-1363.283) [-1363.925] -- 0:00:50 Average standard deviation of split frequencies: 0.012987 315500 -- (-1364.745) (-1363.597) [-1366.519] (-1363.105) * (-1364.857) [-1366.325] (-1363.283) (-1364.702) -- 0:00:49 316000 -- (-1362.543) [-1363.753] (-1365.024) (-1363.424) * (-1364.879) (-1363.838) [-1365.287] (-1364.921) -- 0:00:49 316500 -- (-1365.477) [-1365.734] (-1365.074) (-1362.758) * (-1363.120) [-1365.693] (-1366.052) (-1363.450) -- 0:00:49 317000 -- (-1367.904) (-1362.610) (-1364.845) [-1362.911] * (-1362.724) (-1364.110) (-1367.015) [-1362.641] -- 0:00:49 317500 -- (-1365.135) (-1362.773) [-1362.673] (-1362.914) * (-1363.569) [-1365.457] (-1362.854) (-1365.175) -- 0:00:49 318000 -- (-1364.542) (-1362.813) [-1363.054] (-1362.914) * (-1363.130) (-1364.151) (-1362.799) [-1364.746] -- 0:00:49 318500 -- (-1367.324) (-1363.597) [-1363.750] (-1364.813) * (-1363.422) (-1363.869) [-1364.028] (-1364.162) -- 0:00:51 319000 -- [-1365.312] (-1363.538) (-1364.735) (-1364.647) * [-1364.029] (-1363.683) (-1362.329) (-1365.778) -- 0:00:51 319500 -- (-1367.503) [-1362.135] (-1364.833) (-1362.301) * (-1364.035) (-1362.953) (-1362.483) [-1365.910] -- 0:00:51 320000 -- [-1363.933] (-1364.437) (-1364.411) (-1363.974) * [-1363.627] (-1364.010) (-1362.915) (-1363.695) -- 0:00:50 Average standard deviation of split frequencies: 0.014456 320500 -- [-1364.312] (-1363.246) (-1364.462) (-1364.346) * (-1362.241) [-1363.393] (-1366.038) (-1363.843) -- 0:00:50 321000 -- [-1367.195] (-1362.361) (-1365.512) (-1363.838) * [-1362.499] (-1366.566) (-1364.536) (-1364.859) -- 0:00:50 321500 -- [-1364.173] (-1363.473) (-1364.608) (-1363.433) * (-1364.676) [-1365.583] (-1362.110) (-1365.168) -- 0:00:50 322000 -- [-1364.240] (-1364.749) (-1363.632) (-1364.553) * (-1363.955) [-1363.205] (-1364.231) (-1362.405) -- 0:00:50 322500 -- (-1365.009) (-1363.884) [-1362.928] (-1365.022) * (-1364.281) (-1364.327) (-1362.143) [-1365.121] -- 0:00:50 323000 -- (-1364.241) (-1363.842) (-1363.520) [-1366.092] * [-1364.863] (-1362.945) (-1365.185) (-1364.662) -- 0:00:50 323500 -- [-1368.467] (-1364.348) (-1362.425) (-1365.403) * (-1363.458) (-1365.301) [-1362.849] (-1368.730) -- 0:00:50 324000 -- (-1366.617) (-1366.054) [-1363.895] (-1364.631) * (-1364.282) (-1364.339) [-1362.963] (-1368.280) -- 0:00:50 324500 -- (-1367.301) (-1363.593) (-1362.892) [-1367.241] * (-1363.987) (-1365.553) (-1363.831) [-1365.732] -- 0:00:49 325000 -- [-1363.422] (-1366.797) (-1366.840) (-1369.608) * (-1366.484) (-1365.904) (-1364.367) [-1364.449] -- 0:00:49 Average standard deviation of split frequencies: 0.016972 325500 -- (-1363.112) [-1363.044] (-1364.990) (-1366.560) * (-1366.590) (-1365.610) [-1363.926] (-1366.690) -- 0:00:49 326000 -- [-1362.868] (-1363.442) (-1363.855) (-1365.488) * [-1364.102] (-1364.395) (-1363.089) (-1362.815) -- 0:00:49 326500 -- (-1364.753) (-1363.547) [-1363.015] (-1367.495) * (-1365.962) [-1364.122] (-1364.304) (-1364.659) -- 0:00:49 327000 -- (-1363.907) (-1363.304) [-1362.386] (-1362.295) * [-1368.540] (-1365.357) (-1363.378) (-1365.810) -- 0:00:49 327500 -- [-1362.355] (-1362.879) (-1363.121) (-1364.225) * (-1364.263) (-1365.119) [-1363.967] (-1363.962) -- 0:00:49 328000 -- (-1361.957) (-1363.986) [-1363.760] (-1366.492) * (-1367.715) (-1369.393) (-1364.415) [-1369.367] -- 0:00:49 328500 -- [-1364.988] (-1362.905) (-1363.696) (-1365.135) * [-1362.355] (-1366.658) (-1365.407) (-1369.316) -- 0:00:49 329000 -- (-1363.673) (-1364.646) (-1363.191) [-1363.292] * (-1362.273) (-1364.206) (-1366.745) [-1369.548] -- 0:00:48 329500 -- (-1364.145) [-1364.856] (-1362.280) (-1362.148) * (-1362.137) (-1363.030) [-1365.010] (-1368.792) -- 0:00:48 330000 -- (-1365.035) (-1362.742) (-1362.805) [-1362.577] * (-1361.976) [-1364.082] (-1365.098) (-1368.759) -- 0:00:48 Average standard deviation of split frequencies: 0.015365 330500 -- (-1365.354) (-1366.577) [-1362.792] (-1364.268) * [-1363.757] (-1365.808) (-1365.119) (-1363.999) -- 0:00:48 331000 -- [-1363.105] (-1365.180) (-1363.482) (-1362.795) * (-1365.978) (-1363.775) (-1363.297) [-1363.847] -- 0:00:48 331500 -- (-1365.106) (-1368.620) (-1363.290) [-1364.052] * (-1363.677) (-1366.035) [-1363.004] (-1365.145) -- 0:00:50 332000 -- (-1365.256) [-1364.800] (-1363.028) (-1368.983) * (-1363.286) [-1362.444] (-1364.451) (-1364.236) -- 0:00:50 332500 -- (-1366.465) [-1365.059] (-1363.615) (-1364.301) * (-1363.730) [-1362.549] (-1367.783) (-1363.657) -- 0:00:50 333000 -- [-1363.476] (-1363.159) (-1363.446) (-1371.799) * (-1363.166) [-1363.043] (-1365.217) (-1365.281) -- 0:00:50 333500 -- (-1368.648) [-1364.802] (-1363.728) (-1370.126) * [-1363.474] (-1363.267) (-1364.240) (-1366.077) -- 0:00:49 334000 -- [-1363.893] (-1363.624) (-1365.530) (-1367.511) * (-1363.268) (-1362.776) (-1363.568) [-1365.181] -- 0:00:49 334500 -- [-1364.295] (-1367.323) (-1363.602) (-1367.856) * [-1363.229] (-1369.889) (-1364.631) (-1367.203) -- 0:00:49 335000 -- (-1363.216) (-1363.850) [-1363.053] (-1366.706) * [-1363.281] (-1370.437) (-1364.621) (-1366.508) -- 0:00:49 Average standard deviation of split frequencies: 0.015277 335500 -- [-1364.079] (-1369.188) (-1362.597) (-1368.379) * [-1362.528] (-1363.732) (-1363.946) (-1363.214) -- 0:00:49 336000 -- (-1363.236) [-1367.467] (-1362.519) (-1366.293) * (-1363.189) (-1368.524) [-1363.583] (-1363.312) -- 0:00:49 336500 -- (-1363.223) (-1365.363) [-1364.014] (-1365.463) * (-1365.884) (-1368.162) [-1363.272] (-1368.760) -- 0:00:49 337000 -- (-1363.450) [-1365.773] (-1365.120) (-1365.472) * [-1364.266] (-1366.880) (-1363.384) (-1367.419) -- 0:00:49 337500 -- (-1363.139) (-1368.517) [-1364.654] (-1366.055) * (-1365.383) (-1362.570) [-1364.644] (-1364.294) -- 0:00:49 338000 -- (-1363.840) (-1366.190) [-1364.175] (-1362.454) * (-1362.932) (-1362.091) (-1364.519) [-1367.160] -- 0:00:48 338500 -- (-1363.022) (-1363.533) (-1369.669) [-1363.089] * (-1365.352) (-1364.140) [-1365.246] (-1366.936) -- 0:00:48 339000 -- (-1364.419) (-1363.999) [-1367.528] (-1366.662) * (-1365.316) (-1363.313) (-1364.634) [-1364.132] -- 0:00:48 339500 -- (-1366.189) (-1363.666) (-1367.465) [-1363.199] * (-1369.049) (-1365.448) (-1363.967) [-1365.189] -- 0:00:48 340000 -- (-1364.307) [-1363.143] (-1370.694) (-1363.476) * (-1366.723) (-1365.432) (-1364.390) [-1366.820] -- 0:00:48 Average standard deviation of split frequencies: 0.014760 340500 -- (-1366.186) (-1363.645) [-1366.207] (-1366.236) * [-1363.901] (-1362.585) (-1363.048) (-1366.007) -- 0:00:48 341000 -- (-1367.095) (-1364.501) [-1364.492] (-1364.179) * (-1362.871) (-1365.902) (-1362.842) [-1364.115] -- 0:00:48 341500 -- [-1363.683] (-1363.831) (-1366.532) (-1364.297) * [-1363.003] (-1364.549) (-1368.879) (-1362.389) -- 0:00:48 342000 -- (-1362.710) (-1363.370) (-1363.685) [-1363.499] * [-1363.003] (-1364.156) (-1367.548) (-1363.106) -- 0:00:48 342500 -- (-1362.629) (-1362.916) (-1362.978) [-1362.556] * (-1362.785) [-1367.605] (-1365.290) (-1362.422) -- 0:00:47 343000 -- (-1363.029) [-1363.605] (-1366.873) (-1362.344) * (-1364.098) [-1364.575] (-1363.624) (-1368.224) -- 0:00:47 343500 -- (-1363.112) (-1366.670) (-1367.039) [-1362.973] * (-1363.146) (-1363.835) (-1363.946) [-1365.182] -- 0:00:47 344000 -- [-1364.612] (-1367.693) (-1364.184) (-1365.015) * [-1363.142] (-1368.441) (-1363.688) (-1366.400) -- 0:00:47 344500 -- [-1364.457] (-1365.168) (-1364.148) (-1364.157) * (-1362.576) (-1366.723) (-1363.929) [-1367.439] -- 0:00:47 345000 -- [-1364.031] (-1363.254) (-1364.353) (-1364.157) * (-1367.309) (-1365.437) [-1367.230] (-1366.153) -- 0:00:49 Average standard deviation of split frequencies: 0.013840 345500 -- (-1363.753) (-1362.509) [-1366.461] (-1364.392) * (-1363.187) [-1365.810] (-1365.686) (-1361.895) -- 0:00:49 346000 -- (-1366.199) (-1363.422) (-1365.720) [-1363.151] * [-1363.259] (-1365.801) (-1362.260) (-1362.306) -- 0:00:49 346500 -- (-1364.058) (-1364.917) [-1364.651] (-1362.701) * [-1363.161] (-1364.639) (-1362.695) (-1364.275) -- 0:00:49 347000 -- (-1363.631) [-1365.506] (-1363.892) (-1362.701) * (-1363.548) (-1364.605) (-1364.153) [-1365.352] -- 0:00:48 347500 -- (-1362.848) (-1365.056) [-1363.783] (-1364.944) * [-1362.454] (-1362.419) (-1364.407) (-1364.279) -- 0:00:48 348000 -- (-1367.019) [-1362.932] (-1363.877) (-1365.776) * (-1363.740) [-1362.419] (-1362.569) (-1363.128) -- 0:00:48 348500 -- (-1363.287) (-1362.772) [-1365.217] (-1362.976) * (-1363.700) (-1367.100) (-1362.700) [-1364.136] -- 0:00:48 349000 -- (-1362.504) (-1362.881) [-1366.844] (-1366.546) * (-1364.300) (-1363.613) [-1362.774] (-1362.820) -- 0:00:48 349500 -- (-1362.686) (-1363.232) [-1366.263] (-1363.249) * (-1362.663) (-1362.645) [-1364.886] (-1363.628) -- 0:00:48 350000 -- [-1363.419] (-1362.596) (-1362.020) (-1363.685) * (-1363.167) (-1363.234) (-1363.055) [-1363.454] -- 0:00:48 Average standard deviation of split frequencies: 0.014471 350500 -- (-1364.064) (-1365.757) (-1362.917) [-1363.680] * (-1362.864) (-1364.774) [-1367.210] (-1363.433) -- 0:00:48 351000 -- (-1365.464) (-1364.184) [-1363.258] (-1362.430) * [-1362.737] (-1363.796) (-1364.284) (-1364.227) -- 0:00:48 351500 -- [-1363.680] (-1366.846) (-1367.991) (-1363.339) * (-1365.471) [-1362.800] (-1366.432) (-1365.095) -- 0:00:47 352000 -- (-1363.531) (-1362.491) [-1362.817] (-1363.327) * [-1366.654] (-1365.320) (-1363.997) (-1370.902) -- 0:00:47 352500 -- (-1364.006) [-1363.065] (-1363.616) (-1363.695) * (-1368.861) [-1363.801] (-1363.377) (-1371.469) -- 0:00:47 353000 -- (-1365.150) [-1366.427] (-1363.367) (-1363.931) * (-1367.396) (-1363.966) [-1362.597] (-1367.727) -- 0:00:47 353500 -- (-1372.469) (-1362.967) [-1363.318] (-1365.028) * (-1366.418) [-1364.891] (-1362.645) (-1362.495) -- 0:00:47 354000 -- [-1363.456] (-1366.502) (-1362.762) (-1364.781) * [-1362.431] (-1362.805) (-1364.202) (-1363.149) -- 0:00:47 354500 -- (-1363.057) (-1367.055) (-1365.691) [-1365.427] * (-1363.107) [-1362.425] (-1363.648) (-1365.431) -- 0:00:47 355000 -- [-1363.250] (-1364.705) (-1367.264) (-1366.594) * (-1363.946) [-1365.321] (-1364.403) (-1364.579) -- 0:00:47 Average standard deviation of split frequencies: 0.014198 355500 -- (-1362.514) [-1363.447] (-1367.573) (-1371.895) * (-1363.945) (-1363.947) [-1364.152] (-1364.943) -- 0:00:47 356000 -- (-1367.368) (-1365.030) [-1362.498] (-1368.707) * (-1363.587) (-1363.541) [-1363.639] (-1364.079) -- 0:00:47 356500 -- (-1365.769) [-1364.354] (-1362.243) (-1363.635) * (-1362.721) [-1362.184] (-1365.710) (-1364.097) -- 0:00:46 357000 -- (-1367.556) (-1366.155) (-1362.161) [-1362.730] * (-1362.481) (-1364.434) (-1361.990) [-1363.639] -- 0:00:46 357500 -- (-1363.070) [-1364.294] (-1366.000) (-1362.753) * (-1363.256) (-1363.962) [-1366.944] (-1365.471) -- 0:00:46 358000 -- (-1365.034) [-1367.888] (-1364.158) (-1362.967) * (-1363.946) (-1365.964) [-1365.148] (-1363.596) -- 0:00:48 358500 -- (-1364.425) (-1365.839) [-1365.298] (-1364.714) * [-1363.154] (-1364.098) (-1364.151) (-1367.231) -- 0:00:48 359000 -- [-1363.866] (-1366.405) (-1364.287) (-1362.550) * (-1363.003) [-1362.316] (-1362.890) (-1371.280) -- 0:00:48 359500 -- (-1364.931) (-1365.982) [-1363.422] (-1365.537) * (-1362.534) [-1364.323] (-1364.200) (-1363.994) -- 0:00:48 360000 -- (-1364.559) (-1366.558) [-1363.838] (-1364.643) * (-1363.105) (-1365.447) (-1365.217) [-1362.737] -- 0:00:47 Average standard deviation of split frequencies: 0.013288 360500 -- (-1364.072) (-1364.424) [-1362.885] (-1367.502) * (-1363.053) (-1365.704) [-1363.731] (-1363.585) -- 0:00:47 361000 -- (-1367.880) (-1363.731) [-1367.270] (-1367.954) * (-1362.824) [-1364.685] (-1363.706) (-1366.295) -- 0:00:47 361500 -- (-1365.997) (-1366.517) (-1366.272) [-1362.550] * [-1364.271] (-1365.443) (-1364.580) (-1364.323) -- 0:00:47 362000 -- (-1365.991) (-1362.960) [-1362.710] (-1364.355) * (-1363.784) [-1365.137] (-1363.520) (-1363.121) -- 0:00:47 362500 -- (-1365.504) (-1362.559) [-1365.226] (-1367.274) * [-1364.336] (-1368.540) (-1363.148) (-1363.344) -- 0:00:47 363000 -- (-1369.671) (-1362.559) [-1366.741] (-1364.721) * (-1363.480) (-1367.189) [-1364.257] (-1362.856) -- 0:00:47 363500 -- (-1364.089) (-1363.663) (-1367.170) [-1364.957] * [-1363.364] (-1363.610) (-1364.010) (-1365.257) -- 0:00:47 364000 -- (-1364.448) (-1364.892) (-1371.202) [-1368.703] * (-1363.847) [-1363.154] (-1363.787) (-1365.428) -- 0:00:47 364500 -- (-1364.041) [-1364.884] (-1362.810) (-1365.374) * (-1365.367) (-1365.731) [-1362.602] (-1366.469) -- 0:00:47 365000 -- (-1364.733) (-1368.756) (-1363.280) [-1363.293] * (-1363.197) (-1366.507) [-1362.633] (-1366.862) -- 0:00:46 Average standard deviation of split frequencies: 0.011520 365500 -- (-1364.899) (-1368.418) [-1363.634] (-1363.769) * [-1362.962] (-1368.940) (-1362.605) (-1367.221) -- 0:00:46 366000 -- (-1363.890) [-1363.812] (-1365.576) (-1363.827) * (-1362.250) (-1364.932) (-1362.078) [-1370.194] -- 0:00:46 366500 -- (-1364.102) [-1364.121] (-1367.528) (-1363.252) * (-1364.126) (-1366.764) (-1362.709) [-1364.766] -- 0:00:46 367000 -- (-1363.341) (-1366.124) [-1365.334] (-1365.503) * (-1364.345) (-1362.878) [-1362.517] (-1365.280) -- 0:00:46 367500 -- (-1365.431) (-1367.557) [-1365.171] (-1362.683) * (-1362.511) [-1363.703] (-1364.133) (-1370.551) -- 0:00:46 368000 -- (-1365.946) (-1365.197) [-1365.807] (-1362.701) * (-1363.956) (-1365.463) (-1364.697) [-1362.382] -- 0:00:46 368500 -- (-1363.006) (-1364.834) [-1367.167] (-1362.717) * (-1364.580) (-1362.705) [-1363.924] (-1363.047) -- 0:00:46 369000 -- (-1362.751) [-1364.955] (-1364.683) (-1362.515) * (-1365.077) (-1363.458) (-1365.251) [-1363.630] -- 0:00:46 369500 -- (-1364.159) (-1363.991) [-1363.260] (-1362.835) * (-1364.811) (-1362.981) (-1365.274) [-1363.803] -- 0:00:46 370000 -- (-1364.695) [-1363.820] (-1362.435) (-1365.378) * [-1364.494] (-1368.130) (-1364.239) (-1364.617) -- 0:00:45 Average standard deviation of split frequencies: 0.010739 370500 -- (-1363.070) (-1364.066) (-1362.424) [-1364.072] * (-1364.834) [-1362.299] (-1364.933) (-1362.337) -- 0:00:45 371000 -- (-1363.357) (-1364.062) [-1364.249] (-1363.280) * (-1365.331) [-1362.835] (-1363.165) (-1362.784) -- 0:00:45 371500 -- (-1365.258) (-1366.064) [-1363.028] (-1363.909) * (-1364.576) (-1362.162) [-1363.256] (-1362.483) -- 0:00:47 372000 -- (-1365.721) (-1365.502) (-1365.955) [-1366.066] * (-1365.390) (-1363.268) [-1363.628] (-1362.713) -- 0:00:47 372500 -- [-1365.128] (-1364.070) (-1364.117) (-1363.459) * [-1363.195] (-1362.987) (-1364.115) (-1367.821) -- 0:00:47 373000 -- (-1363.063) [-1362.512] (-1363.363) (-1363.720) * (-1368.426) (-1364.951) (-1363.846) [-1368.321] -- 0:00:47 373500 -- (-1362.938) (-1363.109) [-1365.531] (-1363.488) * [-1365.042] (-1367.980) (-1368.750) (-1364.165) -- 0:00:46 374000 -- (-1364.697) (-1364.421) (-1362.509) [-1363.370] * [-1364.498] (-1364.067) (-1364.499) (-1363.541) -- 0:00:46 374500 -- (-1365.206) (-1362.978) [-1366.300] (-1365.680) * (-1370.133) [-1367.356] (-1366.477) (-1363.102) -- 0:00:46 375000 -- (-1363.917) [-1362.014] (-1366.747) (-1362.436) * (-1363.643) (-1365.340) [-1365.093] (-1362.530) -- 0:00:46 Average standard deviation of split frequencies: 0.011423 375500 -- [-1365.349] (-1363.312) (-1364.386) (-1364.887) * (-1364.252) (-1362.732) (-1365.890) [-1366.396] -- 0:00:46 376000 -- (-1364.680) [-1363.061] (-1363.507) (-1363.507) * (-1363.680) (-1362.926) (-1363.097) [-1366.307] -- 0:00:46 376500 -- (-1362.194) (-1363.063) (-1368.677) [-1363.282] * (-1366.261) [-1363.077] (-1366.441) (-1363.287) -- 0:00:46 377000 -- [-1363.935] (-1362.138) (-1368.193) (-1365.796) * (-1365.825) (-1363.878) [-1365.877] (-1362.437) -- 0:00:46 377500 -- (-1365.470) [-1363.730] (-1366.728) (-1365.037) * (-1364.776) [-1364.937] (-1366.999) (-1362.437) -- 0:00:46 378000 -- (-1365.862) (-1364.805) (-1365.969) [-1364.110] * (-1363.561) (-1366.578) [-1362.589] (-1362.504) -- 0:00:46 378500 -- (-1366.136) (-1364.695) (-1363.205) [-1363.311] * (-1364.524) [-1363.857] (-1363.206) (-1362.546) -- 0:00:45 379000 -- [-1363.598] (-1365.170) (-1364.209) (-1364.023) * (-1363.026) (-1362.487) (-1363.728) [-1363.733] -- 0:00:45 379500 -- (-1364.262) (-1363.383) (-1365.076) [-1366.242] * (-1364.245) (-1362.974) [-1362.884] (-1366.002) -- 0:00:45 380000 -- [-1365.134] (-1364.146) (-1362.527) (-1363.695) * [-1363.194] (-1363.429) (-1369.451) (-1365.328) -- 0:00:45 Average standard deviation of split frequencies: 0.013039 380500 -- (-1366.585) (-1363.806) (-1363.387) [-1364.352] * (-1363.999) (-1365.490) (-1363.300) [-1363.573] -- 0:00:45 381000 -- (-1363.645) (-1366.828) (-1364.632) [-1362.808] * (-1364.220) (-1364.616) [-1362.942] (-1368.795) -- 0:00:45 381500 -- [-1365.411] (-1365.123) (-1364.327) (-1364.736) * (-1363.867) (-1366.944) [-1363.450] (-1362.681) -- 0:00:45 382000 -- (-1361.995) (-1365.076) (-1365.414) [-1364.938] * (-1364.402) (-1368.156) (-1364.952) [-1365.681] -- 0:00:45 382500 -- (-1362.331) [-1365.951] (-1363.730) (-1363.235) * (-1363.071) (-1367.267) (-1362.673) [-1366.013] -- 0:00:45 383000 -- [-1363.748] (-1362.728) (-1362.331) (-1363.938) * (-1363.591) (-1363.822) [-1363.430] (-1366.050) -- 0:00:45 383500 -- (-1363.819) (-1362.739) (-1364.504) [-1364.871] * (-1363.272) (-1363.322) (-1364.269) [-1365.278] -- 0:00:45 384000 -- (-1366.963) (-1363.357) [-1364.072] (-1362.831) * (-1363.908) (-1363.102) (-1362.412) [-1363.973] -- 0:00:44 384500 -- [-1363.419] (-1365.075) (-1365.328) (-1362.062) * (-1369.864) (-1363.920) (-1366.717) [-1364.004] -- 0:00:44 385000 -- (-1368.489) (-1364.909) (-1365.405) [-1362.063] * (-1362.674) (-1362.512) (-1364.347) [-1366.720] -- 0:00:46 Average standard deviation of split frequencies: 0.012500 385500 -- (-1366.577) (-1366.768) [-1363.775] (-1363.240) * (-1363.683) (-1363.139) (-1365.966) [-1365.901] -- 0:00:46 386000 -- (-1365.853) [-1368.411] (-1362.914) (-1363.855) * (-1362.156) (-1365.316) (-1366.266) [-1363.453] -- 0:00:46 386500 -- (-1362.740) (-1364.358) [-1363.130] (-1364.070) * (-1369.089) (-1363.552) (-1369.616) [-1365.459] -- 0:00:46 387000 -- (-1363.505) [-1364.347] (-1365.626) (-1364.019) * (-1366.503) (-1364.705) (-1366.793) [-1367.767] -- 0:00:45 387500 -- (-1364.004) [-1364.027] (-1364.117) (-1363.491) * (-1366.657) [-1363.052] (-1363.559) (-1365.516) -- 0:00:45 388000 -- [-1363.008] (-1363.631) (-1363.258) (-1365.029) * (-1363.691) (-1363.811) [-1364.183] (-1365.205) -- 0:00:45 388500 -- (-1368.292) [-1364.285] (-1364.657) (-1362.523) * (-1363.691) [-1362.963] (-1362.896) (-1363.706) -- 0:00:45 389000 -- [-1367.582] (-1363.717) (-1367.550) (-1367.003) * [-1362.985] (-1362.460) (-1362.984) (-1364.587) -- 0:00:45 389500 -- [-1364.922] (-1364.603) (-1366.336) (-1364.682) * (-1363.604) (-1363.696) (-1363.833) [-1362.640] -- 0:00:45 390000 -- (-1366.886) (-1364.124) (-1362.334) [-1363.041] * (-1363.373) (-1365.005) (-1363.027) [-1363.702] -- 0:00:45 Average standard deviation of split frequencies: 0.012564 390500 -- (-1363.907) (-1370.073) (-1362.732) [-1364.289] * (-1363.590) (-1363.775) [-1362.808] (-1362.117) -- 0:00:45 391000 -- (-1363.329) (-1363.545) (-1365.933) [-1362.425] * (-1364.246) [-1363.429] (-1366.321) (-1362.865) -- 0:00:45 391500 -- [-1362.412] (-1370.376) (-1363.785) (-1362.882) * (-1365.889) [-1362.103] (-1362.242) (-1365.895) -- 0:00:45 392000 -- [-1364.031] (-1364.002) (-1363.795) (-1367.111) * (-1362.775) (-1362.110) [-1363.945] (-1367.897) -- 0:00:44 392500 -- [-1362.913] (-1364.577) (-1365.003) (-1365.728) * (-1362.699) (-1367.066) [-1364.749] (-1365.801) -- 0:00:44 393000 -- (-1365.724) (-1363.587) (-1364.706) [-1368.771] * [-1363.074] (-1367.113) (-1366.237) (-1367.112) -- 0:00:44 393500 -- (-1365.294) [-1362.946] (-1363.436) (-1363.614) * (-1363.369) [-1364.675] (-1363.315) (-1363.436) -- 0:00:44 394000 -- [-1364.412] (-1365.256) (-1364.858) (-1362.885) * (-1363.805) [-1363.600] (-1362.431) (-1362.870) -- 0:00:44 394500 -- (-1363.749) (-1367.195) [-1362.351] (-1367.104) * [-1363.889] (-1367.539) (-1362.431) (-1363.633) -- 0:00:44 395000 -- [-1366.664] (-1368.806) (-1362.987) (-1365.024) * (-1363.519) [-1367.142] (-1362.251) (-1364.574) -- 0:00:44 Average standard deviation of split frequencies: 0.011904 395500 -- (-1366.155) (-1368.215) (-1366.279) [-1366.671] * [-1365.111] (-1367.146) (-1362.841) (-1365.494) -- 0:00:44 396000 -- [-1367.792] (-1365.916) (-1370.260) (-1363.472) * (-1364.140) (-1365.493) [-1362.560] (-1365.619) -- 0:00:44 396500 -- (-1368.606) [-1364.973] (-1365.450) (-1363.441) * (-1365.670) (-1364.652) (-1364.698) [-1363.386] -- 0:00:44 397000 -- (-1366.034) [-1363.088] (-1365.807) (-1366.129) * [-1364.561] (-1365.501) (-1368.653) (-1362.671) -- 0:00:44 397500 -- (-1364.707) (-1362.787) (-1365.251) [-1363.781] * [-1363.358] (-1366.500) (-1367.431) (-1363.822) -- 0:00:43 398000 -- (-1364.104) (-1369.501) [-1363.715] (-1363.382) * [-1363.511] (-1365.095) (-1364.510) (-1363.427) -- 0:00:43 398500 -- (-1364.573) [-1367.676] (-1364.651) (-1365.392) * (-1365.234) [-1363.007] (-1367.142) (-1363.632) -- 0:00:45 399000 -- (-1364.779) (-1365.915) (-1364.775) [-1365.779] * [-1363.185] (-1364.273) (-1366.553) (-1363.339) -- 0:00:45 399500 -- (-1366.748) (-1366.881) [-1364.740] (-1365.037) * (-1364.141) (-1366.319) (-1365.307) [-1363.325] -- 0:00:45 400000 -- [-1362.900] (-1365.771) (-1363.568) (-1365.253) * (-1364.113) (-1366.031) (-1366.611) [-1362.961] -- 0:00:44 Average standard deviation of split frequencies: 0.013150 400500 -- (-1364.201) (-1364.526) (-1368.855) [-1363.617] * (-1363.088) (-1368.323) [-1367.508] (-1363.640) -- 0:00:44 401000 -- (-1363.129) [-1362.315] (-1363.079) (-1367.050) * (-1363.457) (-1367.341) [-1363.125] (-1362.707) -- 0:00:44 401500 -- (-1363.463) (-1363.071) (-1363.182) [-1366.470] * (-1363.060) [-1363.056] (-1363.361) (-1363.503) -- 0:00:44 402000 -- (-1363.297) (-1364.596) (-1363.085) [-1363.430] * (-1363.172) [-1363.636] (-1364.807) (-1363.299) -- 0:00:44 402500 -- (-1362.698) [-1362.449] (-1366.469) (-1366.553) * (-1374.046) (-1363.385) [-1363.624] (-1363.220) -- 0:00:44 403000 -- (-1367.851) (-1362.504) (-1368.081) [-1367.545] * (-1363.112) (-1366.967) (-1362.395) [-1364.284] -- 0:00:44 403500 -- [-1363.177] (-1362.455) (-1365.129) (-1365.909) * (-1362.852) (-1362.519) (-1364.254) [-1363.798] -- 0:00:44 404000 -- (-1363.267) [-1362.358] (-1364.727) (-1364.253) * (-1362.975) [-1363.155] (-1365.702) (-1362.443) -- 0:00:44 404500 -- [-1364.037] (-1366.121) (-1364.367) (-1363.826) * (-1362.996) (-1363.909) [-1362.946] (-1365.287) -- 0:00:44 405000 -- (-1364.556) (-1363.297) [-1363.694] (-1365.847) * (-1366.218) (-1362.689) (-1362.850) [-1364.638] -- 0:00:44 Average standard deviation of split frequencies: 0.013804 405500 -- (-1364.954) (-1364.264) (-1366.563) [-1363.164] * (-1363.785) (-1363.482) [-1363.429] (-1366.396) -- 0:00:43 406000 -- (-1362.867) [-1363.202] (-1366.180) (-1366.328) * (-1366.778) [-1363.620] (-1362.380) (-1363.899) -- 0:00:43 406500 -- (-1363.939) (-1364.034) [-1366.008] (-1365.405) * [-1363.635] (-1364.055) (-1366.298) (-1364.205) -- 0:00:43 407000 -- (-1365.721) (-1363.062) [-1362.895] (-1363.110) * [-1366.188] (-1366.031) (-1367.574) (-1366.655) -- 0:00:43 407500 -- (-1364.742) [-1366.875] (-1363.119) (-1362.180) * (-1364.270) [-1363.062] (-1365.859) (-1363.189) -- 0:00:43 408000 -- (-1365.587) (-1363.747) (-1364.198) [-1362.685] * (-1365.074) (-1362.971) [-1370.754] (-1362.437) -- 0:00:43 408500 -- (-1364.190) (-1364.049) [-1366.385] (-1364.895) * (-1366.763) (-1363.139) [-1364.194] (-1367.507) -- 0:00:43 409000 -- [-1363.256] (-1364.141) (-1366.829) (-1366.229) * (-1364.083) (-1363.609) (-1364.865) [-1363.310] -- 0:00:43 409500 -- [-1364.540] (-1365.472) (-1366.436) (-1365.919) * (-1365.814) [-1362.130] (-1363.732) (-1362.865) -- 0:00:43 410000 -- (-1363.870) (-1363.226) [-1364.422] (-1363.821) * (-1364.158) (-1369.171) [-1363.724] (-1363.321) -- 0:00:43 Average standard deviation of split frequencies: 0.014585 410500 -- [-1363.041] (-1363.075) (-1363.785) (-1365.086) * (-1364.562) [-1363.073] (-1362.119) (-1363.594) -- 0:00:43 411000 -- [-1362.552] (-1367.952) (-1368.620) (-1364.059) * (-1362.726) (-1364.738) (-1362.386) [-1364.820] -- 0:00:42 411500 -- (-1361.988) [-1365.506] (-1367.603) (-1364.965) * (-1362.083) [-1365.336] (-1364.825) (-1365.060) -- 0:00:44 412000 -- (-1366.006) [-1368.180] (-1367.606) (-1366.495) * (-1364.654) (-1365.903) [-1366.586] (-1364.549) -- 0:00:44 412500 -- [-1362.514] (-1368.919) (-1364.507) (-1365.434) * (-1363.126) [-1362.548] (-1366.804) (-1362.449) -- 0:00:44 413000 -- (-1372.054) (-1363.067) (-1365.641) [-1365.441] * [-1365.647] (-1362.779) (-1368.880) (-1364.661) -- 0:00:44 413500 -- [-1365.143] (-1362.597) (-1361.978) (-1362.744) * [-1362.020] (-1366.629) (-1365.819) (-1364.066) -- 0:00:43 414000 -- [-1363.904] (-1362.859) (-1361.994) (-1362.651) * (-1365.625) (-1366.629) [-1362.738] (-1366.114) -- 0:00:43 414500 -- (-1363.635) [-1363.818] (-1363.986) (-1363.065) * [-1367.233] (-1366.633) (-1362.785) (-1367.017) -- 0:00:43 415000 -- [-1365.227] (-1362.804) (-1365.077) (-1363.760) * [-1363.484] (-1363.133) (-1363.808) (-1368.476) -- 0:00:43 Average standard deviation of split frequencies: 0.013998 415500 -- [-1364.492] (-1364.627) (-1364.102) (-1368.723) * (-1363.380) (-1362.411) [-1366.393] (-1366.514) -- 0:00:43 416000 -- (-1364.692) (-1364.873) (-1362.867) [-1362.526] * (-1363.371) (-1362.411) [-1364.120] (-1363.964) -- 0:00:43 416500 -- (-1365.500) [-1365.726] (-1362.667) (-1362.746) * (-1367.351) (-1366.492) (-1364.514) [-1363.912] -- 0:00:43 417000 -- (-1362.598) (-1367.288) [-1363.767] (-1366.095) * (-1365.945) (-1364.912) [-1366.621] (-1362.732) -- 0:00:43 417500 -- (-1364.996) (-1363.412) [-1363.173] (-1362.332) * [-1365.112] (-1366.228) (-1366.464) (-1365.113) -- 0:00:43 418000 -- (-1365.326) (-1364.018) (-1364.069) [-1364.448] * (-1364.986) [-1363.051] (-1366.198) (-1368.071) -- 0:00:43 418500 -- [-1363.996] (-1364.763) (-1362.529) (-1364.346) * (-1363.144) (-1363.008) [-1362.930] (-1365.228) -- 0:00:43 419000 -- (-1363.899) [-1366.312] (-1362.401) (-1364.301) * (-1364.470) (-1364.533) (-1365.239) [-1364.636] -- 0:00:42 419500 -- (-1363.868) (-1364.624) [-1363.967] (-1362.719) * (-1362.620) (-1365.064) (-1365.200) [-1364.471] -- 0:00:42 420000 -- (-1364.507) (-1364.558) (-1363.631) [-1365.115] * (-1362.987) (-1365.219) [-1364.720] (-1364.194) -- 0:00:42 Average standard deviation of split frequencies: 0.014568 420500 -- (-1367.837) [-1362.369] (-1364.008) (-1363.923) * (-1363.373) (-1367.001) (-1369.117) [-1363.498] -- 0:00:42 421000 -- (-1362.788) (-1364.612) [-1364.393] (-1368.719) * (-1362.720) (-1365.366) [-1363.267] (-1363.225) -- 0:00:42 421500 -- (-1364.956) (-1370.169) [-1364.701] (-1364.437) * (-1362.505) (-1366.186) [-1362.593] (-1363.395) -- 0:00:42 422000 -- (-1367.798) (-1367.367) [-1365.312] (-1362.372) * (-1365.397) (-1365.774) (-1363.951) [-1363.587] -- 0:00:42 422500 -- (-1367.136) [-1364.102] (-1364.173) (-1363.096) * (-1363.926) [-1364.145] (-1364.457) (-1362.833) -- 0:00:42 423000 -- [-1366.147] (-1366.083) (-1363.949) (-1364.772) * (-1364.697) (-1365.125) (-1365.176) [-1363.472] -- 0:00:42 423500 -- [-1362.429] (-1369.103) (-1363.892) (-1365.915) * [-1364.434] (-1366.971) (-1363.726) (-1365.602) -- 0:00:42 424000 -- [-1365.696] (-1367.342) (-1363.679) (-1362.541) * (-1363.659) [-1367.697] (-1364.566) (-1367.692) -- 0:00:42 424500 -- (-1364.640) (-1363.826) (-1364.231) [-1362.440] * (-1366.635) [-1363.292] (-1363.953) (-1364.930) -- 0:00:43 425000 -- [-1364.805] (-1365.589) (-1364.442) (-1362.439) * (-1368.390) (-1365.811) [-1362.900] (-1365.496) -- 0:00:43 Average standard deviation of split frequencies: 0.014631 425500 -- [-1362.269] (-1363.440) (-1365.205) (-1362.793) * (-1364.781) [-1366.377] (-1364.108) (-1363.476) -- 0:00:43 426000 -- [-1364.280] (-1366.359) (-1366.285) (-1362.933) * (-1364.285) (-1365.952) (-1363.775) [-1363.809] -- 0:00:43 426500 -- [-1363.330] (-1362.625) (-1364.614) (-1365.637) * (-1363.691) (-1366.425) [-1363.144] (-1363.919) -- 0:00:43 427000 -- (-1362.381) (-1364.190) (-1363.300) [-1367.590] * (-1363.968) (-1365.074) (-1363.258) [-1365.142] -- 0:00:42 427500 -- (-1364.062) (-1362.937) [-1366.746] (-1365.140) * [-1364.107] (-1364.156) (-1364.022) (-1372.225) -- 0:00:42 428000 -- (-1363.126) (-1362.573) (-1363.843) [-1367.637] * (-1366.888) [-1361.960] (-1366.810) (-1366.372) -- 0:00:42 428500 -- (-1362.833) (-1363.864) [-1362.226] (-1365.668) * (-1373.095) (-1364.069) [-1362.474] (-1365.062) -- 0:00:42 429000 -- (-1365.752) (-1366.614) (-1364.218) [-1363.343] * (-1363.681) [-1362.165] (-1363.092) (-1366.079) -- 0:00:42 429500 -- (-1365.171) (-1363.882) [-1366.168] (-1365.011) * (-1363.725) [-1363.133] (-1364.498) (-1366.442) -- 0:00:42 430000 -- [-1362.872] (-1363.975) (-1365.269) (-1366.804) * (-1363.197) (-1363.904) [-1364.630] (-1363.649) -- 0:00:42 Average standard deviation of split frequencies: 0.015260 430500 -- [-1364.199] (-1363.887) (-1363.264) (-1369.086) * (-1365.844) [-1365.610] (-1365.855) (-1364.310) -- 0:00:42 431000 -- (-1366.282) (-1362.934) (-1364.728) [-1362.610] * (-1365.534) (-1365.256) [-1362.269] (-1366.743) -- 0:00:42 431500 -- [-1365.152] (-1363.914) (-1365.398) (-1364.501) * (-1364.087) (-1363.734) (-1363.277) [-1364.028] -- 0:00:42 432000 -- (-1365.041) (-1365.179) [-1366.606] (-1362.748) * (-1362.213) (-1365.379) [-1363.861] (-1363.692) -- 0:00:42 432500 -- (-1363.259) (-1368.494) [-1366.349] (-1364.795) * (-1365.958) (-1365.385) [-1365.796] (-1365.008) -- 0:00:41 433000 -- (-1361.902) [-1364.555] (-1364.003) (-1363.790) * (-1367.024) (-1362.609) [-1367.206] (-1365.455) -- 0:00:41 433500 -- (-1362.856) (-1363.503) (-1365.252) [-1364.396] * (-1366.936) [-1362.578] (-1363.847) (-1366.539) -- 0:00:41 434000 -- (-1362.280) [-1366.006] (-1364.056) (-1363.310) * (-1364.964) (-1362.571) (-1368.889) [-1364.002] -- 0:00:41 434500 -- [-1362.449] (-1363.265) (-1364.008) (-1362.826) * (-1364.861) (-1362.709) [-1363.646] (-1363.968) -- 0:00:41 435000 -- (-1367.380) [-1365.054] (-1363.916) (-1364.491) * (-1364.249) [-1362.871] (-1363.297) (-1362.713) -- 0:00:41 Average standard deviation of split frequencies: 0.014692 435500 -- [-1364.984] (-1363.348) (-1362.993) (-1365.166) * [-1364.055] (-1362.484) (-1363.546) (-1363.516) -- 0:00:41 436000 -- (-1365.251) [-1363.479] (-1363.815) (-1365.259) * [-1370.931] (-1362.651) (-1365.364) (-1363.135) -- 0:00:41 436500 -- [-1367.335] (-1362.257) (-1366.838) (-1362.844) * (-1368.176) [-1364.186] (-1363.942) (-1363.628) -- 0:00:41 437000 -- [-1365.568] (-1363.561) (-1366.990) (-1364.782) * (-1367.502) [-1363.265] (-1366.121) (-1362.669) -- 0:00:41 437500 -- [-1366.174] (-1363.936) (-1369.409) (-1367.482) * (-1365.480) (-1363.858) (-1368.412) [-1365.553] -- 0:00:42 438000 -- (-1363.529) (-1364.460) [-1367.169] (-1367.492) * (-1364.904) (-1365.052) [-1362.865] (-1365.677) -- 0:00:42 438500 -- (-1363.471) [-1362.601] (-1364.895) (-1363.356) * (-1363.882) (-1365.453) [-1362.812] (-1368.298) -- 0:00:42 439000 -- (-1363.127) (-1364.000) (-1366.147) [-1362.742] * (-1365.980) (-1364.568) (-1365.318) [-1364.367] -- 0:00:42 439500 -- (-1365.496) [-1363.424] (-1364.877) (-1365.187) * (-1365.666) (-1364.321) [-1362.618] (-1367.620) -- 0:00:42 440000 -- [-1362.073] (-1363.418) (-1367.335) (-1369.545) * (-1364.311) (-1363.403) [-1363.539] (-1366.773) -- 0:00:41 Average standard deviation of split frequencies: 0.014599 440500 -- (-1364.214) (-1364.442) [-1365.883] (-1368.066) * [-1363.903] (-1365.740) (-1364.409) (-1366.296) -- 0:00:41 441000 -- [-1364.393] (-1365.374) (-1362.801) (-1367.327) * (-1364.336) [-1364.006] (-1364.061) (-1364.373) -- 0:00:41 441500 -- (-1364.709) (-1365.611) (-1364.901) [-1366.179] * [-1365.450] (-1362.922) (-1364.427) (-1362.684) -- 0:00:41 442000 -- (-1363.873) [-1362.093] (-1365.974) (-1368.509) * (-1365.314) (-1364.397) (-1365.755) [-1364.124] -- 0:00:41 442500 -- [-1364.971] (-1365.505) (-1362.754) (-1366.535) * (-1363.231) (-1365.637) [-1364.520] (-1364.184) -- 0:00:41 443000 -- [-1363.052] (-1368.404) (-1364.017) (-1366.170) * (-1363.194) [-1365.186] (-1366.324) (-1366.693) -- 0:00:41 443500 -- [-1362.584] (-1362.645) (-1365.506) (-1365.577) * (-1364.050) [-1363.501] (-1363.967) (-1362.894) -- 0:00:41 444000 -- (-1363.633) [-1362.731] (-1364.827) (-1365.355) * (-1368.989) (-1366.315) (-1363.611) [-1367.852] -- 0:00:41 444500 -- [-1363.707] (-1366.190) (-1362.990) (-1365.516) * [-1362.708] (-1365.035) (-1366.402) (-1368.871) -- 0:00:41 445000 -- (-1365.730) (-1364.655) [-1363.495] (-1365.448) * [-1363.786] (-1363.360) (-1363.680) (-1367.766) -- 0:00:41 Average standard deviation of split frequencies: 0.013865 445500 -- (-1364.416) (-1367.163) [-1364.013] (-1363.124) * (-1363.809) (-1363.733) [-1363.056] (-1365.209) -- 0:00:41 446000 -- (-1364.987) [-1364.080] (-1362.801) (-1363.416) * [-1363.213] (-1365.553) (-1363.706) (-1362.823) -- 0:00:40 446500 -- (-1369.700) [-1362.501] (-1367.456) (-1362.503) * [-1363.117] (-1364.945) (-1363.291) (-1362.078) -- 0:00:40 447000 -- [-1365.003] (-1363.520) (-1369.109) (-1365.800) * (-1365.084) [-1366.936] (-1364.368) (-1362.223) -- 0:00:40 447500 -- [-1364.759] (-1363.685) (-1364.211) (-1364.489) * (-1364.458) [-1365.309] (-1363.379) (-1366.704) -- 0:00:40 448000 -- (-1366.352) (-1366.113) (-1363.991) [-1364.828] * (-1366.303) (-1372.572) [-1364.039] (-1365.030) -- 0:00:40 448500 -- (-1363.338) (-1363.244) [-1363.986] (-1364.244) * [-1365.428] (-1371.127) (-1363.794) (-1364.248) -- 0:00:40 449000 -- (-1363.194) (-1367.812) [-1364.674] (-1364.179) * (-1365.376) (-1365.437) (-1365.274) [-1363.339] -- 0:00:40 449500 -- [-1363.503] (-1364.233) (-1363.175) (-1366.201) * (-1365.327) [-1367.435] (-1363.880) (-1362.664) -- 0:00:40 450000 -- (-1364.338) (-1366.612) (-1365.697) [-1364.009] * (-1366.404) [-1363.041] (-1362.547) (-1365.816) -- 0:00:40 Average standard deviation of split frequencies: 0.014152 450500 -- [-1364.122] (-1364.836) (-1364.703) (-1364.317) * (-1364.233) (-1364.241) [-1363.580] (-1364.958) -- 0:00:40 451000 -- [-1368.101] (-1362.682) (-1365.636) (-1363.732) * (-1364.277) (-1367.880) (-1363.529) [-1363.570] -- 0:00:41 451500 -- (-1364.335) (-1362.042) (-1364.122) [-1362.584] * (-1365.165) (-1364.655) [-1364.534] (-1364.544) -- 0:00:41 452000 -- (-1366.224) (-1364.709) (-1364.481) [-1363.468] * (-1364.888) [-1367.516] (-1362.907) (-1366.747) -- 0:00:41 452500 -- (-1366.414) (-1365.119) [-1367.816] (-1370.418) * [-1367.200] (-1367.407) (-1364.920) (-1363.198) -- 0:00:41 453000 -- [-1364.587] (-1362.906) (-1365.703) (-1363.360) * (-1363.739) (-1367.496) (-1364.021) [-1363.202] -- 0:00:41 453500 -- [-1364.021] (-1362.700) (-1365.185) (-1363.715) * (-1364.159) (-1366.139) (-1364.067) [-1365.349] -- 0:00:40 454000 -- (-1362.954) (-1365.743) (-1371.323) [-1363.132] * (-1364.962) [-1364.446] (-1362.374) (-1366.031) -- 0:00:40 454500 -- [-1362.574] (-1362.952) (-1368.288) (-1366.924) * (-1365.419) (-1366.087) [-1364.523] (-1365.221) -- 0:00:40 455000 -- [-1362.397] (-1363.105) (-1364.327) (-1368.158) * (-1365.027) (-1364.570) (-1363.205) [-1363.715] -- 0:00:40 Average standard deviation of split frequencies: 0.012649 455500 -- (-1363.388) (-1363.255) (-1364.367) [-1364.621] * (-1364.265) [-1366.023] (-1363.434) (-1364.315) -- 0:00:40 456000 -- (-1363.686) (-1364.700) [-1362.660] (-1363.223) * (-1362.355) (-1363.834) (-1363.220) [-1364.120] -- 0:00:40 456500 -- (-1367.525) (-1365.137) (-1366.739) [-1363.160] * (-1369.944) (-1362.948) (-1363.450) [-1363.754] -- 0:00:40 457000 -- (-1364.679) [-1363.556] (-1368.067) (-1362.923) * (-1367.874) (-1363.838) [-1365.689] (-1364.849) -- 0:00:40 457500 -- (-1364.572) (-1365.066) [-1365.129] (-1363.482) * [-1368.072] (-1364.444) (-1363.531) (-1364.146) -- 0:00:40 458000 -- (-1365.231) (-1364.447) [-1363.286] (-1365.575) * (-1368.302) [-1362.817] (-1362.410) (-1365.952) -- 0:00:40 458500 -- (-1363.774) (-1371.686) (-1365.745) [-1364.294] * (-1365.313) (-1363.651) [-1362.984] (-1362.879) -- 0:00:40 459000 -- (-1367.235) (-1362.793) [-1364.194] (-1362.199) * (-1366.955) [-1366.850] (-1363.019) (-1364.364) -- 0:00:40 459500 -- [-1363.271] (-1365.668) (-1363.826) (-1362.262) * (-1363.784) (-1367.915) (-1363.684) [-1364.052] -- 0:00:39 460000 -- (-1364.278) (-1363.348) [-1363.229] (-1362.255) * (-1365.695) (-1366.311) [-1362.858] (-1364.217) -- 0:00:39 Average standard deviation of split frequencies: 0.012821 460500 -- (-1363.151) (-1362.123) (-1364.776) [-1363.948] * (-1365.645) (-1368.043) (-1364.077) [-1363.641] -- 0:00:39 461000 -- (-1366.835) (-1362.123) (-1366.692) [-1362.761] * (-1366.685) (-1370.177) (-1365.467) [-1363.727] -- 0:00:39 461500 -- (-1365.274) [-1362.162] (-1367.265) (-1365.951) * (-1367.490) (-1367.662) [-1363.334] (-1364.362) -- 0:00:39 462000 -- [-1363.027] (-1363.226) (-1367.874) (-1363.031) * [-1363.881] (-1369.291) (-1363.995) (-1365.572) -- 0:00:39 462500 -- (-1363.149) (-1367.484) (-1365.751) [-1362.401] * (-1363.265) (-1366.329) [-1363.568] (-1365.729) -- 0:00:39 463000 -- (-1365.390) (-1365.351) (-1364.948) [-1362.911] * (-1362.665) (-1363.353) (-1363.293) [-1365.370] -- 0:00:39 463500 -- [-1363.043] (-1362.980) (-1362.715) (-1366.184) * (-1362.989) (-1363.847) (-1363.081) [-1365.083] -- 0:00:39 464000 -- (-1366.680) (-1362.396) (-1363.202) [-1366.569] * (-1362.665) (-1369.577) (-1362.652) [-1364.089] -- 0:00:40 464500 -- (-1364.672) [-1363.162] (-1362.615) (-1365.843) * (-1364.356) [-1362.757] (-1362.674) (-1364.812) -- 0:00:40 465000 -- (-1365.329) [-1364.321] (-1365.751) (-1365.532) * [-1364.114] (-1362.545) (-1364.317) (-1366.455) -- 0:00:40 Average standard deviation of split frequencies: 0.012496 465500 -- (-1365.834) (-1364.123) [-1362.484] (-1364.997) * (-1363.825) [-1363.093] (-1363.811) (-1361.932) -- 0:00:40 466000 -- (-1365.382) (-1362.684) (-1363.445) [-1364.479] * (-1363.179) (-1364.740) [-1363.913] (-1362.087) -- 0:00:40 466500 -- (-1364.309) (-1365.242) [-1366.507] (-1370.564) * (-1364.975) (-1365.426) (-1363.949) [-1363.700] -- 0:00:40 467000 -- (-1368.288) [-1363.975] (-1362.838) (-1368.596) * (-1364.570) (-1363.421) (-1362.419) [-1363.776] -- 0:00:39 467500 -- (-1364.633) [-1364.487] (-1364.451) (-1366.860) * (-1362.328) (-1362.997) [-1364.998] (-1365.170) -- 0:00:39 468000 -- (-1363.698) (-1364.574) (-1365.535) [-1364.809] * (-1363.122) [-1362.362] (-1367.406) (-1363.846) -- 0:00:39 468500 -- [-1365.059] (-1365.026) (-1362.838) (-1363.862) * (-1363.370) (-1362.713) (-1368.327) [-1362.856] -- 0:00:39 469000 -- (-1365.598) (-1364.665) (-1364.797) [-1363.866] * (-1364.720) (-1365.059) (-1367.184) [-1363.227] -- 0:00:39 469500 -- [-1366.359] (-1364.548) (-1364.612) (-1366.743) * (-1362.476) (-1371.541) (-1364.249) [-1363.836] -- 0:00:39 470000 -- (-1365.521) [-1364.119] (-1364.082) (-1364.619) * (-1362.417) (-1364.125) (-1364.620) [-1362.836] -- 0:00:39 Average standard deviation of split frequencies: 0.012313 470500 -- [-1370.949] (-1366.325) (-1362.944) (-1364.201) * (-1362.556) (-1366.466) (-1366.682) [-1363.286] -- 0:00:39 471000 -- (-1365.871) [-1368.163] (-1362.185) (-1367.274) * [-1364.427] (-1364.561) (-1366.628) (-1362.840) -- 0:00:39 471500 -- (-1366.732) (-1363.980) (-1366.432) [-1366.325] * (-1369.741) [-1363.630] (-1364.369) (-1363.501) -- 0:00:39 472000 -- (-1365.609) (-1364.950) [-1362.782] (-1363.337) * [-1363.660] (-1364.583) (-1368.556) (-1363.613) -- 0:00:39 472500 -- [-1362.416] (-1363.150) (-1363.819) (-1364.526) * (-1363.078) (-1365.734) (-1370.480) [-1363.975] -- 0:00:39 473000 -- [-1364.966] (-1362.969) (-1364.305) (-1363.055) * (-1364.344) [-1363.383] (-1362.735) (-1363.212) -- 0:00:38 473500 -- (-1365.348) (-1364.653) (-1364.840) [-1362.264] * [-1362.413] (-1363.561) (-1364.282) (-1362.176) -- 0:00:38 474000 -- (-1365.629) (-1365.118) (-1363.924) [-1367.556] * (-1362.763) (-1363.419) (-1366.181) [-1362.136] -- 0:00:38 474500 -- (-1365.214) (-1365.590) (-1363.562) [-1363.353] * (-1364.596) [-1362.743] (-1364.624) (-1365.728) -- 0:00:38 475000 -- (-1363.460) (-1367.125) (-1364.659) [-1365.181] * (-1367.367) [-1363.475] (-1363.001) (-1367.142) -- 0:00:38 Average standard deviation of split frequencies: 0.012175 475500 -- [-1364.438] (-1363.851) (-1365.403) (-1362.325) * (-1364.851) (-1367.252) [-1367.450] (-1369.569) -- 0:00:38 476000 -- (-1364.490) (-1364.526) (-1362.159) [-1364.244] * (-1363.036) (-1365.211) (-1363.824) [-1367.084] -- 0:00:38 476500 -- (-1365.587) [-1364.616] (-1363.508) (-1364.712) * (-1363.013) [-1366.494] (-1362.145) (-1366.464) -- 0:00:38 477000 -- (-1365.101) (-1370.456) (-1364.268) [-1363.203] * [-1363.406] (-1367.558) (-1364.274) (-1364.226) -- 0:00:39 477500 -- (-1364.882) [-1363.001] (-1362.894) (-1363.844) * (-1366.093) (-1368.956) [-1364.873] (-1364.496) -- 0:00:39 478000 -- [-1364.949] (-1367.378) (-1363.474) (-1364.065) * (-1365.563) (-1365.322) (-1366.433) [-1365.385] -- 0:00:39 478500 -- [-1364.046] (-1366.583) (-1365.797) (-1364.678) * [-1363.397] (-1363.013) (-1363.930) (-1365.353) -- 0:00:39 479000 -- (-1365.855) [-1364.305] (-1365.085) (-1365.542) * (-1364.402) [-1364.125] (-1363.039) (-1363.641) -- 0:00:39 479500 -- (-1362.998) (-1364.495) (-1365.294) [-1364.233] * (-1365.889) (-1365.160) (-1362.803) [-1363.215] -- 0:00:39 480000 -- (-1362.823) (-1365.280) [-1363.565] (-1368.087) * (-1364.431) [-1364.621] (-1363.772) (-1363.094) -- 0:00:39 Average standard deviation of split frequencies: 0.013153 480500 -- [-1362.439] (-1365.618) (-1364.479) (-1362.822) * (-1362.646) (-1364.340) (-1366.081) [-1366.495] -- 0:00:38 481000 -- [-1364.602] (-1364.444) (-1366.308) (-1363.076) * (-1364.112) (-1362.775) [-1365.133] (-1365.711) -- 0:00:38 481500 -- (-1365.460) [-1363.740] (-1362.910) (-1362.929) * (-1364.273) (-1371.904) (-1364.999) [-1368.662] -- 0:00:38 482000 -- (-1365.391) (-1365.351) (-1362.955) [-1366.293] * [-1370.883] (-1375.995) (-1363.256) (-1363.946) -- 0:00:38 482500 -- [-1364.696] (-1363.217) (-1365.179) (-1362.722) * (-1373.050) [-1364.894] (-1365.747) (-1365.872) -- 0:00:38 483000 -- (-1363.057) (-1362.959) (-1365.043) [-1363.287] * (-1373.590) (-1364.110) (-1364.467) [-1365.207] -- 0:00:38 483500 -- (-1362.713) (-1364.759) (-1365.796) [-1364.030] * (-1362.494) [-1363.585] (-1365.170) (-1365.056) -- 0:00:38 484000 -- (-1362.877) (-1363.897) [-1366.083] (-1363.241) * (-1362.607) [-1365.640] (-1363.483) (-1365.328) -- 0:00:38 484500 -- (-1363.240) (-1365.749) [-1363.466] (-1362.933) * [-1363.547] (-1366.253) (-1366.443) (-1363.190) -- 0:00:38 485000 -- [-1364.203] (-1365.203) (-1367.315) (-1362.833) * (-1363.216) (-1365.496) [-1363.502] (-1366.134) -- 0:00:38 Average standard deviation of split frequencies: 0.012724 485500 -- (-1363.775) (-1363.256) (-1362.462) [-1363.533] * (-1363.307) (-1364.043) [-1364.600] (-1362.282) -- 0:00:38 486000 -- (-1367.544) (-1363.499) [-1363.495] (-1366.585) * [-1364.065] (-1363.756) (-1368.843) (-1362.966) -- 0:00:38 486500 -- (-1363.969) [-1362.830] (-1364.086) (-1364.212) * (-1367.588) [-1365.256] (-1366.565) (-1366.099) -- 0:00:37 487000 -- [-1363.941] (-1364.031) (-1366.819) (-1365.370) * (-1364.739) [-1363.117] (-1365.271) (-1365.861) -- 0:00:37 487500 -- [-1365.564] (-1365.164) (-1368.961) (-1364.145) * (-1364.352) (-1364.740) (-1365.491) [-1364.998] -- 0:00:37 488000 -- (-1365.727) (-1365.555) [-1363.975] (-1364.801) * (-1366.379) [-1363.594] (-1363.678) (-1368.374) -- 0:00:37 488500 -- (-1362.964) (-1364.812) (-1364.431) [-1364.000] * [-1364.593] (-1365.287) (-1365.077) (-1364.959) -- 0:00:37 489000 -- (-1362.993) [-1363.453] (-1367.794) (-1363.158) * (-1364.091) [-1362.695] (-1362.245) (-1366.980) -- 0:00:37 489500 -- (-1363.984) [-1362.822] (-1365.255) (-1365.187) * (-1366.253) (-1365.524) (-1366.622) [-1363.223] -- 0:00:37 490000 -- (-1367.954) (-1364.745) [-1362.142] (-1365.445) * (-1365.420) [-1372.252] (-1368.940) (-1365.656) -- 0:00:37 Average standard deviation of split frequencies: 0.012998 490500 -- (-1370.055) (-1362.706) [-1362.458] (-1362.520) * (-1365.451) (-1368.132) (-1367.006) [-1366.933] -- 0:00:38 491000 -- (-1365.473) (-1362.153) [-1364.998] (-1362.523) * (-1365.622) (-1366.795) (-1362.356) [-1364.700] -- 0:00:38 491500 -- (-1363.973) (-1363.509) [-1364.441] (-1362.475) * (-1363.690) (-1364.216) (-1363.660) [-1363.287] -- 0:00:38 492000 -- [-1366.768] (-1367.360) (-1368.623) (-1362.493) * [-1365.149] (-1364.853) (-1364.763) (-1366.480) -- 0:00:38 492500 -- (-1364.562) [-1363.576] (-1365.193) (-1363.142) * (-1367.859) (-1364.559) (-1363.919) [-1364.552] -- 0:00:38 493000 -- (-1363.508) (-1363.245) [-1366.127] (-1371.931) * (-1365.533) [-1362.990] (-1367.034) (-1364.128) -- 0:00:38 493500 -- [-1364.069] (-1365.175) (-1364.074) (-1366.320) * (-1364.704) (-1363.750) [-1363.525] (-1372.520) -- 0:00:37 494000 -- (-1368.072) (-1362.568) (-1366.139) [-1366.062] * (-1365.472) (-1362.960) [-1363.371] (-1365.070) -- 0:00:37 494500 -- [-1368.258] (-1363.581) (-1365.601) (-1364.869) * [-1362.680] (-1365.048) (-1363.080) (-1364.782) -- 0:00:37 495000 -- [-1364.215] (-1365.035) (-1363.872) (-1363.139) * (-1362.205) [-1362.224] (-1362.800) (-1364.447) -- 0:00:37 Average standard deviation of split frequencies: 0.012747 495500 -- (-1362.516) (-1364.725) (-1363.625) [-1366.042] * (-1362.245) (-1362.685) (-1362.330) [-1369.535] -- 0:00:37 496000 -- (-1366.589) [-1364.067] (-1365.261) (-1366.295) * (-1362.841) [-1363.559] (-1368.279) (-1371.108) -- 0:00:37 496500 -- (-1364.337) [-1362.782] (-1363.352) (-1363.357) * (-1363.960) (-1367.752) [-1366.357] (-1365.733) -- 0:00:37 497000 -- (-1365.961) [-1364.112] (-1363.662) (-1363.799) * (-1363.890) (-1364.915) [-1362.510] (-1364.274) -- 0:00:37 497500 -- (-1364.849) (-1363.710) [-1363.560] (-1363.890) * [-1364.215] (-1362.104) (-1363.145) (-1367.092) -- 0:00:37 498000 -- [-1370.207] (-1364.393) (-1363.463) (-1363.783) * (-1362.598) [-1362.409] (-1363.433) (-1363.658) -- 0:00:37 498500 -- (-1366.846) (-1364.862) [-1362.553] (-1363.589) * (-1363.073) (-1363.409) (-1363.425) [-1362.652] -- 0:00:37 499000 -- (-1366.818) (-1365.054) (-1362.756) [-1363.968] * [-1363.372] (-1367.526) (-1371.427) (-1363.788) -- 0:00:37 499500 -- (-1364.250) (-1364.038) (-1362.308) [-1363.639] * (-1364.359) [-1364.801] (-1366.336) (-1363.248) -- 0:00:37 500000 -- (-1363.941) (-1362.879) (-1362.404) [-1364.025] * (-1364.332) (-1365.570) (-1364.230) [-1363.450] -- 0:00:37 Average standard deviation of split frequencies: 0.012794 500500 -- (-1364.550) [-1362.703] (-1366.043) (-1365.401) * [-1363.502] (-1370.049) (-1363.156) (-1363.450) -- 0:00:36 501000 -- (-1363.970) (-1363.568) (-1365.662) [-1363.975] * (-1363.241) (-1365.218) [-1362.834] (-1363.057) -- 0:00:36 501500 -- (-1362.710) [-1363.079] (-1364.251) (-1362.367) * (-1363.273) (-1363.123) [-1362.425] (-1365.633) -- 0:00:36 502000 -- (-1363.282) [-1363.234] (-1363.774) (-1367.813) * [-1362.923] (-1362.766) (-1363.592) (-1365.777) -- 0:00:36 502500 -- (-1363.697) (-1366.485) [-1365.117] (-1367.172) * (-1365.568) (-1362.951) (-1365.100) [-1365.957] -- 0:00:36 503000 -- (-1363.970) [-1363.468] (-1364.641) (-1364.917) * (-1366.928) (-1367.375) (-1363.886) [-1365.020] -- 0:00:36 503500 -- [-1362.611] (-1362.540) (-1366.165) (-1364.453) * (-1366.684) [-1363.968] (-1364.789) (-1363.172) -- 0:00:37 504000 -- (-1366.280) [-1365.697] (-1365.032) (-1364.665) * (-1364.264) [-1363.954] (-1365.382) (-1363.579) -- 0:00:37 504500 -- (-1365.341) [-1364.252] (-1364.868) (-1364.408) * (-1366.638) (-1364.158) [-1363.171] (-1364.335) -- 0:00:37 505000 -- [-1367.081] (-1364.366) (-1370.411) (-1362.720) * (-1365.676) [-1363.695] (-1365.763) (-1374.337) -- 0:00:37 Average standard deviation of split frequencies: 0.012933 505500 -- (-1364.294) [-1365.345] (-1365.453) (-1363.309) * (-1366.276) [-1364.231] (-1363.133) (-1369.584) -- 0:00:37 506000 -- (-1365.830) [-1363.052] (-1364.916) (-1363.441) * [-1364.959] (-1362.743) (-1363.567) (-1366.725) -- 0:00:37 506500 -- [-1364.406] (-1365.971) (-1363.558) (-1364.172) * (-1363.277) (-1362.759) (-1364.198) [-1363.876] -- 0:00:37 507000 -- [-1363.082] (-1368.307) (-1363.132) (-1366.306) * (-1362.604) (-1362.741) (-1363.765) [-1364.371] -- 0:00:36 507500 -- (-1363.467) (-1367.009) [-1364.344] (-1365.929) * (-1362.917) [-1364.807] (-1363.315) (-1363.188) -- 0:00:36 508000 -- (-1364.377) (-1364.992) [-1363.135] (-1364.701) * (-1364.222) (-1364.950) (-1364.042) [-1364.550] -- 0:00:36 508500 -- [-1364.922] (-1363.710) (-1362.599) (-1363.588) * (-1368.029) (-1363.254) (-1365.100) [-1366.598] -- 0:00:36 509000 -- (-1362.990) (-1363.753) (-1362.946) [-1366.745] * (-1366.108) (-1363.386) [-1362.421] (-1366.055) -- 0:00:36 509500 -- (-1365.537) (-1366.090) [-1363.119] (-1363.486) * (-1362.668) (-1365.091) (-1363.075) [-1365.588] -- 0:00:36 510000 -- [-1362.803] (-1364.648) (-1363.168) (-1364.871) * (-1364.544) [-1366.797] (-1363.075) (-1363.608) -- 0:00:36 Average standard deviation of split frequencies: 0.011783 510500 -- (-1365.903) (-1363.395) (-1363.826) [-1362.692] * (-1365.670) [-1366.380] (-1363.515) (-1365.640) -- 0:00:36 511000 -- (-1363.241) (-1363.355) (-1367.177) [-1362.453] * (-1364.692) (-1363.216) [-1363.402] (-1363.309) -- 0:00:36 511500 -- (-1364.601) (-1363.989) [-1366.092] (-1364.800) * [-1364.306] (-1363.726) (-1363.744) (-1369.209) -- 0:00:36 512000 -- (-1365.454) (-1367.279) [-1363.370] (-1363.423) * [-1365.690] (-1364.690) (-1364.453) (-1364.559) -- 0:00:36 512500 -- (-1362.659) (-1365.537) (-1363.332) [-1363.110] * (-1366.055) (-1366.352) [-1364.855] (-1364.677) -- 0:00:36 513000 -- [-1363.078] (-1366.221) (-1364.710) (-1362.869) * (-1364.163) (-1364.966) (-1366.969) [-1365.025] -- 0:00:36 513500 -- (-1364.206) (-1364.336) (-1363.310) [-1362.887] * [-1362.636] (-1367.442) (-1363.675) (-1365.326) -- 0:00:36 514000 -- (-1363.002) (-1366.458) (-1362.937) [-1364.464] * (-1362.636) (-1363.342) [-1362.429] (-1368.910) -- 0:00:35 514500 -- (-1362.773) (-1362.975) (-1364.506) [-1364.785] * (-1363.892) (-1363.161) [-1364.213] (-1365.657) -- 0:00:35 515000 -- [-1362.511] (-1363.032) (-1362.414) (-1366.638) * (-1364.512) (-1367.695) (-1364.563) [-1364.252] -- 0:00:35 Average standard deviation of split frequencies: 0.012199 515500 -- (-1365.529) (-1362.790) (-1366.026) [-1363.830] * [-1366.276] (-1367.609) (-1362.900) (-1362.830) -- 0:00:35 516000 -- (-1364.784) (-1364.990) [-1366.247] (-1363.801) * (-1365.136) [-1363.243] (-1365.748) (-1362.635) -- 0:00:35 516500 -- [-1363.181] (-1367.495) (-1365.614) (-1363.522) * (-1363.240) (-1367.856) [-1365.936] (-1363.843) -- 0:00:35 517000 -- (-1367.457) [-1364.167] (-1364.044) (-1362.732) * (-1362.137) (-1366.538) (-1366.702) [-1363.299] -- 0:00:36 517500 -- (-1364.498) (-1366.408) [-1362.050] (-1366.677) * (-1362.323) (-1363.950) (-1365.127) [-1362.709] -- 0:00:36 518000 -- (-1365.090) [-1365.711] (-1364.057) (-1364.002) * (-1364.131) [-1363.950] (-1364.839) (-1362.705) -- 0:00:36 518500 -- (-1364.304) (-1363.597) [-1364.150] (-1362.744) * (-1367.007) (-1363.950) (-1362.011) [-1362.247] -- 0:00:36 519000 -- (-1365.083) [-1363.494] (-1363.108) (-1364.896) * (-1364.036) (-1363.167) [-1368.777] (-1363.052) -- 0:00:36 519500 -- (-1362.933) (-1366.737) [-1362.015] (-1364.930) * (-1362.371) [-1362.769] (-1366.996) (-1363.372) -- 0:00:36 520000 -- (-1363.602) [-1365.633] (-1364.908) (-1367.181) * (-1364.764) (-1367.405) [-1365.167] (-1363.316) -- 0:00:36 Average standard deviation of split frequencies: 0.012090 520500 -- (-1363.160) [-1362.582] (-1364.522) (-1364.553) * (-1364.737) (-1366.268) (-1363.661) [-1367.372] -- 0:00:35 521000 -- (-1365.785) (-1363.411) [-1369.206] (-1364.112) * [-1363.166] (-1364.285) (-1362.462) (-1362.564) -- 0:00:35 521500 -- [-1365.630] (-1364.615) (-1366.853) (-1363.448) * (-1364.371) [-1365.618] (-1367.923) (-1364.911) -- 0:00:35 522000 -- (-1364.078) (-1364.414) (-1363.315) [-1363.950] * [-1368.423] (-1365.120) (-1365.661) (-1366.305) -- 0:00:35 522500 -- (-1363.945) (-1362.888) [-1362.501] (-1365.458) * (-1366.062) (-1364.192) (-1363.045) [-1367.984] -- 0:00:35 523000 -- (-1363.976) (-1363.206) [-1366.512] (-1364.483) * [-1368.589] (-1365.159) (-1363.267) (-1366.573) -- 0:00:35 523500 -- [-1363.972] (-1363.174) (-1365.068) (-1364.476) * (-1363.044) (-1369.222) [-1364.469] (-1370.291) -- 0:00:35 524000 -- (-1365.005) [-1362.100] (-1364.485) (-1362.526) * (-1366.598) (-1364.632) (-1367.474) [-1371.373] -- 0:00:35 524500 -- (-1366.308) (-1363.310) [-1368.253] (-1363.156) * (-1365.086) (-1364.733) [-1368.356] (-1370.670) -- 0:00:35 525000 -- (-1362.986) (-1364.202) [-1364.731] (-1368.062) * [-1364.046] (-1365.284) (-1364.840) (-1364.711) -- 0:00:35 Average standard deviation of split frequencies: 0.011914 525500 -- (-1364.079) [-1363.435] (-1363.596) (-1368.321) * (-1363.603) [-1363.686] (-1364.106) (-1363.485) -- 0:00:35 526000 -- [-1363.790] (-1363.968) (-1371.468) (-1368.329) * (-1364.733) [-1365.067] (-1365.519) (-1366.692) -- 0:00:35 526500 -- (-1365.676) [-1363.077] (-1366.596) (-1364.844) * [-1364.055] (-1365.414) (-1363.658) (-1365.621) -- 0:00:35 527000 -- (-1365.768) (-1362.767) (-1364.673) [-1363.153] * [-1363.493] (-1365.356) (-1364.595) (-1365.572) -- 0:00:35 527500 -- [-1365.184] (-1367.101) (-1364.385) (-1362.714) * [-1362.604] (-1363.895) (-1364.124) (-1365.265) -- 0:00:34 528000 -- [-1364.502] (-1366.010) (-1364.255) (-1362.703) * (-1365.336) [-1363.236] (-1363.007) (-1364.145) -- 0:00:34 528500 -- [-1364.170] (-1365.164) (-1364.367) (-1362.562) * (-1366.278) (-1365.046) (-1367.166) [-1364.356] -- 0:00:34 529000 -- (-1364.951) (-1363.631) (-1368.523) [-1363.792] * (-1363.665) (-1367.628) (-1366.302) [-1362.407] -- 0:00:34 529500 -- (-1362.569) (-1363.519) (-1362.783) [-1362.370] * (-1363.820) (-1366.592) (-1363.785) [-1364.652] -- 0:00:34 530000 -- [-1363.259] (-1363.968) (-1362.705) (-1365.742) * (-1365.795) (-1364.813) (-1364.631) [-1362.745] -- 0:00:35 Average standard deviation of split frequencies: 0.011914 530500 -- (-1368.024) (-1363.033) [-1362.429] (-1363.625) * (-1365.396) (-1364.106) [-1363.485] (-1362.492) -- 0:00:35 531000 -- (-1368.665) (-1361.980) [-1363.440] (-1365.424) * (-1367.973) [-1364.094] (-1363.785) (-1362.436) -- 0:00:35 531500 -- (-1366.431) (-1362.569) [-1364.049] (-1364.186) * (-1365.994) [-1363.823] (-1363.736) (-1362.707) -- 0:00:35 532000 -- (-1363.653) [-1363.039] (-1363.059) (-1365.991) * (-1363.299) (-1365.057) (-1365.029) [-1365.168] -- 0:00:35 532500 -- [-1365.697] (-1367.994) (-1362.465) (-1366.027) * (-1367.972) (-1364.898) (-1366.291) [-1364.834] -- 0:00:35 533000 -- (-1370.654) (-1365.370) (-1363.783) [-1363.371] * (-1363.390) [-1364.760] (-1363.166) (-1363.066) -- 0:00:35 533500 -- [-1364.438] (-1365.602) (-1365.333) (-1364.463) * [-1363.957] (-1363.320) (-1364.532) (-1364.099) -- 0:00:34 534000 -- (-1365.317) [-1364.734] (-1365.602) (-1365.147) * (-1368.995) (-1371.215) [-1366.436] (-1363.974) -- 0:00:34 534500 -- (-1363.032) (-1366.203) (-1364.304) [-1364.314] * [-1363.070] (-1367.051) (-1366.276) (-1363.266) -- 0:00:34 535000 -- (-1362.628) (-1363.788) [-1363.498] (-1363.559) * [-1363.763] (-1366.692) (-1363.374) (-1365.176) -- 0:00:34 Average standard deviation of split frequencies: 0.011899 535500 -- (-1363.640) (-1363.938) (-1364.653) [-1362.268] * (-1364.332) (-1366.845) (-1363.443) [-1363.908] -- 0:00:34 536000 -- [-1366.568] (-1364.010) (-1362.750) (-1365.679) * (-1365.460) [-1363.321] (-1363.764) (-1362.728) -- 0:00:34 536500 -- (-1365.723) (-1367.616) [-1363.763] (-1364.097) * (-1363.558) (-1363.510) (-1362.828) [-1365.160] -- 0:00:34 537000 -- (-1366.574) (-1365.597) [-1362.098] (-1370.049) * (-1365.992) (-1362.620) [-1363.002] (-1365.481) -- 0:00:34 537500 -- (-1366.632) (-1363.353) (-1363.025) [-1362.471] * (-1364.843) (-1362.828) [-1362.940] (-1367.627) -- 0:00:34 538000 -- (-1371.811) (-1363.298) (-1364.757) [-1365.499] * (-1363.339) (-1364.291) [-1363.068] (-1367.585) -- 0:00:34 538500 -- (-1366.940) (-1368.102) [-1362.543] (-1364.011) * (-1367.710) [-1363.857] (-1364.282) (-1368.461) -- 0:00:34 539000 -- (-1364.991) (-1368.618) (-1362.264) [-1364.308] * (-1364.067) [-1364.574] (-1365.377) (-1369.269) -- 0:00:34 539500 -- (-1365.061) (-1367.286) (-1367.525) [-1367.364] * (-1365.396) [-1367.241] (-1362.322) (-1368.721) -- 0:00:34 540000 -- (-1364.941) [-1362.920] (-1363.781) (-1368.969) * [-1365.396] (-1371.081) (-1362.396) (-1365.274) -- 0:00:34 Average standard deviation of split frequencies: 0.011745 540500 -- (-1362.234) (-1362.574) (-1363.782) [-1365.053] * [-1363.696] (-1363.646) (-1362.154) (-1365.645) -- 0:00:34 541000 -- (-1363.403) (-1363.589) [-1361.941] (-1364.868) * (-1364.011) (-1366.863) [-1363.937] (-1363.504) -- 0:00:33 541500 -- [-1363.232] (-1363.037) (-1363.252) (-1364.084) * [-1363.406] (-1367.243) (-1364.197) (-1365.661) -- 0:00:33 542000 -- (-1362.533) (-1362.856) (-1363.658) [-1363.010] * (-1364.103) [-1362.851] (-1364.156) (-1366.386) -- 0:00:33 542500 -- [-1363.830] (-1363.587) (-1366.410) (-1365.015) * (-1364.808) (-1364.073) [-1362.956] (-1368.268) -- 0:00:33 543000 -- (-1366.207) (-1365.118) (-1364.247) [-1363.099] * (-1367.720) (-1364.232) [-1363.486] (-1365.104) -- 0:00:33 543500 -- (-1366.610) (-1364.454) [-1363.959] (-1364.957) * (-1367.106) (-1364.966) [-1363.503] (-1364.355) -- 0:00:34 544000 -- (-1364.520) [-1364.151] (-1366.603) (-1367.461) * (-1364.201) (-1362.431) [-1363.896] (-1363.775) -- 0:00:34 544500 -- (-1363.166) [-1363.649] (-1366.375) (-1364.262) * (-1363.382) (-1364.099) (-1365.278) [-1368.067] -- 0:00:34 545000 -- [-1362.131] (-1365.590) (-1364.571) (-1366.211) * [-1363.104] (-1365.313) (-1362.515) (-1366.682) -- 0:00:34 Average standard deviation of split frequencies: 0.012240 545500 -- [-1367.275] (-1363.604) (-1364.361) (-1368.174) * (-1363.399) (-1362.474) [-1365.920] (-1365.017) -- 0:00:34 546000 -- [-1363.718] (-1364.984) (-1364.105) (-1362.743) * (-1364.253) (-1362.828) (-1365.034) [-1365.347] -- 0:00:34 546500 -- (-1366.083) (-1368.802) (-1363.993) [-1362.193] * (-1363.124) (-1362.654) (-1365.123) [-1366.110] -- 0:00:34 547000 -- [-1367.122] (-1367.908) (-1362.821) (-1362.485) * (-1363.120) (-1363.799) [-1365.257] (-1365.778) -- 0:00:33 547500 -- (-1362.811) (-1368.526) (-1363.979) [-1364.744] * (-1364.253) [-1363.532] (-1363.238) (-1366.627) -- 0:00:33 548000 -- (-1365.646) [-1364.186] (-1364.332) (-1363.398) * [-1365.781] (-1367.399) (-1370.137) (-1366.101) -- 0:00:33 548500 -- (-1365.788) [-1362.856] (-1363.446) (-1365.939) * (-1366.555) (-1365.518) (-1364.325) [-1364.716] -- 0:00:33 549000 -- [-1363.635] (-1362.821) (-1364.359) (-1364.080) * (-1364.035) (-1364.670) (-1365.632) [-1364.741] -- 0:00:33 549500 -- (-1363.172) (-1370.330) (-1365.059) [-1364.025] * (-1364.699) (-1366.035) [-1364.069] (-1363.968) -- 0:00:33 550000 -- (-1363.748) [-1363.548] (-1365.998) (-1363.003) * [-1364.074] (-1363.612) (-1363.807) (-1363.209) -- 0:00:33 Average standard deviation of split frequencies: 0.012086 550500 -- (-1365.166) [-1363.055] (-1364.428) (-1363.876) * (-1365.237) (-1363.342) [-1363.937] (-1363.186) -- 0:00:33 551000 -- (-1363.056) (-1362.325) (-1363.073) [-1366.461] * [-1365.673] (-1363.017) (-1363.811) (-1372.244) -- 0:00:33 551500 -- [-1364.165] (-1364.057) (-1363.121) (-1362.462) * (-1362.587) [-1363.671] (-1364.183) (-1362.672) -- 0:00:33 552000 -- [-1363.679] (-1369.077) (-1364.247) (-1363.321) * [-1363.546] (-1366.001) (-1363.816) (-1364.703) -- 0:00:33 552500 -- [-1363.187] (-1364.680) (-1364.777) (-1363.371) * (-1365.074) (-1365.093) [-1364.334] (-1364.834) -- 0:00:33 553000 -- (-1365.379) (-1363.748) [-1363.047] (-1362.978) * (-1366.457) (-1363.040) [-1362.512] (-1362.214) -- 0:00:33 553500 -- (-1364.867) (-1365.236) [-1362.919] (-1365.365) * (-1362.979) (-1363.618) [-1366.545] (-1364.726) -- 0:00:33 554000 -- (-1363.360) (-1363.822) [-1363.478] (-1364.183) * (-1366.247) (-1365.068) (-1362.665) [-1362.465] -- 0:00:33 554500 -- (-1363.928) (-1365.968) (-1362.424) [-1364.698] * (-1363.418) (-1364.469) (-1363.142) [-1364.160] -- 0:00:32 555000 -- (-1367.969) [-1364.047] (-1363.411) (-1368.275) * (-1363.321) (-1363.880) [-1363.485] (-1362.758) -- 0:00:32 Average standard deviation of split frequencies: 0.011920 555500 -- (-1363.515) [-1363.614] (-1365.569) (-1364.052) * (-1362.875) (-1362.176) [-1365.250] (-1363.336) -- 0:00:32 556000 -- (-1365.017) (-1362.744) [-1364.687] (-1365.136) * [-1362.836] (-1361.995) (-1363.005) (-1364.718) -- 0:00:32 556500 -- (-1362.352) (-1363.243) [-1362.982] (-1367.956) * (-1362.727) [-1363.214] (-1363.429) (-1364.397) -- 0:00:33 557000 -- (-1364.609) (-1365.639) (-1362.289) [-1362.402] * (-1364.530) (-1365.266) (-1364.527) [-1366.023] -- 0:00:33 557500 -- (-1364.235) [-1365.107] (-1364.299) (-1362.731) * [-1363.476] (-1367.899) (-1367.128) (-1364.578) -- 0:00:33 558000 -- (-1364.332) [-1363.388] (-1363.393) (-1363.153) * [-1366.595] (-1365.091) (-1366.483) (-1363.871) -- 0:00:33 558500 -- (-1369.516) [-1362.875] (-1364.874) (-1362.435) * (-1362.663) [-1365.638] (-1367.190) (-1363.287) -- 0:00:33 559000 -- (-1363.644) [-1362.860] (-1364.204) (-1365.352) * [-1362.150] (-1366.513) (-1367.857) (-1363.467) -- 0:00:33 559500 -- [-1364.435] (-1363.517) (-1363.491) (-1367.269) * (-1367.889) [-1366.955] (-1365.379) (-1363.118) -- 0:00:33 560000 -- (-1365.102) (-1362.133) (-1365.904) [-1364.456] * (-1366.013) (-1365.777) (-1363.355) [-1363.855] -- 0:00:33 Average standard deviation of split frequencies: 0.011623 560500 -- (-1364.140) (-1362.716) [-1366.181] (-1363.959) * (-1363.141) (-1363.232) [-1364.703] (-1363.275) -- 0:00:32 561000 -- [-1364.615] (-1365.995) (-1366.079) (-1362.440) * [-1366.889] (-1363.739) (-1364.889) (-1363.918) -- 0:00:32 561500 -- (-1362.893) [-1362.457] (-1366.733) (-1362.797) * (-1367.202) (-1363.255) [-1365.775] (-1365.464) -- 0:00:32 562000 -- (-1363.790) [-1365.025] (-1363.036) (-1362.758) * [-1362.463] (-1362.032) (-1363.935) (-1365.478) -- 0:00:32 562500 -- (-1363.684) (-1362.580) [-1364.461] (-1364.663) * (-1363.289) (-1363.432) (-1364.904) [-1366.659] -- 0:00:32 563000 -- [-1363.518] (-1362.755) (-1366.168) (-1364.112) * (-1363.737) [-1362.397] (-1366.898) (-1367.020) -- 0:00:32 563500 -- (-1362.138) [-1362.646] (-1364.797) (-1367.765) * (-1363.895) (-1362.397) (-1365.854) [-1367.984] -- 0:00:32 564000 -- (-1363.667) [-1363.406] (-1368.216) (-1365.557) * (-1365.831) [-1365.092] (-1364.874) (-1365.179) -- 0:00:32 564500 -- (-1364.867) (-1363.627) (-1365.113) [-1362.242] * (-1363.417) [-1366.026] (-1365.149) (-1363.523) -- 0:00:32 565000 -- (-1363.769) (-1364.550) [-1366.701] (-1363.637) * (-1363.171) (-1364.776) (-1366.201) [-1363.492] -- 0:00:32 Average standard deviation of split frequencies: 0.011513 565500 -- [-1363.585] (-1364.540) (-1362.911) (-1365.247) * [-1364.795] (-1364.355) (-1366.044) (-1365.178) -- 0:00:32 566000 -- (-1363.449) (-1366.751) [-1363.203] (-1366.611) * (-1365.177) [-1363.054] (-1365.420) (-1367.308) -- 0:00:32 566500 -- (-1365.294) (-1363.413) [-1363.161] (-1363.744) * (-1365.351) [-1363.362] (-1362.788) (-1364.635) -- 0:00:32 567000 -- (-1364.396) [-1365.126] (-1366.373) (-1369.507) * (-1368.341) (-1362.827) [-1362.107] (-1364.147) -- 0:00:32 567500 -- (-1364.447) [-1365.586] (-1363.030) (-1365.565) * (-1363.234) [-1363.056] (-1363.256) (-1363.649) -- 0:00:32 568000 -- [-1363.482] (-1363.003) (-1364.209) (-1368.230) * [-1365.898] (-1366.088) (-1363.552) (-1363.117) -- 0:00:31 568500 -- [-1363.832] (-1363.247) (-1365.694) (-1364.996) * (-1366.247) (-1363.303) (-1362.121) [-1366.437] -- 0:00:31 569000 -- (-1364.154) [-1362.496] (-1362.982) (-1363.766) * (-1363.965) (-1364.172) (-1364.579) [-1363.554] -- 0:00:31 569500 -- (-1365.987) (-1362.775) [-1362.116] (-1363.610) * (-1365.225) (-1362.887) (-1363.574) [-1362.405] -- 0:00:31 570000 -- (-1364.778) (-1364.905) [-1363.741] (-1363.596) * [-1364.379] (-1364.361) (-1363.414) (-1362.396) -- 0:00:32 Average standard deviation of split frequencies: 0.011128 570500 -- (-1363.660) (-1366.061) (-1364.676) [-1362.733] * (-1367.678) (-1365.081) (-1363.241) [-1364.182] -- 0:00:32 571000 -- (-1365.492) [-1365.239] (-1364.147) (-1362.796) * [-1363.828] (-1364.264) (-1363.959) (-1365.486) -- 0:00:32 571500 -- (-1364.273) [-1364.856] (-1363.498) (-1363.472) * (-1363.396) (-1364.481) (-1362.969) [-1366.757] -- 0:00:32 572000 -- (-1366.682) (-1367.794) (-1371.196) [-1362.367] * [-1363.935] (-1364.114) (-1364.672) (-1362.566) -- 0:00:32 572500 -- (-1366.892) [-1366.095] (-1367.060) (-1363.295) * [-1364.766] (-1364.752) (-1365.868) (-1367.191) -- 0:00:32 573000 -- (-1367.455) (-1365.497) (-1362.792) [-1363.468] * [-1363.021] (-1363.229) (-1366.276) (-1364.096) -- 0:00:32 573500 -- (-1363.306) [-1365.408] (-1363.741) (-1364.071) * (-1363.832) (-1363.578) [-1365.480] (-1366.765) -- 0:00:31 574000 -- (-1363.914) [-1369.396] (-1364.575) (-1366.313) * [-1364.118] (-1363.656) (-1364.048) (-1364.893) -- 0:00:31 574500 -- (-1364.055) [-1365.887] (-1365.037) (-1362.254) * (-1364.413) (-1364.409) [-1364.001] (-1363.148) -- 0:00:31 575000 -- (-1371.097) [-1364.734] (-1365.682) (-1362.529) * (-1365.074) (-1365.143) [-1362.965] (-1364.247) -- 0:00:31 Average standard deviation of split frequencies: 0.011747 575500 -- (-1369.570) (-1364.149) (-1370.753) [-1362.798] * (-1364.579) (-1363.757) (-1365.170) [-1364.510] -- 0:00:31 576000 -- (-1363.542) (-1363.316) (-1368.937) [-1364.558] * (-1365.856) [-1364.785] (-1366.061) (-1362.838) -- 0:00:31 576500 -- (-1364.263) (-1363.157) (-1365.204) [-1363.766] * (-1365.117) (-1363.163) (-1363.543) [-1365.030] -- 0:00:31 577000 -- (-1363.702) [-1368.749] (-1366.506) (-1364.361) * (-1366.322) (-1364.060) [-1363.117] (-1362.605) -- 0:00:31 577500 -- (-1364.331) (-1362.797) (-1362.957) [-1362.371] * [-1363.801] (-1363.648) (-1364.321) (-1366.368) -- 0:00:31 578000 -- (-1363.810) (-1366.011) [-1363.865] (-1367.598) * (-1369.548) (-1363.109) (-1364.385) [-1364.135] -- 0:00:31 578500 -- (-1363.843) (-1367.287) (-1368.523) [-1363.558] * [-1365.085] (-1364.559) (-1363.451) (-1362.967) -- 0:00:31 579000 -- (-1364.621) (-1365.971) (-1362.136) [-1362.269] * (-1363.030) [-1365.343] (-1364.946) (-1363.765) -- 0:00:31 579500 -- (-1363.302) (-1365.884) (-1362.777) [-1362.907] * (-1363.068) (-1363.989) [-1362.457] (-1364.981) -- 0:00:31 580000 -- [-1364.366] (-1362.320) (-1363.048) (-1365.729) * (-1364.580) [-1365.431] (-1363.502) (-1367.577) -- 0:00:31 Average standard deviation of split frequencies: 0.011700 580500 -- (-1363.941) (-1366.185) (-1362.945) [-1363.432] * (-1363.451) [-1364.737] (-1365.330) (-1364.297) -- 0:00:31 581000 -- (-1363.377) (-1364.392) (-1371.491) [-1365.545] * (-1364.913) [-1364.245] (-1366.331) (-1366.067) -- 0:00:31 581500 -- (-1363.123) [-1365.065] (-1362.405) (-1365.860) * (-1364.375) (-1364.957) (-1367.805) [-1363.697] -- 0:00:30 582000 -- (-1365.664) [-1362.895] (-1365.958) (-1369.075) * (-1362.765) (-1367.728) (-1367.639) [-1365.654] -- 0:00:30 582500 -- (-1363.793) (-1365.681) (-1363.809) [-1364.367] * [-1363.740] (-1366.375) (-1367.950) (-1364.925) -- 0:00:30 583000 -- [-1362.435] (-1363.248) (-1363.267) (-1364.003) * (-1362.520) [-1370.315] (-1367.412) (-1368.979) -- 0:00:31 583500 -- (-1362.043) (-1363.101) (-1364.532) [-1366.858] * (-1364.283) (-1364.809) (-1367.167) [-1368.835] -- 0:00:31 584000 -- (-1367.720) (-1363.657) (-1365.797) [-1365.104] * (-1364.783) (-1367.235) (-1362.731) [-1365.101] -- 0:00:31 584500 -- [-1366.428] (-1364.731) (-1365.175) (-1365.602) * (-1367.457) [-1363.777] (-1368.471) (-1363.998) -- 0:00:31 585000 -- (-1362.052) (-1369.584) [-1363.717] (-1363.792) * (-1363.663) (-1366.008) (-1368.611) [-1363.373] -- 0:00:31 Average standard deviation of split frequencies: 0.011404 585500 -- [-1362.749] (-1366.598) (-1362.126) (-1364.962) * (-1363.473) [-1363.755] (-1362.931) (-1362.941) -- 0:00:31 586000 -- (-1362.945) (-1364.593) [-1362.741] (-1366.625) * [-1363.276] (-1362.150) (-1367.459) (-1366.128) -- 0:00:31 586500 -- [-1365.287] (-1367.595) (-1363.355) (-1365.446) * (-1362.622) (-1365.891) (-1364.055) [-1363.517] -- 0:00:31 587000 -- [-1364.340] (-1362.884) (-1363.685) (-1363.827) * [-1363.726] (-1364.104) (-1364.321) (-1365.472) -- 0:00:30 587500 -- (-1367.606) (-1362.150) [-1362.251] (-1366.097) * (-1364.031) (-1364.339) (-1365.742) [-1362.661] -- 0:00:30 588000 -- (-1364.487) [-1365.148] (-1363.414) (-1362.934) * (-1364.917) (-1364.807) (-1366.252) [-1364.977] -- 0:00:30 588500 -- (-1362.785) (-1372.285) [-1364.988] (-1365.764) * (-1366.075) (-1363.235) [-1367.267] (-1363.844) -- 0:00:30 589000 -- (-1363.849) (-1364.960) [-1367.165] (-1366.097) * (-1365.644) [-1363.205] (-1364.458) (-1362.663) -- 0:00:30 589500 -- [-1362.876] (-1365.419) (-1364.162) (-1364.830) * (-1363.488) (-1365.082) (-1362.984) [-1363.115] -- 0:00:30 590000 -- (-1364.060) (-1364.771) [-1365.219] (-1366.697) * [-1366.386] (-1365.598) (-1367.693) (-1364.145) -- 0:00:30 Average standard deviation of split frequencies: 0.011126 590500 -- (-1363.847) (-1364.778) (-1362.725) [-1364.125] * [-1364.141] (-1368.471) (-1364.236) (-1364.465) -- 0:00:30 591000 -- (-1363.234) (-1364.551) (-1364.056) [-1363.835] * (-1362.549) [-1367.953] (-1370.234) (-1367.873) -- 0:00:30 591500 -- [-1367.386] (-1364.154) (-1366.046) (-1364.402) * (-1363.694) (-1373.988) [-1364.987] (-1367.562) -- 0:00:30 592000 -- (-1363.157) (-1363.247) [-1366.435] (-1362.579) * [-1363.667] (-1370.468) (-1365.744) (-1363.431) -- 0:00:30 592500 -- (-1362.668) [-1363.355] (-1364.643) (-1362.458) * (-1363.463) (-1368.839) (-1364.147) [-1363.961] -- 0:00:30 593000 -- [-1362.656] (-1366.716) (-1364.142) (-1363.806) * [-1362.005] (-1365.303) (-1364.599) (-1366.141) -- 0:00:30 593500 -- (-1364.578) (-1365.690) [-1364.611] (-1363.934) * [-1364.472] (-1365.708) (-1364.020) (-1367.584) -- 0:00:30 594000 -- [-1365.631] (-1362.415) (-1363.108) (-1364.819) * [-1363.084] (-1363.813) (-1365.391) (-1366.675) -- 0:00:30 594500 -- (-1365.773) (-1362.667) [-1364.747] (-1365.745) * (-1366.895) [-1364.613] (-1363.561) (-1365.206) -- 0:00:30 595000 -- (-1362.807) (-1363.517) (-1364.136) [-1368.587] * (-1365.856) (-1363.934) [-1362.697] (-1365.715) -- 0:00:29 Average standard deviation of split frequencies: 0.011352 595500 -- (-1363.050) [-1364.124] (-1363.116) (-1366.763) * (-1362.548) [-1364.435] (-1364.587) (-1364.961) -- 0:00:29 596000 -- (-1365.225) (-1366.961) [-1364.405] (-1364.235) * [-1362.548] (-1365.211) (-1372.489) (-1362.910) -- 0:00:30 596500 -- (-1362.818) (-1369.163) (-1366.025) [-1363.687] * (-1363.677) [-1369.477] (-1363.412) (-1363.492) -- 0:00:30 597000 -- (-1367.793) (-1370.542) [-1366.701] (-1365.006) * (-1364.308) (-1363.837) (-1363.705) [-1368.118] -- 0:00:30 597500 -- (-1365.796) (-1366.251) (-1363.897) [-1364.321] * (-1362.405) (-1365.041) (-1365.666) [-1365.746] -- 0:00:30 598000 -- (-1366.262) (-1362.918) [-1362.803] (-1363.133) * (-1364.639) (-1363.323) (-1366.280) [-1364.710] -- 0:00:30 598500 -- [-1365.021] (-1363.185) (-1362.798) (-1363.532) * (-1364.968) [-1363.514] (-1363.845) (-1363.686) -- 0:00:30 599000 -- [-1362.556] (-1363.277) (-1364.245) (-1367.480) * (-1366.860) (-1365.973) (-1363.475) [-1364.830] -- 0:00:30 599500 -- (-1363.869) (-1363.426) [-1364.446] (-1364.947) * (-1364.846) (-1366.619) [-1365.111] (-1362.576) -- 0:00:30 600000 -- (-1362.784) [-1365.920] (-1369.434) (-1364.170) * (-1362.253) (-1364.616) [-1364.882] (-1363.657) -- 0:00:29 Average standard deviation of split frequencies: 0.011634 600500 -- [-1365.351] (-1365.014) (-1366.299) (-1364.549) * [-1363.328] (-1363.698) (-1366.723) (-1363.256) -- 0:00:29 601000 -- [-1367.082] (-1364.598) (-1366.676) (-1362.948) * [-1363.437] (-1363.117) (-1362.677) (-1362.606) -- 0:00:29 601500 -- (-1368.592) [-1363.415] (-1365.098) (-1363.478) * (-1362.201) [-1367.290] (-1364.422) (-1364.326) -- 0:00:29 602000 -- (-1365.935) (-1363.834) [-1363.413] (-1364.415) * (-1363.481) [-1365.172] (-1364.812) (-1366.963) -- 0:00:29 602500 -- (-1362.874) [-1363.528] (-1363.735) (-1364.694) * [-1366.010] (-1363.283) (-1362.544) (-1363.306) -- 0:00:29 603000 -- (-1362.955) (-1363.389) (-1362.503) [-1364.436] * (-1371.560) (-1363.782) [-1362.605] (-1363.992) -- 0:00:29 603500 -- [-1364.669] (-1364.254) (-1362.848) (-1367.528) * (-1363.963) (-1364.826) (-1363.113) [-1363.324] -- 0:00:29 604000 -- (-1367.091) (-1366.631) (-1364.822) [-1362.052] * (-1364.060) (-1365.093) (-1364.474) [-1363.466] -- 0:00:29 604500 -- (-1365.157) [-1365.075] (-1364.330) (-1364.543) * (-1363.167) (-1368.132) [-1364.516] (-1364.253) -- 0:00:29 605000 -- (-1364.870) (-1363.136) (-1366.910) [-1362.929] * [-1364.838] (-1365.672) (-1369.506) (-1368.233) -- 0:00:29 Average standard deviation of split frequencies: 0.011760 605500 -- [-1363.152] (-1362.312) (-1365.528) (-1363.376) * [-1362.035] (-1362.943) (-1366.181) (-1363.576) -- 0:00:29 606000 -- (-1363.600) (-1369.124) [-1367.143] (-1368.104) * (-1361.953) (-1364.075) (-1366.815) [-1363.852] -- 0:00:29 606500 -- [-1365.783] (-1363.091) (-1365.368) (-1364.090) * [-1362.668] (-1362.734) (-1363.850) (-1364.674) -- 0:00:29 607000 -- (-1366.678) [-1365.098] (-1366.908) (-1363.365) * (-1362.964) (-1363.960) [-1363.074] (-1364.563) -- 0:00:29 607500 -- (-1365.530) (-1363.505) (-1364.223) [-1363.035] * (-1363.672) [-1361.988] (-1363.598) (-1363.602) -- 0:00:29 608000 -- (-1364.698) [-1364.297] (-1364.991) (-1363.150) * (-1364.662) (-1363.707) [-1362.554] (-1368.058) -- 0:00:29 608500 -- (-1364.800) (-1363.653) (-1365.686) [-1367.934] * [-1366.378] (-1363.335) (-1362.564) (-1368.845) -- 0:00:28 609000 -- (-1369.119) (-1363.868) [-1362.271] (-1368.318) * (-1372.830) (-1362.953) [-1362.169] (-1362.337) -- 0:00:29 609500 -- (-1363.008) (-1364.130) [-1364.349] (-1368.196) * (-1363.314) [-1363.384] (-1362.209) (-1365.490) -- 0:00:29 610000 -- (-1364.556) [-1362.206] (-1364.425) (-1363.873) * (-1364.505) [-1363.389] (-1362.136) (-1365.441) -- 0:00:29 Average standard deviation of split frequencies: 0.011398 610500 -- (-1362.507) [-1363.332] (-1366.144) (-1362.939) * (-1365.062) [-1365.788] (-1362.196) (-1364.457) -- 0:00:29 611000 -- (-1363.796) (-1363.014) (-1367.851) [-1364.544] * (-1365.706) (-1368.392) [-1362.196] (-1364.371) -- 0:00:29 611500 -- (-1364.182) (-1363.376) (-1363.044) [-1366.280] * (-1364.017) [-1364.331] (-1362.152) (-1366.578) -- 0:00:29 612000 -- (-1365.054) [-1364.990] (-1362.820) (-1364.693) * (-1368.731) (-1364.033) (-1363.895) [-1364.371] -- 0:00:29 612500 -- [-1363.628] (-1364.892) (-1362.955) (-1365.528) * (-1363.388) (-1365.989) (-1363.090) [-1363.584] -- 0:00:29 613000 -- (-1368.185) (-1365.198) (-1364.904) [-1361.997] * (-1365.276) (-1363.198) [-1362.679] (-1364.086) -- 0:00:29 613500 -- (-1368.627) [-1365.315] (-1363.867) (-1362.800) * (-1363.880) [-1366.626] (-1362.905) (-1364.617) -- 0:00:28 614000 -- (-1364.698) [-1363.380] (-1368.894) (-1365.653) * [-1364.136] (-1363.185) (-1363.475) (-1363.900) -- 0:00:28 614500 -- [-1365.075] (-1364.125) (-1365.521) (-1363.740) * (-1362.945) (-1367.518) [-1362.979] (-1363.789) -- 0:00:28 615000 -- (-1363.207) (-1363.149) (-1364.001) [-1365.221] * (-1363.319) (-1367.826) (-1364.827) [-1362.756] -- 0:00:28 Average standard deviation of split frequencies: 0.011884 615500 -- (-1362.979) [-1364.075] (-1362.701) (-1364.575) * (-1366.581) (-1363.497) (-1364.167) [-1364.168] -- 0:00:28 616000 -- (-1362.700) (-1363.102) (-1362.820) [-1364.772] * (-1365.305) (-1364.801) (-1365.308) [-1364.892] -- 0:00:28 616500 -- [-1364.976] (-1368.028) (-1362.714) (-1363.296) * (-1364.611) [-1370.728] (-1364.875) (-1365.749) -- 0:00:28 617000 -- [-1365.016] (-1365.155) (-1364.955) (-1363.438) * (-1364.097) (-1364.887) (-1367.952) [-1362.873] -- 0:00:28 617500 -- (-1364.058) (-1363.182) (-1363.848) [-1361.865] * (-1363.973) (-1366.902) [-1365.636] (-1364.205) -- 0:00:28 618000 -- (-1364.324) (-1362.977) [-1364.826] (-1365.076) * [-1365.936] (-1371.751) (-1363.686) (-1366.210) -- 0:00:28 618500 -- (-1363.668) (-1364.192) [-1363.791] (-1364.168) * (-1364.734) (-1365.687) [-1364.005] (-1365.445) -- 0:00:28 619000 -- (-1363.179) (-1363.895) (-1365.836) [-1363.470] * [-1365.226] (-1364.904) (-1366.215) (-1371.037) -- 0:00:28 619500 -- [-1365.042] (-1364.117) (-1366.484) (-1365.071) * (-1364.848) (-1365.746) (-1365.869) [-1366.729] -- 0:00:28 620000 -- (-1371.161) [-1363.903] (-1364.728) (-1365.283) * (-1362.294) [-1365.648] (-1362.744) (-1363.307) -- 0:00:28 Average standard deviation of split frequencies: 0.012018 620500 -- (-1369.736) (-1363.785) [-1368.091] (-1362.959) * (-1363.250) (-1363.159) (-1362.151) [-1364.357] -- 0:00:28 621000 -- (-1362.784) (-1363.341) (-1365.557) [-1363.214] * (-1362.251) (-1365.142) [-1364.031] (-1363.650) -- 0:00:28 621500 -- (-1366.960) (-1363.826) (-1363.013) [-1364.348] * [-1362.222] (-1363.971) (-1363.834) (-1369.655) -- 0:00:28 622000 -- (-1366.294) (-1363.852) (-1363.581) [-1364.233] * [-1362.651] (-1362.641) (-1362.926) (-1368.663) -- 0:00:28 622500 -- [-1363.765] (-1365.333) (-1364.556) (-1364.973) * (-1365.695) (-1366.179) [-1363.445] (-1362.293) -- 0:00:28 623000 -- [-1364.922] (-1362.793) (-1366.178) (-1363.351) * (-1368.673) [-1363.420] (-1364.107) (-1366.309) -- 0:00:28 623500 -- (-1363.709) (-1363.100) (-1363.139) [-1362.642] * [-1363.996] (-1362.924) (-1366.153) (-1365.537) -- 0:00:28 624000 -- (-1362.758) [-1366.503] (-1364.765) (-1364.465) * (-1367.022) (-1364.054) (-1362.187) [-1362.909] -- 0:00:28 624500 -- [-1363.788] (-1369.038) (-1364.006) (-1366.239) * [-1362.586] (-1364.857) (-1362.169) (-1365.128) -- 0:00:28 625000 -- (-1362.761) (-1367.309) (-1364.355) [-1365.954] * [-1362.798] (-1363.892) (-1363.854) (-1370.402) -- 0:00:28 Average standard deviation of split frequencies: 0.012004 625500 -- [-1362.843] (-1363.785) (-1366.828) (-1364.904) * (-1362.886) [-1364.494] (-1364.942) (-1367.324) -- 0:00:28 626000 -- [-1363.778] (-1362.489) (-1364.551) (-1365.969) * (-1365.353) [-1363.474] (-1365.689) (-1366.460) -- 0:00:28 626500 -- (-1363.301) (-1371.119) [-1364.579] (-1365.441) * (-1371.231) (-1366.413) (-1363.913) [-1369.517] -- 0:00:28 627000 -- (-1364.132) [-1367.225] (-1367.267) (-1364.013) * (-1368.947) [-1363.284] (-1363.895) (-1367.271) -- 0:00:27 627500 -- (-1366.725) [-1365.234] (-1364.248) (-1364.100) * [-1364.491] (-1363.233) (-1364.058) (-1363.818) -- 0:00:27 628000 -- (-1363.937) [-1362.496] (-1363.546) (-1364.433) * (-1365.023) [-1364.368] (-1363.918) (-1361.899) -- 0:00:27 628500 -- (-1368.503) [-1365.720] (-1362.439) (-1365.534) * (-1363.625) (-1365.925) (-1367.373) [-1361.929] -- 0:00:27 629000 -- (-1363.950) (-1363.268) (-1362.568) [-1365.069] * (-1366.355) (-1366.171) [-1364.151] (-1362.239) -- 0:00:27 629500 -- (-1363.118) [-1363.077] (-1363.699) (-1363.782) * [-1365.861] (-1363.519) (-1364.038) (-1368.614) -- 0:00:27 630000 -- (-1363.090) (-1362.478) [-1362.236] (-1364.830) * (-1365.136) (-1364.293) (-1362.773) [-1367.059] -- 0:00:27 Average standard deviation of split frequencies: 0.012091 630500 -- (-1364.985) (-1362.180) [-1362.827] (-1364.802) * (-1369.135) [-1364.784] (-1362.771) (-1364.767) -- 0:00:27 631000 -- [-1364.550] (-1362.995) (-1364.894) (-1364.032) * (-1364.401) (-1364.935) (-1366.484) [-1365.736] -- 0:00:27 631500 -- (-1365.287) (-1363.211) (-1364.362) [-1366.106] * (-1362.546) (-1364.157) [-1364.035] (-1366.349) -- 0:00:27 632000 -- (-1364.018) (-1365.055) [-1365.791] (-1365.594) * (-1362.392) (-1370.216) (-1363.681) [-1369.892] -- 0:00:27 632500 -- (-1366.723) (-1364.782) (-1363.155) [-1364.318] * [-1363.510] (-1363.678) (-1365.319) (-1366.385) -- 0:00:27 633000 -- (-1364.251) (-1362.449) (-1364.692) [-1365.526] * (-1362.609) (-1363.690) [-1362.880] (-1370.208) -- 0:00:27 633500 -- [-1365.532] (-1364.003) (-1364.362) (-1365.925) * [-1364.397] (-1364.732) (-1363.348) (-1368.504) -- 0:00:27 634000 -- (-1364.775) [-1363.565] (-1363.668) (-1366.198) * (-1364.426) (-1363.759) (-1365.660) [-1362.890] -- 0:00:27 634500 -- (-1363.749) (-1364.695) (-1371.401) [-1363.628] * (-1365.413) [-1364.137] (-1364.198) (-1366.296) -- 0:00:27 635000 -- (-1363.306) (-1364.622) [-1363.101] (-1363.352) * [-1364.479] (-1365.032) (-1363.015) (-1368.240) -- 0:00:27 Average standard deviation of split frequencies: 0.012208 635500 -- [-1363.495] (-1364.999) (-1371.642) (-1363.567) * (-1364.359) [-1363.019] (-1364.618) (-1362.986) -- 0:00:27 636000 -- (-1363.255) (-1367.972) [-1363.355] (-1363.742) * [-1362.448] (-1362.987) (-1362.434) (-1363.457) -- 0:00:27 636500 -- (-1362.637) (-1366.589) (-1362.882) [-1364.565] * (-1361.830) (-1362.870) [-1364.037] (-1364.226) -- 0:00:27 637000 -- (-1366.045) [-1365.345] (-1365.183) (-1364.516) * [-1364.419] (-1362.869) (-1364.060) (-1363.010) -- 0:00:27 637500 -- (-1366.641) (-1364.673) [-1367.488] (-1364.629) * (-1365.439) [-1363.840] (-1365.603) (-1363.430) -- 0:00:27 638000 -- (-1366.124) [-1367.804] (-1364.612) (-1362.986) * (-1364.649) (-1363.840) [-1365.213] (-1362.916) -- 0:00:27 638500 -- (-1363.996) (-1368.857) (-1364.128) [-1364.652] * [-1363.934] (-1364.673) (-1365.864) (-1363.033) -- 0:00:27 639000 -- (-1363.758) (-1364.461) (-1363.722) [-1364.559] * (-1363.446) [-1365.212] (-1365.137) (-1364.071) -- 0:00:27 639500 -- (-1365.274) (-1365.155) (-1362.757) [-1368.606] * (-1364.113) (-1363.532) [-1366.401] (-1362.973) -- 0:00:27 640000 -- (-1365.043) (-1365.307) [-1363.539] (-1364.881) * (-1363.162) (-1364.967) (-1363.352) [-1364.438] -- 0:00:26 Average standard deviation of split frequencies: 0.011989 640500 -- [-1364.289] (-1365.893) (-1362.956) (-1364.362) * (-1364.873) (-1365.645) (-1362.640) [-1364.735] -- 0:00:26 641000 -- (-1365.116) (-1365.166) (-1363.239) [-1365.227] * [-1364.445] (-1365.003) (-1362.595) (-1365.213) -- 0:00:26 641500 -- (-1366.747) [-1364.981] (-1363.889) (-1363.245) * [-1364.018] (-1364.946) (-1363.613) (-1363.033) -- 0:00:26 642000 -- (-1362.788) (-1363.085) (-1365.455) [-1364.528] * (-1364.870) (-1367.431) [-1365.629] (-1364.642) -- 0:00:26 642500 -- (-1365.470) (-1363.273) (-1366.743) [-1363.601] * (-1363.773) (-1363.604) (-1366.390) [-1363.129] -- 0:00:26 643000 -- (-1364.870) [-1363.319] (-1362.201) (-1364.004) * [-1364.393] (-1364.345) (-1363.745) (-1366.512) -- 0:00:26 643500 -- [-1366.494] (-1365.500) (-1362.297) (-1367.910) * [-1363.325] (-1365.287) (-1364.271) (-1364.738) -- 0:00:26 644000 -- (-1371.469) (-1362.797) [-1367.061] (-1363.310) * (-1364.144) (-1363.152) (-1364.368) [-1364.638] -- 0:00:26 644500 -- (-1364.708) (-1365.681) (-1364.475) [-1363.030] * (-1365.134) [-1363.529] (-1363.934) (-1363.752) -- 0:00:26 645000 -- (-1366.030) (-1365.192) (-1362.658) [-1365.851] * (-1363.990) (-1365.609) [-1364.130] (-1363.795) -- 0:00:26 Average standard deviation of split frequencies: 0.012234 645500 -- (-1366.760) (-1366.033) (-1362.967) [-1370.756] * (-1364.164) (-1362.900) [-1368.741] (-1368.675) -- 0:00:26 646000 -- (-1364.734) (-1367.284) (-1363.295) [-1365.310] * (-1366.063) [-1363.951] (-1363.931) (-1366.373) -- 0:00:26 646500 -- (-1366.105) (-1364.307) [-1363.402] (-1363.309) * [-1363.155] (-1362.596) (-1368.319) (-1363.042) -- 0:00:26 647000 -- (-1366.547) (-1363.457) (-1366.374) [-1365.181] * (-1365.326) [-1364.583] (-1364.932) (-1365.279) -- 0:00:26 647500 -- (-1364.272) [-1365.052] (-1364.433) (-1363.072) * (-1368.443) (-1362.554) (-1365.370) [-1363.866] -- 0:00:26 648000 -- (-1365.009) [-1364.023] (-1364.265) (-1364.122) * (-1364.626) [-1363.191] (-1366.467) (-1364.069) -- 0:00:26 648500 -- (-1364.623) (-1363.071) [-1364.123] (-1362.671) * (-1371.920) (-1363.855) [-1368.987] (-1363.862) -- 0:00:26 649000 -- [-1365.674] (-1364.733) (-1363.788) (-1362.820) * (-1364.401) [-1365.651] (-1368.180) (-1363.159) -- 0:00:26 649500 -- [-1362.803] (-1364.918) (-1369.035) (-1364.551) * (-1368.025) (-1367.923) (-1363.397) [-1365.422] -- 0:00:26 650000 -- (-1363.562) (-1364.990) [-1365.728] (-1362.538) * (-1368.112) [-1364.640] (-1362.954) (-1363.311) -- 0:00:26 Average standard deviation of split frequencies: 0.012146 650500 -- [-1363.725] (-1366.818) (-1363.943) (-1363.450) * [-1366.668] (-1364.771) (-1362.222) (-1362.852) -- 0:00:26 651000 -- (-1362.481) (-1366.919) [-1363.943] (-1363.782) * [-1364.606] (-1368.373) (-1362.746) (-1365.511) -- 0:00:26 651500 -- [-1368.658] (-1365.649) (-1363.847) (-1362.700) * [-1364.473] (-1363.145) (-1363.822) (-1369.391) -- 0:00:26 652000 -- (-1366.356) (-1363.786) (-1364.502) [-1363.332] * [-1368.237] (-1368.928) (-1362.796) (-1365.024) -- 0:00:26 652500 -- (-1366.186) (-1366.527) (-1363.204) [-1364.177] * (-1367.547) [-1367.116] (-1364.598) (-1365.263) -- 0:00:26 653000 -- (-1364.267) [-1367.342] (-1362.771) (-1364.259) * [-1362.541] (-1369.108) (-1366.875) (-1362.919) -- 0:00:26 653500 -- (-1364.890) (-1365.199) [-1362.201] (-1363.863) * [-1362.461] (-1363.140) (-1364.608) (-1365.061) -- 0:00:25 654000 -- [-1364.648] (-1368.430) (-1363.399) (-1362.531) * (-1363.616) (-1362.765) [-1363.814] (-1364.820) -- 0:00:25 654500 -- (-1364.026) (-1367.378) (-1363.020) [-1362.490] * (-1366.728) (-1368.476) [-1364.144] (-1367.372) -- 0:00:25 655000 -- (-1363.429) (-1366.890) [-1364.065] (-1362.758) * (-1368.617) [-1365.039] (-1367.202) (-1367.632) -- 0:00:25 Average standard deviation of split frequencies: 0.012259 655500 -- (-1362.362) [-1365.558] (-1363.702) (-1363.445) * (-1365.608) [-1363.707] (-1364.804) (-1368.620) -- 0:00:25 656000 -- (-1365.863) (-1364.051) [-1363.359] (-1364.524) * (-1366.820) [-1362.311] (-1364.037) (-1364.966) -- 0:00:25 656500 -- (-1363.929) (-1364.089) (-1368.653) [-1362.243] * (-1373.516) (-1363.270) [-1363.745] (-1364.161) -- 0:00:25 657000 -- (-1365.582) (-1370.080) (-1365.655) [-1362.274] * (-1369.930) [-1362.915] (-1369.366) (-1362.724) -- 0:00:25 657500 -- [-1366.670] (-1365.778) (-1363.932) (-1362.237) * (-1370.778) (-1362.242) [-1363.719] (-1365.764) -- 0:00:25 658000 -- (-1365.610) (-1369.876) (-1362.968) [-1363.494] * (-1372.704) (-1362.380) [-1366.283] (-1364.495) -- 0:00:25 658500 -- (-1364.464) [-1365.611] (-1362.467) (-1363.803) * (-1364.907) (-1364.875) (-1367.036) [-1363.536] -- 0:00:25 659000 -- [-1364.032] (-1363.616) (-1362.333) (-1364.440) * (-1364.745) [-1364.886] (-1363.052) (-1365.011) -- 0:00:25 659500 -- (-1366.462) [-1363.819] (-1365.003) (-1364.177) * (-1363.462) [-1363.584] (-1363.888) (-1365.373) -- 0:00:25 660000 -- (-1362.452) (-1364.350) (-1365.358) [-1366.210] * (-1365.026) (-1362.517) [-1366.329] (-1364.951) -- 0:00:25 Average standard deviation of split frequencies: 0.011878 660500 -- (-1365.502) (-1363.854) [-1366.054] (-1366.676) * (-1364.290) [-1362.658] (-1364.559) (-1363.759) -- 0:00:25 661000 -- (-1364.824) (-1364.610) (-1362.946) [-1365.477] * (-1366.309) (-1363.215) (-1363.640) [-1363.669] -- 0:00:25 661500 -- (-1366.004) [-1365.600] (-1362.928) (-1364.079) * (-1362.206) (-1363.288) (-1365.404) [-1366.318] -- 0:00:25 662000 -- (-1363.412) [-1367.154] (-1362.941) (-1365.146) * (-1366.095) (-1364.610) (-1368.389) [-1364.945] -- 0:00:25 662500 -- (-1362.980) [-1368.180] (-1366.924) (-1363.500) * (-1365.772) (-1363.230) [-1362.864] (-1365.167) -- 0:00:25 663000 -- [-1363.898] (-1368.404) (-1363.159) (-1362.880) * (-1365.861) [-1362.852] (-1362.489) (-1364.848) -- 0:00:25 663500 -- (-1363.999) (-1365.600) (-1363.596) [-1365.715] * (-1365.279) (-1365.552) [-1367.277] (-1363.083) -- 0:00:25 664000 -- [-1363.628] (-1364.566) (-1363.303) (-1364.674) * (-1363.747) (-1371.911) [-1363.106] (-1362.587) -- 0:00:25 664500 -- (-1363.533) [-1367.797] (-1363.147) (-1364.491) * (-1362.406) [-1367.458] (-1363.225) (-1367.901) -- 0:00:25 665000 -- (-1365.639) (-1367.258) (-1363.856) [-1363.709] * (-1363.588) (-1362.849) (-1362.728) [-1367.731] -- 0:00:25 Average standard deviation of split frequencies: 0.012033 665500 -- (-1365.907) (-1370.450) [-1364.609] (-1363.161) * [-1364.822] (-1363.360) (-1362.147) (-1366.917) -- 0:00:25 666000 -- (-1371.010) [-1365.634] (-1362.509) (-1362.139) * (-1366.233) [-1363.178] (-1365.775) (-1367.649) -- 0:00:25 666500 -- (-1368.798) (-1363.453) [-1362.900] (-1363.353) * (-1363.729) [-1363.789] (-1365.124) (-1365.941) -- 0:00:25 667000 -- (-1365.580) (-1365.064) [-1362.710] (-1363.055) * (-1363.170) (-1365.092) [-1365.659] (-1364.050) -- 0:00:24 667500 -- (-1364.438) [-1363.639] (-1364.407) (-1363.808) * (-1369.147) (-1368.185) [-1367.991] (-1366.479) -- 0:00:24 668000 -- (-1368.435) (-1364.858) [-1363.820] (-1366.902) * (-1368.183) [-1364.876] (-1363.986) (-1365.245) -- 0:00:24 668500 -- (-1363.943) (-1362.371) (-1365.078) [-1365.494] * (-1366.286) (-1363.669) [-1363.690] (-1363.012) -- 0:00:24 669000 -- [-1366.386] (-1361.846) (-1364.760) (-1364.526) * (-1366.131) [-1363.658] (-1366.065) (-1363.159) -- 0:00:24 669500 -- (-1380.239) (-1364.646) [-1363.852] (-1362.799) * [-1364.276] (-1362.721) (-1366.036) (-1366.103) -- 0:00:24 670000 -- (-1380.606) (-1366.212) [-1369.588] (-1363.515) * (-1362.843) [-1363.924] (-1363.708) (-1364.682) -- 0:00:24 Average standard deviation of split frequencies: 0.011784 670500 -- (-1382.972) [-1364.020] (-1366.917) (-1363.952) * (-1362.857) (-1363.955) (-1364.252) [-1366.281] -- 0:00:24 671000 -- (-1365.345) [-1363.470] (-1365.220) (-1365.469) * (-1363.991) [-1366.562] (-1362.467) (-1364.131) -- 0:00:24 671500 -- (-1362.843) (-1364.118) [-1365.291] (-1362.965) * (-1364.756) (-1367.404) [-1362.539] (-1367.071) -- 0:00:24 672000 -- [-1362.649] (-1364.116) (-1365.433) (-1362.847) * (-1365.389) (-1363.368) [-1365.598] (-1363.325) -- 0:00:24 672500 -- (-1364.208) (-1363.474) [-1362.127] (-1363.376) * (-1364.558) (-1364.837) [-1362.423] (-1367.205) -- 0:00:24 673000 -- (-1365.538) (-1362.310) [-1362.610] (-1363.222) * (-1365.827) (-1364.402) (-1363.642) [-1363.964] -- 0:00:24 673500 -- (-1365.381) (-1362.644) [-1363.614] (-1364.980) * (-1368.087) (-1363.516) (-1363.706) [-1362.555] -- 0:00:24 674000 -- [-1363.142] (-1364.228) (-1365.031) (-1365.597) * (-1367.175) [-1362.987] (-1365.879) (-1366.882) -- 0:00:24 674500 -- (-1367.037) (-1368.005) [-1365.401] (-1366.012) * (-1365.143) (-1362.902) [-1364.025] (-1362.988) -- 0:00:24 675000 -- (-1364.342) (-1370.505) [-1364.210] (-1366.255) * (-1365.515) (-1365.034) (-1364.654) [-1366.112] -- 0:00:24 Average standard deviation of split frequencies: 0.011363 675500 -- [-1364.939] (-1367.358) (-1366.191) (-1364.202) * [-1364.112] (-1363.090) (-1368.057) (-1366.854) -- 0:00:24 676000 -- (-1365.135) (-1362.807) (-1364.276) [-1363.205] * (-1366.918) (-1366.105) (-1369.018) [-1362.878] -- 0:00:24 676500 -- (-1366.288) (-1364.108) [-1365.736] (-1363.232) * (-1366.820) [-1364.977] (-1369.413) (-1363.383) -- 0:00:24 677000 -- (-1363.630) (-1364.619) (-1363.935) [-1365.111] * (-1365.385) (-1366.129) (-1362.768) [-1364.895] -- 0:00:24 677500 -- [-1363.804] (-1364.705) (-1364.746) (-1370.015) * [-1365.174] (-1364.657) (-1363.533) (-1363.360) -- 0:00:24 678000 -- [-1363.647] (-1369.869) (-1364.031) (-1363.134) * (-1364.673) (-1362.460) [-1363.816] (-1364.284) -- 0:00:24 678500 -- [-1363.878] (-1370.384) (-1365.891) (-1363.275) * (-1365.122) [-1362.445] (-1362.096) (-1366.124) -- 0:00:24 679000 -- [-1362.921] (-1363.915) (-1365.650) (-1363.126) * (-1363.197) (-1363.542) (-1363.539) [-1364.375] -- 0:00:24 679500 -- [-1363.575] (-1363.217) (-1366.544) (-1364.265) * (-1365.543) (-1368.635) (-1367.710) [-1362.309] -- 0:00:24 680000 -- (-1364.946) [-1362.418] (-1368.499) (-1363.359) * [-1364.910] (-1365.423) (-1369.186) (-1362.822) -- 0:00:23 Average standard deviation of split frequencies: 0.011325 680500 -- (-1365.237) (-1364.685) (-1368.751) [-1363.129] * (-1364.894) (-1363.510) (-1369.389) [-1364.509] -- 0:00:23 681000 -- (-1362.861) (-1365.843) (-1366.413) [-1367.384] * (-1362.164) [-1363.827] (-1365.755) (-1363.805) -- 0:00:23 681500 -- (-1363.445) (-1365.465) [-1365.772] (-1365.578) * (-1363.664) (-1366.252) [-1365.809] (-1365.279) -- 0:00:23 682000 -- (-1363.776) (-1363.024) (-1364.058) [-1370.304] * [-1364.761] (-1363.777) (-1364.279) (-1365.962) -- 0:00:23 682500 -- [-1363.628] (-1366.371) (-1366.169) (-1365.134) * (-1366.481) (-1366.350) [-1364.281] (-1365.821) -- 0:00:23 683000 -- (-1363.948) (-1363.238) [-1367.929] (-1364.131) * [-1362.010] (-1367.560) (-1364.821) (-1365.136) -- 0:00:23 683500 -- (-1364.609) (-1364.733) [-1364.929] (-1363.831) * (-1367.847) (-1367.351) [-1362.451] (-1364.691) -- 0:00:23 684000 -- (-1364.618) (-1365.436) (-1365.039) [-1367.328] * (-1363.309) (-1365.559) [-1364.151] (-1370.766) -- 0:00:23 684500 -- [-1363.045] (-1365.490) (-1363.825) (-1366.468) * [-1363.500] (-1367.515) (-1364.459) (-1372.635) -- 0:00:23 685000 -- (-1363.970) (-1365.248) [-1362.884] (-1365.285) * (-1366.193) [-1368.935] (-1366.186) (-1368.304) -- 0:00:23 Average standard deviation of split frequencies: 0.010752 685500 -- [-1363.677] (-1362.425) (-1363.247) (-1364.157) * (-1365.851) (-1362.303) [-1363.366] (-1369.406) -- 0:00:23 686000 -- (-1365.035) (-1362.892) [-1366.047] (-1368.633) * [-1364.371] (-1362.948) (-1363.100) (-1365.373) -- 0:00:23 686500 -- (-1370.900) (-1362.914) [-1362.840] (-1364.753) * (-1366.056) (-1364.699) (-1363.986) [-1367.180] -- 0:00:23 687000 -- [-1367.224] (-1362.873) (-1363.136) (-1364.230) * (-1362.230) (-1364.099) [-1365.370] (-1363.525) -- 0:00:23 687500 -- (-1367.845) (-1363.468) (-1365.465) [-1364.031] * [-1362.061] (-1365.724) (-1364.754) (-1365.647) -- 0:00:23 688000 -- (-1366.282) (-1365.241) [-1364.101] (-1364.495) * [-1364.405] (-1364.312) (-1366.533) (-1362.823) -- 0:00:23 688500 -- (-1364.095) [-1366.541] (-1367.429) (-1365.057) * (-1367.096) (-1367.964) (-1364.103) [-1361.881] -- 0:00:23 689000 -- (-1363.268) (-1363.341) (-1363.259) [-1363.061] * (-1364.673) (-1366.832) (-1367.638) [-1365.156] -- 0:00:23 689500 -- (-1363.593) (-1369.028) (-1362.575) [-1364.023] * (-1363.223) (-1362.452) (-1363.402) [-1364.505] -- 0:00:23 690000 -- [-1364.767] (-1363.835) (-1363.133) (-1362.219) * (-1362.463) (-1363.358) (-1362.697) [-1364.754] -- 0:00:23 Average standard deviation of split frequencies: 0.010599 690500 -- (-1367.531) [-1362.089] (-1363.702) (-1362.094) * (-1364.230) (-1365.165) [-1364.768] (-1363.855) -- 0:00:23 691000 -- (-1368.299) (-1362.407) (-1363.895) [-1362.528] * (-1362.387) (-1365.527) [-1364.595] (-1363.246) -- 0:00:23 691500 -- (-1363.439) (-1364.276) (-1366.424) [-1362.713] * (-1363.990) (-1364.213) [-1364.326] (-1362.983) -- 0:00:23 692000 -- (-1363.204) (-1364.024) [-1366.624] (-1367.166) * (-1365.886) [-1364.065] (-1366.632) (-1365.244) -- 0:00:23 692500 -- [-1363.139] (-1363.619) (-1364.796) (-1362.637) * (-1363.850) (-1363.821) (-1365.245) [-1363.828] -- 0:00:23 693000 -- [-1362.939] (-1365.060) (-1366.550) (-1364.162) * [-1364.203] (-1363.679) (-1362.610) (-1366.235) -- 0:00:23 693500 -- [-1362.194] (-1365.620) (-1364.002) (-1364.011) * [-1363.465] (-1365.114) (-1363.612) (-1365.781) -- 0:00:22 694000 -- (-1365.168) (-1365.777) [-1363.371] (-1366.043) * [-1363.903] (-1365.163) (-1365.438) (-1364.880) -- 0:00:22 694500 -- (-1365.814) [-1365.713] (-1364.419) (-1363.422) * (-1364.986) [-1366.307] (-1367.098) (-1363.966) -- 0:00:22 695000 -- (-1364.456) [-1366.832] (-1362.196) (-1364.500) * (-1367.805) [-1363.201] (-1365.395) (-1365.304) -- 0:00:22 Average standard deviation of split frequencies: 0.009721 695500 -- (-1365.946) [-1362.523] (-1366.539) (-1364.314) * (-1366.061) (-1363.889) (-1364.744) [-1365.209] -- 0:00:22 696000 -- (-1365.011) [-1362.776] (-1363.869) (-1363.948) * [-1363.992] (-1363.454) (-1362.886) (-1363.644) -- 0:00:22 696500 -- [-1362.256] (-1365.759) (-1364.364) (-1362.468) * (-1364.822) (-1363.786) (-1363.500) [-1363.143] -- 0:00:22 697000 -- (-1365.075) (-1369.778) [-1364.305] (-1365.464) * [-1363.857] (-1364.075) (-1365.532) (-1362.613) -- 0:00:22 697500 -- (-1367.972) (-1368.920) (-1365.350) [-1369.099] * [-1365.406] (-1366.490) (-1364.133) (-1367.360) -- 0:00:22 698000 -- (-1364.741) (-1364.024) [-1365.405] (-1366.002) * [-1363.630] (-1365.914) (-1365.515) (-1364.777) -- 0:00:22 698500 -- (-1364.653) [-1366.737] (-1366.509) (-1364.032) * (-1363.961) (-1366.056) [-1365.414] (-1363.365) -- 0:00:22 699000 -- [-1366.131] (-1364.984) (-1364.961) (-1363.449) * (-1365.135) (-1368.300) [-1363.899] (-1364.527) -- 0:00:22 699500 -- (-1365.128) (-1364.304) [-1367.039] (-1363.017) * (-1368.997) (-1362.777) [-1364.585] (-1362.592) -- 0:00:22 700000 -- (-1364.858) (-1363.718) [-1364.785] (-1362.782) * (-1362.613) (-1364.113) [-1364.797] (-1363.039) -- 0:00:22 Average standard deviation of split frequencies: 0.009419 700500 -- [-1364.239] (-1364.124) (-1365.644) (-1365.812) * (-1365.523) (-1363.795) [-1365.777] (-1366.326) -- 0:00:22 701000 -- [-1362.666] (-1366.484) (-1366.168) (-1365.995) * [-1363.349] (-1364.793) (-1366.230) (-1368.232) -- 0:00:22 701500 -- (-1363.529) (-1363.670) (-1363.412) [-1362.285] * [-1363.690] (-1364.644) (-1365.400) (-1367.061) -- 0:00:22 702000 -- (-1363.386) (-1364.118) [-1364.103] (-1362.228) * [-1363.005] (-1363.730) (-1363.849) (-1367.570) -- 0:00:22 702500 -- (-1363.961) [-1363.085] (-1364.093) (-1363.392) * (-1362.701) (-1363.749) [-1364.167] (-1363.917) -- 0:00:22 703000 -- [-1363.356] (-1363.354) (-1365.821) (-1363.508) * (-1366.308) [-1362.461] (-1362.551) (-1366.028) -- 0:00:22 703500 -- [-1365.824] (-1364.196) (-1364.142) (-1363.971) * (-1363.843) [-1362.302] (-1362.217) (-1362.938) -- 0:00:22 704000 -- (-1363.847) (-1364.972) [-1366.540] (-1363.176) * (-1366.072) (-1364.088) (-1363.960) [-1363.697] -- 0:00:22 704500 -- (-1363.498) [-1368.548] (-1367.120) (-1362.996) * (-1365.424) [-1363.495] (-1365.649) (-1364.088) -- 0:00:22 705000 -- (-1365.299) (-1364.256) [-1363.419] (-1364.982) * (-1369.296) [-1365.370] (-1365.627) (-1367.078) -- 0:00:22 Average standard deviation of split frequencies: 0.009152 705500 -- (-1364.127) (-1363.549) [-1362.938] (-1363.593) * [-1365.310] (-1364.722) (-1364.168) (-1364.411) -- 0:00:22 706000 -- [-1363.892] (-1363.381) (-1363.345) (-1362.268) * (-1366.026) (-1364.401) [-1367.731] (-1365.148) -- 0:00:22 706500 -- (-1364.136) [-1368.179] (-1364.619) (-1362.246) * (-1362.854) [-1365.343] (-1366.322) (-1364.397) -- 0:00:22 707000 -- (-1364.124) (-1363.779) (-1366.551) [-1362.292] * [-1365.177] (-1363.996) (-1363.452) (-1362.732) -- 0:00:21 707500 -- (-1369.402) (-1366.500) (-1365.949) [-1362.912] * (-1363.109) (-1363.839) (-1364.757) [-1362.400] -- 0:00:21 708000 -- (-1364.633) [-1364.031] (-1364.772) (-1362.864) * (-1363.634) (-1365.414) (-1364.727) [-1365.172] -- 0:00:21 708500 -- (-1364.113) (-1363.371) (-1363.543) [-1362.566] * [-1369.078] (-1363.599) (-1365.280) (-1366.045) -- 0:00:21 709000 -- (-1363.143) [-1368.014] (-1363.540) (-1363.228) * (-1365.334) (-1365.144) (-1363.830) [-1362.260] -- 0:00:21 709500 -- (-1365.379) (-1367.752) (-1362.754) [-1362.940] * (-1366.222) (-1366.043) (-1376.665) [-1362.792] -- 0:00:21 710000 -- (-1363.555) (-1364.654) [-1365.736] (-1363.885) * [-1364.331] (-1364.445) (-1365.423) (-1368.656) -- 0:00:21 Average standard deviation of split frequencies: 0.009209 710500 -- (-1362.816) (-1363.180) (-1362.153) [-1363.476] * (-1365.939) (-1367.109) (-1363.853) [-1364.599] -- 0:00:21 711000 -- (-1363.698) (-1363.128) [-1362.865] (-1362.543) * (-1363.569) (-1367.753) [-1362.380] (-1363.804) -- 0:00:21 711500 -- [-1363.545] (-1363.394) (-1365.823) (-1367.769) * [-1364.490] (-1364.275) (-1363.034) (-1362.817) -- 0:00:21 712000 -- (-1362.499) (-1367.334) (-1364.248) [-1364.115] * (-1362.681) (-1365.850) [-1362.964] (-1363.079) -- 0:00:21 712500 -- [-1364.362] (-1368.227) (-1364.301) (-1363.706) * (-1364.030) [-1364.815] (-1362.952) (-1364.314) -- 0:00:21 713000 -- (-1367.648) (-1369.863) [-1362.864] (-1363.181) * (-1363.119) (-1365.938) [-1363.167] (-1363.550) -- 0:00:21 713500 -- (-1369.003) [-1367.223] (-1364.155) (-1363.699) * (-1369.629) (-1363.099) (-1363.647) [-1363.684] -- 0:00:21 714000 -- (-1363.807) (-1365.644) [-1362.620] (-1363.273) * (-1369.095) (-1364.411) [-1362.106] (-1363.531) -- 0:00:21 714500 -- (-1365.498) (-1363.286) (-1364.860) [-1364.327] * (-1366.199) (-1365.594) [-1361.894] (-1363.898) -- 0:00:21 715000 -- (-1365.081) [-1368.625] (-1363.415) (-1363.017) * (-1363.132) [-1363.475] (-1365.017) (-1364.978) -- 0:00:21 Average standard deviation of split frequencies: 0.009179 715500 -- (-1365.293) [-1369.713] (-1363.689) (-1362.925) * (-1363.641) [-1363.551] (-1364.884) (-1366.501) -- 0:00:21 716000 -- (-1364.973) (-1363.260) [-1364.960] (-1368.196) * (-1367.152) (-1363.460) [-1364.860] (-1364.602) -- 0:00:21 716500 -- [-1362.354] (-1363.360) (-1363.504) (-1366.623) * (-1371.167) (-1366.470) [-1363.656] (-1362.960) -- 0:00:21 717000 -- (-1363.137) (-1368.158) (-1362.524) [-1364.286] * [-1367.579] (-1366.343) (-1363.390) (-1365.343) -- 0:00:21 717500 -- (-1367.244) (-1363.698) [-1362.401] (-1363.393) * (-1364.910) (-1368.677) [-1367.400] (-1366.338) -- 0:00:21 718000 -- (-1363.736) [-1363.447] (-1362.401) (-1365.307) * (-1365.557) (-1364.278) (-1366.109) [-1362.488] -- 0:00:21 718500 -- [-1364.125] (-1366.410) (-1363.687) (-1362.341) * [-1366.296] (-1365.716) (-1363.563) (-1364.174) -- 0:00:21 719000 -- (-1362.982) (-1363.875) (-1364.915) [-1363.488] * (-1363.875) [-1364.219] (-1364.692) (-1363.134) -- 0:00:21 719500 -- (-1364.801) (-1364.065) [-1369.156] (-1364.271) * (-1367.702) [-1362.730] (-1365.649) (-1363.527) -- 0:00:21 720000 -- (-1365.764) (-1364.536) [-1364.984] (-1362.527) * (-1364.923) [-1362.319] (-1368.498) (-1363.648) -- 0:00:20 Average standard deviation of split frequencies: 0.009542 720500 -- (-1369.234) [-1363.398] (-1362.679) (-1363.532) * (-1367.687) (-1364.846) (-1366.018) [-1362.991] -- 0:00:20 721000 -- [-1364.710] (-1364.697) (-1365.686) (-1363.437) * [-1363.214] (-1365.326) (-1366.167) (-1363.008) -- 0:00:20 721500 -- [-1362.316] (-1366.550) (-1362.431) (-1366.034) * (-1364.757) [-1364.178] (-1366.299) (-1364.429) -- 0:00:20 722000 -- (-1363.115) (-1366.417) [-1364.067] (-1368.377) * (-1364.617) (-1364.092) (-1363.165) [-1366.014] -- 0:00:20 722500 -- (-1366.266) [-1364.765] (-1362.804) (-1367.428) * [-1362.635] (-1362.824) (-1363.625) (-1365.295) -- 0:00:20 723000 -- (-1364.718) (-1366.698) (-1364.515) [-1363.221] * (-1365.490) (-1363.954) (-1365.644) [-1363.234] -- 0:00:20 723500 -- (-1364.730) [-1367.026] (-1365.840) (-1364.130) * [-1366.457] (-1366.344) (-1364.357) (-1363.329) -- 0:00:20 724000 -- (-1362.769) (-1362.158) [-1363.050] (-1363.901) * (-1364.347) (-1366.001) [-1365.614] (-1362.345) -- 0:00:20 724500 -- (-1362.667) [-1363.589] (-1363.628) (-1362.755) * (-1364.024) [-1363.912] (-1364.933) (-1362.483) -- 0:00:20 725000 -- (-1364.760) (-1364.848) [-1364.170] (-1365.587) * (-1364.712) (-1363.912) [-1365.072] (-1366.179) -- 0:00:20 Average standard deviation of split frequencies: 0.009778 725500 -- [-1363.911] (-1363.716) (-1366.814) (-1367.383) * (-1363.937) [-1363.682] (-1366.624) (-1366.528) -- 0:00:20 726000 -- (-1366.518) [-1363.303] (-1362.365) (-1363.414) * [-1364.038] (-1363.026) (-1364.340) (-1365.925) -- 0:00:20 726500 -- [-1366.309] (-1362.536) (-1362.888) (-1367.493) * (-1364.193) [-1365.124] (-1364.231) (-1365.331) -- 0:00:20 727000 -- [-1362.697] (-1364.079) (-1363.469) (-1362.855) * (-1364.580) [-1363.209] (-1362.935) (-1369.082) -- 0:00:20 727500 -- [-1363.731] (-1365.110) (-1363.847) (-1364.962) * (-1364.589) (-1363.273) (-1365.936) [-1362.854] -- 0:00:20 728000 -- (-1367.772) (-1362.712) [-1367.943] (-1365.117) * (-1363.766) (-1363.922) (-1363.719) [-1363.844] -- 0:00:20 728500 -- (-1363.313) (-1362.551) [-1364.252] (-1362.630) * (-1364.214) [-1364.302] (-1367.561) (-1365.045) -- 0:00:20 729000 -- (-1362.476) (-1365.456) [-1364.428] (-1363.779) * (-1365.243) (-1364.116) [-1366.494] (-1367.739) -- 0:00:20 729500 -- (-1364.206) (-1364.038) (-1364.521) [-1364.866] * (-1364.407) [-1362.655] (-1362.982) (-1362.476) -- 0:00:20 730000 -- (-1363.711) (-1363.162) [-1364.890] (-1366.725) * (-1366.387) (-1362.784) [-1363.806] (-1363.045) -- 0:00:20 Average standard deviation of split frequencies: 0.010209 730500 -- (-1365.448) [-1363.545] (-1370.207) (-1365.267) * (-1367.141) [-1365.703] (-1365.728) (-1363.011) -- 0:00:20 731000 -- (-1363.662) [-1364.031] (-1366.390) (-1365.227) * [-1363.873] (-1367.746) (-1366.753) (-1364.334) -- 0:00:20 731500 -- (-1362.908) (-1364.751) [-1362.959] (-1364.787) * (-1364.305) [-1364.671] (-1363.224) (-1364.016) -- 0:00:20 732000 -- [-1365.648] (-1368.462) (-1362.892) (-1362.601) * (-1364.745) [-1364.063] (-1362.331) (-1363.324) -- 0:00:20 732500 -- (-1365.632) (-1365.394) [-1363.181] (-1362.521) * (-1364.356) [-1365.288] (-1366.646) (-1364.589) -- 0:00:20 733000 -- [-1367.104] (-1365.162) (-1363.904) (-1362.505) * [-1363.385] (-1364.131) (-1362.472) (-1364.798) -- 0:00:20 733500 -- (-1361.969) (-1363.865) (-1365.224) [-1366.168] * (-1365.938) [-1362.228] (-1363.863) (-1365.147) -- 0:00:19 734000 -- (-1368.840) (-1363.790) (-1363.984) [-1367.665] * (-1367.456) [-1362.847] (-1367.567) (-1366.169) -- 0:00:19 734500 -- (-1363.746) (-1363.864) [-1363.519] (-1367.508) * (-1366.468) (-1362.850) [-1362.714] (-1364.336) -- 0:00:19 735000 -- (-1368.793) (-1362.829) (-1363.448) [-1366.451] * (-1364.268) (-1362.710) [-1363.799] (-1363.127) -- 0:00:19 Average standard deviation of split frequencies: 0.010060 735500 -- [-1363.456] (-1364.320) (-1363.529) (-1367.260) * (-1365.151) (-1365.845) [-1364.399] (-1363.308) -- 0:00:19 736000 -- (-1366.695) (-1365.055) [-1366.891] (-1366.990) * (-1363.139) (-1367.490) [-1364.677] (-1363.639) -- 0:00:19 736500 -- (-1365.946) [-1364.998] (-1366.242) (-1368.934) * [-1363.160] (-1363.150) (-1363.091) (-1366.521) -- 0:00:19 737000 -- (-1365.320) (-1363.887) [-1364.897] (-1363.821) * (-1363.024) (-1362.265) (-1364.562) [-1365.236] -- 0:00:19 737500 -- (-1366.346) [-1362.805] (-1363.838) (-1366.852) * (-1362.379) (-1363.375) (-1362.196) [-1364.641] -- 0:00:19 738000 -- (-1363.035) (-1364.955) [-1364.134] (-1367.990) * [-1362.840] (-1364.388) (-1363.238) (-1365.167) -- 0:00:19 738500 -- (-1365.205) [-1362.528] (-1363.440) (-1366.665) * (-1363.545) (-1364.830) (-1363.028) [-1365.372] -- 0:00:19 739000 -- (-1367.290) (-1364.951) (-1365.683) [-1365.151] * (-1364.466) [-1362.950] (-1366.098) (-1364.673) -- 0:00:19 739500 -- (-1361.847) (-1366.236) [-1366.416] (-1364.176) * (-1365.100) (-1366.022) (-1366.605) [-1364.799] -- 0:00:19 740000 -- (-1362.724) [-1363.618] (-1364.825) (-1366.568) * (-1364.001) (-1362.769) [-1363.034] (-1363.541) -- 0:00:19 Average standard deviation of split frequencies: 0.009247 740500 -- (-1363.560) (-1364.590) (-1364.709) [-1364.409] * (-1363.806) (-1363.500) [-1364.399] (-1363.873) -- 0:00:19 741000 -- (-1363.907) (-1367.586) [-1367.718] (-1363.206) * (-1364.554) (-1364.949) [-1364.591] (-1365.325) -- 0:00:19 741500 -- [-1364.432] (-1367.932) (-1368.173) (-1363.715) * (-1364.105) (-1362.232) (-1366.269) [-1362.872] -- 0:00:19 742000 -- (-1362.666) [-1365.030] (-1363.225) (-1363.137) * (-1365.719) (-1363.091) (-1371.083) [-1366.496] -- 0:00:19 742500 -- (-1363.876) [-1362.657] (-1363.215) (-1367.267) * (-1364.431) [-1363.337] (-1364.582) (-1364.034) -- 0:00:19 743000 -- (-1364.972) (-1365.840) (-1364.928) [-1363.623] * (-1365.049) (-1366.082) (-1368.611) [-1365.828] -- 0:00:19 743500 -- (-1363.995) (-1371.141) (-1364.776) [-1365.824] * (-1367.467) (-1365.337) [-1363.107] (-1364.593) -- 0:00:19 744000 -- [-1364.785] (-1364.115) (-1368.367) (-1364.319) * (-1363.579) [-1365.587] (-1363.964) (-1365.129) -- 0:00:19 744500 -- (-1364.959) (-1363.689) (-1361.877) [-1365.498] * [-1364.957] (-1364.376) (-1366.762) (-1363.275) -- 0:00:19 745000 -- (-1362.482) (-1363.739) (-1364.548) [-1364.646] * (-1364.875) (-1365.245) [-1364.061] (-1362.256) -- 0:00:19 Average standard deviation of split frequencies: 0.009516 745500 -- (-1363.722) (-1363.397) [-1364.619] (-1364.624) * [-1363.458] (-1377.248) (-1366.515) (-1363.745) -- 0:00:19 746000 -- (-1362.857) (-1365.691) [-1364.561] (-1363.772) * (-1366.653) (-1366.874) (-1362.924) [-1363.713] -- 0:00:19 746500 -- (-1363.752) [-1366.579] (-1364.375) (-1364.306) * (-1365.607) [-1364.202] (-1362.801) (-1364.541) -- 0:00:19 747000 -- (-1364.479) (-1364.024) (-1366.630) [-1364.970] * (-1370.680) (-1364.062) (-1362.483) [-1364.461] -- 0:00:18 747500 -- (-1364.605) (-1363.432) [-1362.943] (-1366.446) * [-1368.414] (-1362.424) (-1362.398) (-1366.004) -- 0:00:18 748000 -- (-1364.104) (-1362.753) (-1364.648) [-1363.794] * (-1364.661) (-1366.976) (-1362.329) [-1367.260] -- 0:00:18 748500 -- (-1363.538) [-1362.758] (-1364.890) (-1362.956) * (-1364.793) (-1370.858) (-1364.398) [-1365.560] -- 0:00:18 749000 -- (-1366.074) [-1363.051] (-1367.744) (-1365.012) * [-1363.702] (-1366.379) (-1366.979) (-1364.520) -- 0:00:18 749500 -- (-1367.007) (-1363.285) (-1362.593) [-1363.796] * [-1362.599] (-1365.313) (-1363.648) (-1364.375) -- 0:00:18 750000 -- (-1368.737) [-1365.716] (-1367.652) (-1362.774) * (-1363.087) (-1367.560) [-1362.368] (-1363.811) -- 0:00:18 Average standard deviation of split frequencies: 0.009383 750500 -- (-1365.489) [-1363.763] (-1374.796) (-1363.990) * [-1363.647] (-1364.110) (-1364.652) (-1365.199) -- 0:00:18 751000 -- (-1364.421) (-1365.700) (-1365.588) [-1363.766] * [-1365.200] (-1363.816) (-1364.250) (-1367.814) -- 0:00:18 751500 -- (-1365.946) [-1365.817] (-1370.233) (-1363.529) * (-1365.274) [-1364.654] (-1364.324) (-1365.735) -- 0:00:18 752000 -- (-1365.201) [-1363.282] (-1363.123) (-1362.530) * (-1362.807) (-1361.818) (-1362.088) [-1364.855] -- 0:00:18 752500 -- [-1363.189] (-1363.544) (-1363.864) (-1366.474) * (-1362.583) (-1364.233) (-1362.850) [-1367.727] -- 0:00:18 753000 -- (-1366.377) (-1363.781) [-1363.530] (-1364.952) * (-1363.250) [-1363.398] (-1364.116) (-1365.771) -- 0:00:18 753500 -- (-1366.205) (-1365.089) [-1366.771] (-1370.522) * [-1363.031] (-1370.651) (-1364.132) (-1366.495) -- 0:00:18 754000 -- (-1364.221) (-1364.725) (-1362.838) [-1364.075] * [-1363.178] (-1365.762) (-1364.794) (-1363.118) -- 0:00:18 754500 -- (-1363.591) (-1364.747) [-1363.219] (-1362.809) * (-1364.608) (-1363.029) (-1363.236) [-1363.234] -- 0:00:18 755000 -- [-1363.002] (-1367.048) (-1363.382) (-1363.048) * (-1363.085) (-1365.265) [-1363.480] (-1364.637) -- 0:00:18 Average standard deviation of split frequencies: 0.009610 755500 -- (-1365.396) [-1363.098] (-1365.126) (-1363.051) * [-1367.083] (-1365.409) (-1362.989) (-1363.854) -- 0:00:18 756000 -- (-1365.697) [-1363.719] (-1363.307) (-1363.880) * (-1364.530) [-1363.938] (-1362.811) (-1363.185) -- 0:00:18 756500 -- (-1362.708) (-1362.765) (-1363.433) [-1363.138] * (-1362.717) [-1363.928] (-1362.477) (-1363.140) -- 0:00:18 757000 -- (-1363.232) (-1362.765) (-1362.648) [-1364.163] * (-1362.717) [-1362.953] (-1365.141) (-1364.270) -- 0:00:18 757500 -- (-1368.918) (-1364.005) [-1362.476] (-1364.669) * (-1366.362) [-1364.106] (-1362.867) (-1362.750) -- 0:00:18 758000 -- [-1363.161] (-1362.748) (-1363.419) (-1362.792) * (-1366.561) [-1364.692] (-1368.693) (-1363.982) -- 0:00:18 758500 -- (-1365.077) (-1364.692) (-1362.246) [-1365.189] * (-1366.330) (-1365.940) [-1363.379] (-1365.544) -- 0:00:18 759000 -- (-1363.474) [-1363.158] (-1363.575) (-1365.264) * (-1364.310) (-1366.656) (-1362.789) [-1366.334] -- 0:00:18 759500 -- (-1362.165) (-1363.334) (-1363.104) [-1363.381] * (-1362.360) (-1367.935) (-1364.050) [-1364.516] -- 0:00:18 760000 -- (-1364.948) (-1363.500) (-1365.470) [-1363.845] * (-1366.764) (-1364.819) (-1362.530) [-1366.100] -- 0:00:18 Average standard deviation of split frequencies: 0.009952 760500 -- [-1365.105] (-1362.658) (-1364.151) (-1364.252) * [-1362.670] (-1363.963) (-1364.903) (-1366.282) -- 0:00:17 761000 -- (-1364.164) (-1362.397) [-1366.156] (-1365.447) * (-1367.761) (-1365.484) [-1367.248] (-1363.727) -- 0:00:17 761500 -- (-1365.999) (-1364.253) [-1363.270] (-1367.828) * [-1363.285] (-1365.604) (-1366.798) (-1362.964) -- 0:00:17 762000 -- [-1369.406] (-1366.405) (-1363.641) (-1363.687) * (-1366.979) [-1363.902] (-1364.844) (-1365.061) -- 0:00:17 762500 -- (-1365.803) (-1364.421) (-1364.704) [-1364.839] * (-1362.626) [-1364.964] (-1363.228) (-1364.275) -- 0:00:17 763000 -- (-1363.315) [-1363.772] (-1363.868) (-1363.855) * [-1364.686] (-1363.450) (-1364.598) (-1364.447) -- 0:00:17 763500 -- (-1365.950) [-1363.392] (-1364.893) (-1364.555) * (-1365.894) [-1366.289] (-1363.857) (-1364.948) -- 0:00:17 764000 -- (-1365.169) (-1363.200) [-1365.382] (-1369.679) * (-1367.740) (-1363.137) (-1363.590) [-1363.825] -- 0:00:17 764500 -- [-1364.866] (-1364.190) (-1365.379) (-1370.590) * (-1372.130) (-1364.309) [-1364.706] (-1363.127) -- 0:00:17 765000 -- [-1365.123] (-1363.210) (-1366.171) (-1362.204) * (-1372.021) (-1367.956) (-1364.430) [-1364.315] -- 0:00:17 Average standard deviation of split frequencies: 0.009774 765500 -- (-1366.952) (-1362.690) [-1366.573] (-1363.401) * (-1366.619) (-1368.186) (-1365.026) [-1364.080] -- 0:00:17 766000 -- (-1366.052) [-1364.434] (-1363.731) (-1365.363) * [-1364.303] (-1364.430) (-1364.701) (-1365.404) -- 0:00:17 766500 -- (-1367.706) [-1363.485] (-1364.686) (-1364.222) * [-1363.109] (-1362.594) (-1366.554) (-1364.589) -- 0:00:17 767000 -- (-1362.628) [-1362.749] (-1364.216) (-1364.322) * (-1363.741) (-1364.194) [-1362.507] (-1362.268) -- 0:00:17 767500 -- (-1363.079) (-1362.890) (-1368.903) [-1364.486] * (-1362.562) (-1364.617) (-1364.389) [-1362.281] -- 0:00:17 768000 -- (-1363.114) (-1372.664) [-1364.385] (-1364.104) * (-1364.034) (-1365.128) (-1364.402) [-1362.648] -- 0:00:17 768500 -- [-1363.614] (-1363.558) (-1363.845) (-1366.045) * (-1363.056) [-1363.418] (-1363.946) (-1363.368) -- 0:00:17 769000 -- [-1368.357] (-1365.587) (-1363.209) (-1364.239) * [-1366.581] (-1364.451) (-1364.487) (-1365.045) -- 0:00:17 769500 -- [-1364.769] (-1366.295) (-1364.445) (-1365.772) * (-1364.018) (-1364.165) [-1363.942] (-1364.455) -- 0:00:17 770000 -- (-1366.073) (-1373.115) (-1363.264) [-1365.490] * (-1365.864) [-1361.992] (-1362.493) (-1362.042) -- 0:00:17 Average standard deviation of split frequencies: 0.009571 770500 -- [-1362.973] (-1369.077) (-1362.860) (-1364.376) * (-1363.390) (-1363.730) (-1364.318) [-1362.051] -- 0:00:17 771000 -- [-1363.116] (-1363.448) (-1368.429) (-1363.567) * (-1364.164) (-1363.730) [-1362.900] (-1363.186) -- 0:00:17 771500 -- (-1364.486) (-1364.850) (-1364.987) [-1362.785] * (-1365.811) [-1363.094] (-1364.216) (-1364.410) -- 0:00:17 772000 -- (-1363.626) (-1364.726) [-1363.192] (-1363.566) * (-1362.921) (-1365.121) (-1364.915) [-1366.561] -- 0:00:17 772500 -- [-1363.276] (-1365.632) (-1363.504) (-1364.462) * (-1363.425) (-1367.534) [-1365.549] (-1368.312) -- 0:00:17 773000 -- (-1364.174) [-1363.126] (-1364.213) (-1364.513) * [-1363.867] (-1362.715) (-1366.169) (-1364.306) -- 0:00:17 773500 -- (-1364.775) [-1363.088] (-1363.029) (-1366.341) * (-1362.449) (-1364.827) [-1364.821] (-1364.319) -- 0:00:16 774000 -- (-1370.992) (-1364.724) [-1363.231] (-1363.400) * (-1364.057) (-1368.715) [-1363.906] (-1366.602) -- 0:00:16 774500 -- (-1371.767) (-1364.933) (-1365.770) [-1363.200] * (-1370.217) (-1364.474) [-1363.747] (-1366.154) -- 0:00:16 775000 -- (-1366.761) [-1367.676] (-1368.722) (-1362.807) * (-1368.023) (-1364.549) (-1365.507) [-1364.576] -- 0:00:16 Average standard deviation of split frequencies: 0.009612 775500 -- (-1363.011) (-1368.948) [-1364.230] (-1364.536) * (-1364.743) (-1364.511) [-1363.858] (-1364.562) -- 0:00:16 776000 -- (-1363.717) (-1366.353) (-1367.716) [-1364.824] * (-1363.515) (-1365.096) [-1362.758] (-1369.802) -- 0:00:16 776500 -- (-1364.679) (-1365.780) [-1367.257] (-1363.132) * (-1363.864) (-1362.845) [-1364.498] (-1363.882) -- 0:00:16 777000 -- (-1364.737) [-1364.436] (-1363.212) (-1364.073) * (-1367.457) [-1366.309] (-1367.194) (-1364.422) -- 0:00:16 777500 -- (-1362.411) (-1362.548) [-1363.273] (-1364.324) * (-1370.792) (-1362.773) (-1365.877) [-1364.060] -- 0:00:16 778000 -- (-1364.903) (-1363.228) [-1363.315] (-1362.641) * [-1365.424] (-1365.630) (-1364.162) (-1364.571) -- 0:00:16 778500 -- (-1362.202) (-1364.137) [-1363.482] (-1363.331) * (-1362.752) (-1364.849) (-1363.587) [-1368.380] -- 0:00:16 779000 -- [-1362.942] (-1362.498) (-1363.497) (-1364.523) * (-1362.657) (-1364.410) [-1364.015] (-1364.222) -- 0:00:16 779500 -- (-1365.577) [-1362.825] (-1365.064) (-1365.371) * (-1363.281) (-1363.370) [-1363.191] (-1365.610) -- 0:00:16 780000 -- (-1367.345) [-1362.791] (-1362.499) (-1363.755) * [-1363.811] (-1364.652) (-1363.520) (-1364.351) -- 0:00:16 Average standard deviation of split frequencies: 0.009555 780500 -- [-1362.622] (-1364.103) (-1364.791) (-1364.727) * [-1364.326] (-1365.449) (-1368.567) (-1364.109) -- 0:00:16 781000 -- (-1364.331) (-1364.738) (-1367.902) [-1363.376] * (-1363.941) (-1369.793) (-1364.882) [-1363.365] -- 0:00:16 781500 -- (-1366.474) (-1363.171) (-1363.800) [-1365.527] * (-1364.427) (-1364.715) [-1363.684] (-1365.447) -- 0:00:16 782000 -- (-1363.773) (-1363.031) (-1366.459) [-1366.173] * (-1367.631) (-1364.181) (-1363.892) [-1366.495] -- 0:00:16 782500 -- (-1363.990) [-1363.162] (-1364.744) (-1370.695) * (-1365.338) (-1364.128) (-1364.670) [-1366.588] -- 0:00:16 783000 -- (-1365.016) (-1364.010) (-1364.567) [-1366.872] * [-1363.509] (-1362.962) (-1365.755) (-1365.273) -- 0:00:16 783500 -- (-1372.158) (-1364.803) [-1366.363] (-1369.392) * (-1362.013) (-1370.223) [-1365.267] (-1363.880) -- 0:00:16 784000 -- [-1368.264] (-1367.184) (-1365.032) (-1364.359) * (-1362.562) (-1363.139) (-1366.965) [-1363.386] -- 0:00:16 784500 -- (-1363.112) [-1365.081] (-1363.530) (-1362.847) * (-1363.216) [-1363.554] (-1364.846) (-1364.412) -- 0:00:16 785000 -- [-1363.112] (-1362.271) (-1364.555) (-1364.113) * (-1365.969) (-1364.232) (-1363.627) [-1362.726] -- 0:00:16 Average standard deviation of split frequencies: 0.009631 785500 -- [-1363.112] (-1365.237) (-1362.738) (-1365.534) * [-1363.630] (-1365.720) (-1363.330) (-1362.576) -- 0:00:16 786000 -- (-1363.984) [-1364.121] (-1363.117) (-1362.729) * (-1363.190) (-1366.983) [-1363.267] (-1362.680) -- 0:00:16 786500 -- [-1362.787] (-1366.112) (-1363.887) (-1366.594) * (-1363.372) (-1363.570) (-1363.299) [-1365.377] -- 0:00:16 787000 -- (-1365.438) (-1365.003) (-1365.191) [-1364.065] * (-1368.046) (-1365.185) (-1365.418) [-1364.236] -- 0:00:15 787500 -- (-1372.672) (-1364.426) [-1362.018] (-1366.322) * [-1367.381] (-1366.507) (-1364.925) (-1363.996) -- 0:00:15 788000 -- (-1369.191) (-1362.426) (-1363.211) [-1363.411] * (-1372.531) [-1363.789] (-1364.002) (-1367.334) -- 0:00:15 788500 -- (-1366.585) [-1365.425] (-1362.244) (-1362.513) * (-1364.504) (-1362.682) [-1365.911] (-1363.973) -- 0:00:15 789000 -- (-1363.436) (-1362.911) (-1363.692) [-1368.175] * [-1363.099] (-1363.370) (-1369.250) (-1366.440) -- 0:00:15 789500 -- (-1363.742) (-1368.135) [-1365.361] (-1365.440) * [-1363.057] (-1363.696) (-1367.382) (-1366.600) -- 0:00:15 790000 -- (-1362.821) (-1365.457) [-1365.310] (-1369.870) * (-1364.300) [-1365.087] (-1363.327) (-1365.617) -- 0:00:15 Average standard deviation of split frequencies: 0.010276 790500 -- [-1362.944] (-1364.308) (-1367.101) (-1364.872) * (-1371.235) (-1370.268) [-1362.054] (-1364.212) -- 0:00:15 791000 -- (-1369.858) (-1365.456) (-1367.794) [-1365.495] * [-1365.263] (-1365.993) (-1363.578) (-1362.968) -- 0:00:15 791500 -- (-1366.236) [-1364.619] (-1363.693) (-1365.530) * (-1368.643) [-1364.923] (-1366.278) (-1363.143) -- 0:00:15 792000 -- (-1364.277) (-1364.350) (-1365.249) [-1364.710] * (-1365.567) (-1365.829) (-1362.596) [-1364.909] -- 0:00:15 792500 -- (-1367.105) (-1366.806) [-1365.430] (-1366.728) * [-1368.922] (-1364.437) (-1362.285) (-1371.935) -- 0:00:15 793000 -- (-1362.873) (-1363.213) (-1371.415) [-1362.671] * (-1364.231) [-1362.876] (-1363.112) (-1370.585) -- 0:00:15 793500 -- [-1364.803] (-1362.464) (-1363.476) (-1363.351) * (-1367.010) (-1364.069) [-1363.784] (-1368.703) -- 0:00:15 794000 -- (-1364.008) (-1363.364) (-1363.187) [-1362.058] * (-1364.907) (-1364.123) [-1363.734] (-1367.218) -- 0:00:15 794500 -- (-1367.500) [-1364.360] (-1363.858) (-1364.538) * [-1363.114] (-1363.557) (-1366.652) (-1367.115) -- 0:00:15 795000 -- (-1369.647) (-1364.254) (-1362.443) [-1365.318] * (-1363.488) (-1363.762) [-1363.798] (-1363.203) -- 0:00:15 Average standard deviation of split frequencies: 0.009772 795500 -- (-1366.131) (-1365.039) (-1366.261) [-1366.696] * [-1366.286] (-1362.501) (-1363.440) (-1362.719) -- 0:00:15 796000 -- [-1366.317] (-1363.783) (-1367.587) (-1365.710) * (-1365.306) (-1364.043) (-1364.132) [-1362.266] -- 0:00:15 796500 -- [-1363.838] (-1364.593) (-1364.059) (-1365.115) * (-1363.404) (-1364.217) [-1362.193] (-1362.552) -- 0:00:15 797000 -- (-1366.110) (-1363.937) (-1362.937) [-1365.549] * (-1364.979) [-1363.567] (-1362.314) (-1365.382) -- 0:00:15 797500 -- (-1372.050) (-1363.647) [-1363.862] (-1369.683) * (-1364.610) (-1362.653) [-1362.390] (-1363.361) -- 0:00:15 798000 -- [-1364.477] (-1363.405) (-1363.624) (-1362.961) * (-1366.329) (-1363.282) (-1366.564) [-1363.602] -- 0:00:15 798500 -- (-1363.307) [-1365.608] (-1364.687) (-1368.221) * (-1365.239) (-1362.260) [-1362.949] (-1364.312) -- 0:00:15 799000 -- (-1366.479) (-1368.022) [-1369.316] (-1366.014) * (-1364.418) (-1365.738) [-1363.221] (-1364.157) -- 0:00:15 799500 -- (-1364.880) (-1364.277) (-1365.694) [-1362.774] * (-1368.705) [-1368.507] (-1365.749) (-1363.417) -- 0:00:15 800000 -- (-1364.966) (-1365.327) (-1366.768) [-1362.803] * (-1369.010) (-1366.758) [-1364.933] (-1363.957) -- 0:00:14 Average standard deviation of split frequencies: 0.009715 800500 -- (-1365.144) (-1363.037) (-1368.276) [-1362.609] * (-1365.504) [-1364.646] (-1363.157) (-1363.592) -- 0:00:14 801000 -- [-1362.724] (-1361.882) (-1362.357) (-1365.786) * (-1364.485) (-1362.176) [-1363.032] (-1363.021) -- 0:00:14 801500 -- (-1362.831) (-1363.368) (-1366.362) [-1362.716] * (-1365.324) (-1363.248) [-1364.034] (-1363.675) -- 0:00:14 802000 -- (-1365.910) (-1363.948) (-1362.965) [-1363.996] * [-1366.717] (-1363.290) (-1362.773) (-1364.348) -- 0:00:14 802500 -- (-1364.006) (-1363.232) [-1366.988] (-1363.395) * [-1363.735] (-1362.920) (-1362.620) (-1364.245) -- 0:00:14 803000 -- (-1364.733) [-1367.323] (-1364.698) (-1363.258) * (-1365.492) (-1362.833) (-1365.106) [-1362.640] -- 0:00:14 803500 -- [-1364.733] (-1364.594) (-1362.181) (-1363.023) * (-1365.481) [-1362.136] (-1366.190) (-1363.411) -- 0:00:14 804000 -- (-1364.065) (-1366.014) [-1363.363] (-1365.197) * (-1362.234) (-1362.008) (-1363.561) [-1364.447] -- 0:00:14 804500 -- (-1366.123) [-1364.324] (-1364.748) (-1363.854) * (-1362.070) (-1361.992) [-1363.919] (-1363.745) -- 0:00:14 805000 -- (-1365.593) [-1364.151] (-1364.125) (-1364.465) * (-1364.514) [-1363.285] (-1363.025) (-1363.102) -- 0:00:14 Average standard deviation of split frequencies: 0.010162 805500 -- [-1363.375] (-1366.020) (-1362.764) (-1363.494) * (-1362.767) (-1365.134) [-1364.851] (-1362.937) -- 0:00:14 806000 -- [-1362.519] (-1368.443) (-1362.641) (-1362.840) * (-1362.155) (-1363.346) (-1367.302) [-1363.346] -- 0:00:14 806500 -- (-1366.222) [-1363.503] (-1365.320) (-1368.699) * [-1362.155] (-1363.973) (-1363.867) (-1363.373) -- 0:00:14 807000 -- [-1362.949] (-1362.491) (-1362.696) (-1366.844) * [-1362.150] (-1363.651) (-1364.471) (-1362.147) -- 0:00:14 807500 -- (-1365.410) [-1364.649] (-1364.500) (-1365.729) * (-1364.555) (-1363.481) [-1364.533] (-1366.848) -- 0:00:14 808000 -- (-1364.954) (-1365.003) (-1362.383) [-1364.295] * (-1365.565) (-1365.836) (-1365.128) [-1365.928] -- 0:00:14 808500 -- [-1363.594] (-1364.743) (-1363.607) (-1362.759) * (-1363.704) [-1367.937] (-1363.906) (-1364.034) -- 0:00:14 809000 -- [-1363.565] (-1365.328) (-1363.048) (-1362.788) * (-1362.471) (-1366.363) [-1363.123] (-1365.377) -- 0:00:14 809500 -- (-1363.768) (-1363.834) [-1363.679] (-1363.442) * [-1362.214] (-1362.651) (-1370.374) (-1363.560) -- 0:00:14 810000 -- (-1363.388) [-1362.347] (-1371.160) (-1366.934) * (-1364.931) [-1362.214] (-1362.835) (-1362.836) -- 0:00:14 Average standard deviation of split frequencies: 0.010140 810500 -- (-1362.123) [-1361.995] (-1364.461) (-1364.252) * (-1369.077) [-1364.304] (-1362.685) (-1365.350) -- 0:00:14 811000 -- (-1363.190) [-1362.044] (-1364.302) (-1362.061) * (-1363.691) (-1363.864) (-1362.438) [-1362.968] -- 0:00:14 811500 -- (-1362.637) (-1363.925) [-1364.397] (-1368.206) * (-1368.205) (-1363.726) [-1363.641] (-1365.028) -- 0:00:14 812000 -- [-1363.980] (-1365.768) (-1362.842) (-1366.398) * [-1363.438] (-1364.875) (-1365.486) (-1366.144) -- 0:00:14 812500 -- (-1363.062) (-1365.985) (-1362.443) [-1363.202] * (-1363.556) [-1363.476] (-1369.901) (-1366.802) -- 0:00:14 813000 -- [-1363.124] (-1364.929) (-1362.345) (-1364.009) * [-1362.356] (-1370.116) (-1366.863) (-1366.820) -- 0:00:14 813500 -- (-1367.742) (-1366.018) [-1363.821] (-1363.895) * (-1364.021) (-1367.945) [-1364.451] (-1365.973) -- 0:00:13 814000 -- (-1368.064) [-1364.393] (-1363.778) (-1364.803) * (-1364.221) [-1363.462] (-1368.233) (-1368.921) -- 0:00:13 814500 -- (-1370.170) [-1363.050] (-1365.805) (-1364.331) * (-1363.827) [-1363.158] (-1363.228) (-1365.302) -- 0:00:13 815000 -- [-1362.622] (-1363.020) (-1363.200) (-1363.381) * (-1365.766) (-1363.051) (-1365.808) [-1362.791] -- 0:00:13 Average standard deviation of split frequencies: 0.010001 815500 -- (-1365.011) (-1363.957) (-1370.879) [-1362.987] * (-1365.947) [-1362.868] (-1365.793) (-1363.876) -- 0:00:13 816000 -- (-1364.711) (-1364.186) [-1364.238] (-1362.547) * (-1365.745) (-1365.288) (-1365.243) [-1363.179] -- 0:00:13 816500 -- (-1364.261) [-1365.815] (-1366.275) (-1363.480) * (-1367.999) (-1364.041) [-1364.430] (-1372.691) -- 0:00:13 817000 -- (-1364.359) (-1363.997) [-1362.240] (-1363.780) * (-1364.637) [-1364.394] (-1367.274) (-1366.445) -- 0:00:13 817500 -- [-1364.765] (-1364.408) (-1362.443) (-1367.390) * [-1363.458] (-1364.153) (-1366.619) (-1363.970) -- 0:00:13 818000 -- (-1364.576) [-1362.532] (-1363.249) (-1365.770) * (-1365.026) (-1363.682) (-1363.322) [-1363.200] -- 0:00:13 818500 -- (-1364.192) [-1362.949] (-1364.581) (-1364.253) * [-1362.463] (-1365.134) (-1362.904) (-1364.379) -- 0:00:13 819000 -- (-1364.425) [-1363.984] (-1364.766) (-1364.715) * [-1365.681] (-1363.674) (-1365.028) (-1363.681) -- 0:00:13 819500 -- (-1365.470) (-1367.014) [-1366.790] (-1363.549) * (-1366.387) [-1363.812] (-1363.075) (-1362.693) -- 0:00:13 820000 -- [-1363.063] (-1364.079) (-1365.347) (-1364.075) * (-1366.401) (-1367.947) [-1363.210] (-1366.302) -- 0:00:13 Average standard deviation of split frequencies: 0.010016 820500 -- [-1363.561] (-1364.980) (-1369.744) (-1364.930) * [-1365.914] (-1365.075) (-1364.887) (-1365.841) -- 0:00:13 821000 -- (-1362.737) (-1365.517) (-1365.637) [-1363.339] * (-1365.712) [-1363.761] (-1366.727) (-1363.806) -- 0:00:13 821500 -- (-1369.819) [-1364.594] (-1363.622) (-1362.374) * (-1363.711) (-1364.186) [-1367.364] (-1362.801) -- 0:00:13 822000 -- (-1364.772) [-1361.986] (-1362.347) (-1362.612) * [-1365.442] (-1363.892) (-1364.960) (-1369.609) -- 0:00:13 822500 -- [-1364.448] (-1366.693) (-1364.403) (-1365.207) * [-1363.741] (-1362.336) (-1363.589) (-1367.153) -- 0:00:13 823000 -- [-1363.728] (-1363.190) (-1363.783) (-1364.969) * [-1364.262] (-1362.329) (-1365.897) (-1365.086) -- 0:00:13 823500 -- (-1363.849) (-1363.378) (-1367.102) [-1368.415] * (-1364.967) (-1363.378) (-1365.003) [-1362.605] -- 0:00:13 824000 -- (-1364.907) (-1366.262) (-1362.945) [-1363.461] * (-1370.898) [-1363.507] (-1363.802) (-1362.900) -- 0:00:13 824500 -- (-1363.699) [-1364.362] (-1365.305) (-1369.615) * (-1366.014) [-1363.531] (-1364.881) (-1366.739) -- 0:00:13 825000 -- (-1363.037) [-1362.819] (-1367.104) (-1364.953) * (-1363.760) (-1364.897) (-1363.082) [-1364.807] -- 0:00:13 Average standard deviation of split frequencies: 0.010071 825500 -- (-1364.813) (-1362.798) (-1364.250) [-1367.043] * [-1365.589] (-1365.664) (-1362.508) (-1365.201) -- 0:00:13 826000 -- (-1365.988) [-1362.398] (-1363.701) (-1367.771) * [-1363.241] (-1366.948) (-1363.333) (-1368.299) -- 0:00:13 826500 -- (-1367.321) (-1365.386) (-1368.423) [-1369.106] * [-1363.049] (-1367.662) (-1364.196) (-1362.992) -- 0:00:13 827000 -- (-1367.378) [-1364.682] (-1365.329) (-1366.877) * (-1367.058) (-1364.160) (-1363.685) [-1364.134] -- 0:00:12 827500 -- [-1366.382] (-1364.683) (-1364.934) (-1365.699) * (-1366.697) [-1363.730] (-1365.657) (-1366.381) -- 0:00:12 828000 -- (-1364.867) (-1363.156) [-1364.249] (-1366.055) * [-1364.292] (-1365.859) (-1369.422) (-1363.751) -- 0:00:12 828500 -- [-1366.502] (-1364.015) (-1366.733) (-1362.187) * (-1362.551) [-1366.108] (-1365.603) (-1364.265) -- 0:00:12 829000 -- (-1364.759) (-1366.724) [-1364.093] (-1364.320) * (-1362.687) (-1363.539) [-1362.162] (-1362.798) -- 0:00:12 829500 -- (-1366.129) (-1369.076) [-1365.170] (-1365.195) * (-1364.675) (-1363.944) [-1362.857] (-1364.653) -- 0:00:12 830000 -- (-1367.014) [-1364.617] (-1362.220) (-1365.196) * (-1364.922) (-1365.103) [-1362.797] (-1368.103) -- 0:00:12 Average standard deviation of split frequencies: 0.010593 830500 -- (-1364.309) (-1363.232) (-1364.222) [-1364.248] * [-1364.706] (-1363.673) (-1363.202) (-1366.647) -- 0:00:12 831000 -- (-1363.924) (-1366.707) [-1365.411] (-1364.442) * (-1364.613) (-1363.667) (-1364.464) [-1364.134] -- 0:00:12 831500 -- (-1363.523) (-1367.061) [-1363.692] (-1364.307) * [-1365.640] (-1365.772) (-1364.168) (-1365.842) -- 0:00:12 832000 -- (-1365.801) [-1364.859] (-1363.859) (-1364.080) * [-1365.575] (-1362.298) (-1365.752) (-1370.292) -- 0:00:12 832500 -- [-1363.040] (-1363.090) (-1365.103) (-1362.732) * (-1365.490) [-1363.808] (-1365.720) (-1364.007) -- 0:00:12 833000 -- (-1363.144) (-1364.084) (-1365.550) [-1362.821] * (-1365.528) (-1364.166) [-1365.788] (-1362.572) -- 0:00:12 833500 -- (-1362.359) [-1362.627] (-1363.111) (-1364.524) * (-1366.671) (-1364.497) (-1366.358) [-1363.061] -- 0:00:12 834000 -- (-1362.359) [-1363.405] (-1363.087) (-1368.227) * (-1363.995) (-1366.196) (-1365.939) [-1364.109] -- 0:00:12 834500 -- [-1365.665] (-1363.984) (-1362.665) (-1371.144) * (-1364.187) (-1364.461) [-1368.132] (-1362.848) -- 0:00:12 835000 -- (-1363.520) [-1363.469] (-1365.115) (-1364.739) * (-1364.945) [-1363.082] (-1366.925) (-1365.970) -- 0:00:12 Average standard deviation of split frequencies: 0.009785 835500 -- (-1362.482) (-1368.348) [-1364.704] (-1363.147) * (-1364.309) (-1363.019) (-1364.588) [-1364.501] -- 0:00:12 836000 -- (-1363.806) (-1363.201) (-1364.341) [-1369.525] * (-1367.878) [-1362.541] (-1365.628) (-1365.580) -- 0:00:12 836500 -- (-1364.789) (-1364.355) [-1362.990] (-1365.032) * [-1365.354] (-1364.114) (-1364.637) (-1365.860) -- 0:00:12 837000 -- (-1364.003) [-1365.525] (-1364.092) (-1364.039) * [-1362.708] (-1367.005) (-1366.119) (-1364.171) -- 0:00:12 837500 -- (-1363.153) [-1363.545] (-1363.785) (-1362.114) * (-1365.202) (-1363.212) (-1363.509) [-1363.780] -- 0:00:12 838000 -- [-1364.791] (-1363.266) (-1364.664) (-1364.063) * (-1367.146) (-1367.276) [-1364.095] (-1363.609) -- 0:00:12 838500 -- (-1365.260) (-1363.252) [-1365.464] (-1362.946) * [-1364.358] (-1368.017) (-1362.452) (-1364.508) -- 0:00:12 839000 -- (-1364.268) (-1367.267) [-1363.005] (-1364.623) * (-1369.389) (-1369.725) [-1362.051] (-1365.156) -- 0:00:12 839500 -- (-1367.492) (-1365.530) (-1368.330) [-1362.307] * (-1367.276) (-1362.961) (-1363.728) [-1363.454] -- 0:00:12 840000 -- (-1364.952) (-1363.100) [-1363.731] (-1363.797) * [-1370.129] (-1366.812) (-1367.026) (-1367.585) -- 0:00:11 Average standard deviation of split frequencies: 0.009830 840500 -- [-1362.657] (-1363.275) (-1367.372) (-1363.258) * (-1365.444) (-1363.594) (-1363.845) [-1362.246] -- 0:00:11 841000 -- (-1364.952) [-1362.828] (-1367.952) (-1362.929) * (-1364.131) (-1367.436) [-1365.024] (-1363.615) -- 0:00:11 841500 -- (-1366.366) (-1365.862) (-1365.898) [-1362.827] * (-1363.932) [-1364.303] (-1364.360) (-1365.792) -- 0:00:11 842000 -- (-1365.075) [-1364.587] (-1363.138) (-1363.651) * [-1362.957] (-1364.107) (-1364.361) (-1362.098) -- 0:00:11 842500 -- (-1365.873) (-1366.585) (-1363.759) [-1365.372] * [-1366.099] (-1365.168) (-1362.502) (-1362.286) -- 0:00:11 843000 -- (-1365.646) [-1363.093] (-1362.892) (-1362.788) * (-1366.645) (-1372.176) (-1364.455) [-1365.451] -- 0:00:11 843500 -- (-1363.633) [-1362.264] (-1368.074) (-1363.771) * [-1364.369] (-1364.414) (-1365.532) (-1362.653) -- 0:00:11 844000 -- (-1363.071) (-1364.458) [-1364.027] (-1365.128) * [-1364.237] (-1362.869) (-1364.912) (-1363.266) -- 0:00:11 844500 -- (-1363.574) [-1364.241] (-1362.622) (-1370.794) * (-1362.691) [-1363.090] (-1363.010) (-1363.253) -- 0:00:11 845000 -- (-1363.537) (-1363.281) [-1364.828] (-1368.205) * [-1362.791] (-1366.798) (-1365.713) (-1363.717) -- 0:00:11 Average standard deviation of split frequencies: 0.009505 845500 -- (-1362.698) (-1362.533) [-1364.154] (-1362.878) * (-1364.737) (-1366.810) (-1364.341) [-1367.993] -- 0:00:11 846000 -- [-1363.138] (-1362.815) (-1365.873) (-1365.377) * [-1362.759] (-1365.508) (-1364.586) (-1362.546) -- 0:00:11 846500 -- (-1362.772) [-1365.018] (-1361.972) (-1370.798) * (-1363.367) [-1362.173] (-1367.322) (-1362.576) -- 0:00:11 847000 -- [-1362.968] (-1364.383) (-1364.699) (-1364.510) * (-1363.083) (-1364.943) [-1362.154] (-1362.213) -- 0:00:11 847500 -- (-1364.551) [-1363.479] (-1365.794) (-1364.433) * (-1365.119) (-1363.781) [-1364.289] (-1363.157) -- 0:00:11 848000 -- (-1367.849) (-1366.200) [-1362.809] (-1363.943) * (-1365.085) (-1364.916) (-1364.767) [-1363.999] -- 0:00:11 848500 -- (-1363.588) (-1373.774) (-1363.845) [-1363.004] * (-1364.851) [-1367.516] (-1365.093) (-1364.964) -- 0:00:11 849000 -- [-1363.547] (-1363.376) (-1363.555) (-1363.910) * [-1363.729] (-1369.874) (-1362.408) (-1362.287) -- 0:00:11 849500 -- (-1362.381) [-1364.663] (-1365.090) (-1366.892) * (-1364.497) (-1363.815) (-1363.187) [-1361.985] -- 0:00:11 850000 -- (-1363.786) [-1363.974] (-1363.090) (-1363.666) * [-1368.754] (-1364.661) (-1364.442) (-1369.644) -- 0:00:11 Average standard deviation of split frequencies: 0.009852 850500 -- (-1363.600) (-1363.854) [-1363.628] (-1363.001) * (-1369.677) (-1369.095) [-1364.216] (-1367.555) -- 0:00:11 851000 -- (-1363.224) [-1366.107] (-1364.623) (-1363.760) * (-1364.657) (-1364.547) [-1363.506] (-1364.759) -- 0:00:11 851500 -- [-1363.823] (-1364.761) (-1366.204) (-1364.430) * (-1364.208) [-1363.869] (-1365.928) (-1362.042) -- 0:00:11 852000 -- (-1364.826) (-1367.164) (-1366.616) [-1366.754] * (-1365.137) [-1363.442] (-1362.757) (-1364.535) -- 0:00:11 852500 -- [-1365.710] (-1362.963) (-1365.967) (-1367.646) * (-1365.607) [-1362.693] (-1362.929) (-1366.092) -- 0:00:11 853000 -- (-1364.515) (-1362.802) [-1363.306] (-1368.840) * (-1365.279) (-1362.283) [-1365.428] (-1364.973) -- 0:00:11 853500 -- (-1364.521) [-1363.645] (-1369.150) (-1365.267) * (-1366.557) [-1362.180] (-1364.603) (-1365.237) -- 0:00:10 854000 -- [-1362.835] (-1366.241) (-1365.729) (-1362.842) * (-1365.960) [-1362.865] (-1362.953) (-1365.166) -- 0:00:10 854500 -- (-1362.489) [-1368.663] (-1363.051) (-1362.824) * (-1363.123) (-1364.095) (-1363.091) [-1366.390] -- 0:00:10 855000 -- (-1364.736) (-1368.895) (-1363.627) [-1363.874] * (-1363.356) (-1363.534) (-1365.190) [-1366.165] -- 0:00:10 Average standard deviation of split frequencies: 0.009423 855500 -- (-1365.865) (-1365.638) [-1363.427] (-1364.255) * (-1370.225) (-1363.846) (-1364.425) [-1363.786] -- 0:00:10 856000 -- (-1364.600) [-1366.966] (-1362.651) (-1363.352) * (-1368.693) (-1363.073) (-1365.289) [-1365.756] -- 0:00:10 856500 -- (-1368.073) (-1367.976) (-1362.936) [-1363.471] * (-1370.174) (-1364.693) [-1362.720] (-1367.516) -- 0:00:10 857000 -- (-1368.532) (-1366.487) [-1362.942] (-1364.578) * [-1363.269] (-1363.377) (-1362.279) (-1363.650) -- 0:00:10 857500 -- [-1362.743] (-1363.926) (-1363.337) (-1362.216) * (-1363.852) (-1361.948) (-1362.730) [-1364.943] -- 0:00:10 858000 -- (-1362.218) (-1362.964) [-1362.871] (-1366.849) * (-1364.507) (-1364.468) [-1362.613] (-1363.124) -- 0:00:10 858500 -- [-1363.345] (-1365.881) (-1364.190) (-1366.093) * (-1362.462) [-1366.792] (-1363.965) (-1363.340) -- 0:00:10 859000 -- (-1365.996) (-1363.420) (-1362.992) [-1362.710] * [-1363.744] (-1367.756) (-1362.615) (-1361.956) -- 0:00:10 859500 -- (-1363.813) (-1363.795) [-1363.004] (-1362.539) * (-1362.907) (-1370.111) [-1363.442] (-1363.580) -- 0:00:10 860000 -- (-1364.499) (-1366.169) [-1363.545] (-1364.347) * (-1363.008) (-1365.954) (-1363.664) [-1365.276] -- 0:00:10 Average standard deviation of split frequencies: 0.009037 860500 -- (-1362.950) [-1362.492] (-1365.340) (-1364.593) * (-1362.682) [-1364.658] (-1366.214) (-1362.557) -- 0:00:10 861000 -- (-1364.105) [-1364.749] (-1362.747) (-1364.023) * (-1362.894) (-1362.266) (-1367.040) [-1362.016] -- 0:00:10 861500 -- [-1362.817] (-1362.318) (-1362.663) (-1364.702) * (-1362.865) (-1366.291) (-1364.424) [-1363.270] -- 0:00:10 862000 -- (-1366.039) (-1363.480) [-1365.977] (-1364.487) * (-1362.621) (-1363.952) (-1367.137) [-1364.521] -- 0:00:10 862500 -- (-1363.395) [-1363.652] (-1363.354) (-1364.302) * (-1364.870) [-1364.000] (-1362.806) (-1364.814) -- 0:00:10 863000 -- (-1363.723) [-1364.229] (-1361.931) (-1364.438) * (-1363.528) [-1364.377] (-1364.583) (-1363.345) -- 0:00:10 863500 -- (-1363.072) [-1363.005] (-1363.133) (-1362.534) * (-1363.833) (-1363.767) [-1363.308] (-1365.747) -- 0:00:10 864000 -- (-1365.058) [-1364.002] (-1366.707) (-1366.468) * [-1363.055] (-1363.264) (-1365.470) (-1364.332) -- 0:00:10 864500 -- (-1369.065) (-1363.659) [-1365.302] (-1367.351) * [-1363.740] (-1363.899) (-1363.606) (-1367.595) -- 0:00:10 865000 -- (-1362.778) (-1365.270) [-1364.928] (-1362.776) * (-1366.122) [-1363.968] (-1362.874) (-1364.930) -- 0:00:10 Average standard deviation of split frequencies: 0.008800 865500 -- (-1364.722) [-1364.817] (-1361.991) (-1363.336) * (-1363.422) [-1364.911] (-1364.019) (-1366.139) -- 0:00:10 866000 -- (-1366.338) (-1363.631) (-1364.273) [-1363.201] * (-1363.267) [-1362.965] (-1365.085) (-1365.015) -- 0:00:10 866500 -- (-1364.898) [-1364.460] (-1362.690) (-1366.150) * (-1364.036) [-1363.989] (-1363.308) (-1365.214) -- 0:00:10 867000 -- (-1364.949) (-1366.996) [-1364.910] (-1367.036) * (-1362.666) (-1364.727) [-1362.484] (-1366.196) -- 0:00:09 867500 -- [-1364.240] (-1371.188) (-1366.268) (-1367.214) * (-1364.868) (-1363.797) [-1362.629] (-1365.546) -- 0:00:09 868000 -- (-1362.762) (-1364.435) (-1364.508) [-1366.995] * (-1364.396) [-1363.803] (-1363.579) (-1364.129) -- 0:00:09 868500 -- (-1362.117) (-1363.165) (-1370.585) [-1363.704] * (-1364.483) (-1364.470) (-1364.197) [-1362.006] -- 0:00:09 869000 -- (-1364.507) (-1365.383) (-1366.410) [-1362.481] * (-1368.331) [-1362.732] (-1363.883) (-1362.705) -- 0:00:09 869500 -- (-1366.094) (-1367.204) [-1363.710] (-1364.066) * (-1366.850) [-1363.394] (-1363.819) (-1363.869) -- 0:00:09 870000 -- (-1364.620) [-1364.514] (-1366.182) (-1364.519) * (-1363.203) (-1363.966) [-1365.761] (-1366.748) -- 0:00:09 Average standard deviation of split frequencies: 0.009204 870500 -- (-1364.144) (-1364.688) (-1364.441) [-1365.216] * (-1365.992) [-1363.155] (-1370.616) (-1363.779) -- 0:00:09 871000 -- [-1363.415] (-1364.126) (-1365.475) (-1363.932) * (-1369.343) (-1361.884) (-1367.247) [-1364.059] -- 0:00:09 871500 -- (-1366.074) (-1365.428) (-1365.882) [-1368.415] * (-1364.007) (-1364.177) [-1368.046] (-1364.922) -- 0:00:09 872000 -- (-1362.889) (-1362.622) (-1368.673) [-1362.782] * [-1363.484] (-1363.597) (-1365.630) (-1363.350) -- 0:00:09 872500 -- [-1365.923] (-1364.009) (-1363.492) (-1363.995) * (-1362.520) (-1364.502) [-1367.249] (-1363.673) -- 0:00:09 873000 -- [-1367.661] (-1364.278) (-1365.133) (-1363.193) * (-1362.682) [-1362.765] (-1365.682) (-1364.486) -- 0:00:09 873500 -- (-1362.749) (-1363.971) [-1365.283] (-1364.626) * [-1363.568] (-1364.184) (-1363.391) (-1368.685) -- 0:00:09 874000 -- [-1364.759] (-1362.816) (-1372.182) (-1366.052) * [-1362.999] (-1363.973) (-1362.986) (-1368.832) -- 0:00:09 874500 -- (-1364.003) [-1361.870] (-1364.889) (-1367.949) * (-1363.096) (-1365.007) (-1365.246) [-1363.247] -- 0:00:09 875000 -- (-1365.455) (-1362.831) [-1363.688] (-1369.052) * (-1366.086) (-1365.577) [-1363.050] (-1364.064) -- 0:00:09 Average standard deviation of split frequencies: 0.008760 875500 -- (-1361.955) (-1365.517) [-1364.278] (-1369.989) * [-1368.753] (-1363.184) (-1363.142) (-1369.805) -- 0:00:09 876000 -- (-1363.124) (-1362.618) (-1365.787) [-1367.182] * [-1365.257] (-1362.251) (-1365.736) (-1363.567) -- 0:00:09 876500 -- (-1363.389) [-1364.339] (-1362.966) (-1363.440) * (-1367.076) (-1364.271) (-1364.858) [-1363.458] -- 0:00:09 877000 -- (-1363.117) (-1369.859) [-1366.114] (-1363.517) * (-1366.170) (-1367.116) (-1364.755) [-1364.309] -- 0:00:09 877500 -- (-1363.454) [-1369.988] (-1364.445) (-1362.980) * (-1363.634) [-1366.828] (-1363.485) (-1365.092) -- 0:00:09 878000 -- (-1365.897) [-1363.516] (-1365.692) (-1363.061) * (-1365.470) [-1362.701] (-1364.188) (-1362.679) -- 0:00:09 878500 -- (-1364.148) (-1364.086) (-1365.953) [-1365.823] * (-1364.223) [-1362.076] (-1364.704) (-1363.253) -- 0:00:09 879000 -- (-1369.872) (-1363.671) (-1364.879) [-1366.192] * (-1369.252) [-1364.031] (-1363.169) (-1363.475) -- 0:00:09 879500 -- [-1363.767] (-1365.915) (-1367.072) (-1367.403) * [-1363.893] (-1364.009) (-1364.830) (-1364.177) -- 0:00:09 880000 -- (-1364.937) (-1362.754) (-1365.712) [-1365.131] * (-1364.311) (-1369.275) [-1363.663] (-1367.433) -- 0:00:09 Average standard deviation of split frequencies: 0.008743 880500 -- [-1366.383] (-1365.409) (-1365.662) (-1362.126) * (-1364.780) (-1363.970) [-1362.453] (-1364.727) -- 0:00:08 881000 -- (-1366.160) [-1363.038] (-1366.179) (-1363.698) * (-1364.636) (-1363.793) [-1362.679] (-1362.535) -- 0:00:08 881500 -- (-1366.820) (-1362.915) [-1364.621] (-1363.637) * [-1367.477] (-1371.769) (-1364.079) (-1365.725) -- 0:00:08 882000 -- (-1367.962) (-1367.338) (-1364.203) [-1364.794] * [-1364.956] (-1367.183) (-1365.639) (-1363.064) -- 0:00:08 882500 -- (-1364.180) [-1362.686] (-1366.275) (-1362.657) * [-1362.365] (-1367.205) (-1371.214) (-1363.761) -- 0:00:08 883000 -- [-1362.270] (-1364.619) (-1361.946) (-1363.609) * (-1364.039) (-1366.723) [-1367.569] (-1363.149) -- 0:00:08 883500 -- [-1362.341] (-1364.823) (-1361.780) (-1366.231) * (-1365.645) [-1364.999] (-1362.139) (-1363.848) -- 0:00:08 884000 -- (-1364.245) (-1364.496) [-1362.449] (-1365.631) * (-1365.486) (-1364.297) (-1363.363) [-1363.776] -- 0:00:08 884500 -- (-1364.232) (-1362.299) [-1364.334] (-1364.086) * (-1363.275) [-1362.318] (-1366.114) (-1365.292) -- 0:00:08 885000 -- [-1363.060] (-1362.814) (-1363.960) (-1365.374) * [-1363.878] (-1363.747) (-1364.759) (-1368.366) -- 0:00:08 Average standard deviation of split frequencies: 0.008927 885500 -- (-1363.889) (-1363.179) [-1363.800] (-1365.673) * (-1363.438) (-1363.280) (-1363.916) [-1363.006] -- 0:00:08 886000 -- (-1363.737) (-1363.579) (-1364.261) [-1364.466] * (-1364.638) [-1362.976] (-1362.909) (-1363.005) -- 0:00:08 886500 -- (-1366.888) (-1362.573) (-1363.227) [-1363.531] * (-1368.415) [-1362.927] (-1366.710) (-1363.493) -- 0:00:08 887000 -- (-1363.979) [-1363.299] (-1363.268) (-1363.199) * (-1370.019) (-1362.579) (-1364.619) [-1364.526] -- 0:00:08 887500 -- (-1366.912) [-1362.691] (-1364.420) (-1363.851) * [-1366.112] (-1362.960) (-1364.336) (-1363.435) -- 0:00:08 888000 -- (-1366.197) (-1362.921) (-1362.844) [-1363.892] * (-1367.429) [-1367.010] (-1363.488) (-1364.686) -- 0:00:08 888500 -- (-1362.610) (-1362.995) (-1365.180) [-1363.943] * (-1367.353) (-1365.784) (-1364.147) [-1364.071] -- 0:00:08 889000 -- [-1363.421] (-1363.387) (-1364.630) (-1362.059) * (-1362.421) (-1363.566) (-1363.248) [-1363.626] -- 0:00:08 889500 -- [-1365.493] (-1364.657) (-1364.806) (-1365.808) * (-1363.080) [-1364.085] (-1363.667) (-1365.560) -- 0:00:08 890000 -- (-1363.688) (-1362.343) (-1362.885) [-1363.354] * [-1365.498] (-1365.455) (-1363.686) (-1370.105) -- 0:00:08 Average standard deviation of split frequencies: 0.008998 890500 -- [-1364.495] (-1363.134) (-1367.142) (-1364.652) * (-1362.730) (-1363.024) [-1363.744] (-1369.890) -- 0:00:08 891000 -- (-1367.958) [-1363.078] (-1365.945) (-1370.652) * [-1362.931] (-1364.668) (-1365.371) (-1366.751) -- 0:00:08 891500 -- [-1363.930] (-1364.896) (-1365.156) (-1364.301) * (-1366.081) (-1362.819) (-1364.656) [-1367.951] -- 0:00:08 892000 -- [-1363.101] (-1364.750) (-1366.776) (-1364.683) * (-1362.904) [-1365.771] (-1365.210) (-1364.103) -- 0:00:08 892500 -- [-1365.689] (-1365.496) (-1366.063) (-1364.697) * (-1366.593) [-1364.131] (-1364.365) (-1364.709) -- 0:00:08 893000 -- (-1362.527) (-1364.148) (-1365.374) [-1367.300] * [-1365.841] (-1362.455) (-1363.966) (-1363.864) -- 0:00:08 893500 -- [-1362.891] (-1367.520) (-1364.943) (-1365.201) * (-1364.459) [-1362.538] (-1366.901) (-1362.779) -- 0:00:07 894000 -- [-1363.972] (-1368.440) (-1363.138) (-1365.939) * (-1365.646) (-1362.547) (-1365.053) [-1363.062] -- 0:00:07 894500 -- [-1366.281] (-1362.208) (-1363.996) (-1364.874) * [-1363.023] (-1363.144) (-1363.026) (-1362.305) -- 0:00:07 895000 -- (-1367.207) (-1362.766) [-1365.820] (-1363.504) * [-1363.392] (-1366.472) (-1362.446) (-1362.418) -- 0:00:07 Average standard deviation of split frequencies: 0.009061 895500 -- (-1367.236) (-1363.056) [-1367.038] (-1363.552) * (-1366.769) [-1365.769] (-1366.879) (-1363.490) -- 0:00:07 896000 -- (-1368.065) (-1363.929) (-1365.767) [-1362.304] * (-1367.384) [-1362.471] (-1362.919) (-1363.154) -- 0:00:07 896500 -- (-1363.185) [-1363.985] (-1366.499) (-1363.775) * (-1364.228) (-1366.288) (-1365.919) [-1365.590] -- 0:00:07 897000 -- (-1364.431) (-1364.802) (-1364.787) [-1364.456] * [-1365.801] (-1367.844) (-1367.546) (-1363.901) -- 0:00:07 897500 -- (-1363.879) [-1367.151] (-1363.161) (-1369.245) * (-1362.322) (-1366.617) (-1364.116) [-1363.225] -- 0:00:07 898000 -- [-1362.330] (-1362.619) (-1368.317) (-1363.475) * [-1363.414] (-1364.849) (-1362.652) (-1363.695) -- 0:00:07 898500 -- [-1362.427] (-1365.797) (-1363.690) (-1362.764) * (-1364.062) (-1363.030) (-1365.496) [-1363.389] -- 0:00:07 899000 -- (-1364.891) (-1367.060) [-1364.367] (-1362.624) * (-1364.825) (-1366.095) (-1365.848) [-1363.783] -- 0:00:07 899500 -- (-1362.852) (-1364.642) (-1364.376) [-1362.789] * (-1364.846) (-1365.116) (-1365.578) [-1363.312] -- 0:00:07 900000 -- (-1362.882) [-1365.263] (-1363.234) (-1365.538) * (-1365.188) (-1365.584) [-1364.711] (-1365.655) -- 0:00:07 Average standard deviation of split frequencies: 0.009159 900500 -- (-1365.722) (-1364.724) (-1363.651) [-1362.429] * (-1371.444) (-1364.258) [-1366.882] (-1362.494) -- 0:00:07 901000 -- (-1363.738) (-1364.952) (-1369.207) [-1362.495] * (-1364.861) [-1365.122] (-1366.193) (-1362.192) -- 0:00:07 901500 -- [-1364.313] (-1367.999) (-1369.124) (-1366.976) * (-1364.892) (-1364.467) (-1364.247) [-1364.579] -- 0:00:07 902000 -- (-1362.725) [-1366.361] (-1365.282) (-1363.409) * [-1363.939] (-1365.787) (-1362.074) (-1365.391) -- 0:00:07 902500 -- (-1362.285) (-1369.329) (-1365.555) [-1364.027] * [-1365.091] (-1365.120) (-1365.700) (-1362.830) -- 0:00:07 903000 -- (-1362.848) (-1366.223) (-1363.106) [-1365.982] * (-1364.493) (-1364.128) [-1366.078] (-1364.194) -- 0:00:07 903500 -- [-1362.052] (-1364.571) (-1363.143) (-1367.662) * (-1363.547) (-1362.836) [-1363.445] (-1363.303) -- 0:00:07 904000 -- (-1363.647) (-1364.175) [-1362.541] (-1367.999) * (-1366.382) [-1363.493] (-1364.678) (-1363.654) -- 0:00:07 904500 -- [-1364.458] (-1366.932) (-1363.405) (-1367.838) * (-1362.253) (-1365.159) (-1363.939) [-1366.703] -- 0:00:07 905000 -- (-1363.635) [-1362.182] (-1367.544) (-1364.177) * [-1363.834] (-1364.945) (-1364.428) (-1363.867) -- 0:00:07 Average standard deviation of split frequencies: 0.008788 905500 -- (-1366.966) (-1364.965) [-1364.371] (-1363.550) * (-1364.767) (-1364.353) (-1366.121) [-1362.724] -- 0:00:07 906000 -- (-1366.168) [-1367.639] (-1366.497) (-1365.475) * (-1364.723) [-1363.702] (-1364.703) (-1363.157) -- 0:00:07 906500 -- (-1365.472) [-1362.973] (-1366.666) (-1363.843) * [-1365.202] (-1363.114) (-1363.864) (-1365.272) -- 0:00:07 907000 -- (-1363.771) (-1364.260) (-1367.140) [-1362.731] * (-1368.022) (-1362.451) [-1363.669] (-1366.214) -- 0:00:06 907500 -- (-1364.187) (-1366.822) [-1366.824] (-1363.739) * (-1365.432) [-1363.077] (-1364.832) (-1362.841) -- 0:00:06 908000 -- (-1366.821) [-1366.686] (-1363.418) (-1364.893) * (-1365.781) (-1364.610) (-1363.668) [-1363.290] -- 0:00:06 908500 -- (-1364.211) [-1363.233] (-1366.243) (-1362.546) * (-1363.731) (-1364.354) (-1362.990) [-1362.978] -- 0:00:06 909000 -- (-1364.664) [-1366.690] (-1363.086) (-1363.329) * (-1364.101) [-1363.982] (-1364.676) (-1364.081) -- 0:00:06 909500 -- (-1362.207) [-1363.909] (-1363.618) (-1365.807) * (-1365.175) [-1362.573] (-1363.962) (-1362.740) -- 0:00:06 910000 -- (-1365.195) [-1363.793] (-1365.507) (-1362.535) * (-1368.703) (-1363.468) [-1363.408] (-1363.720) -- 0:00:06 Average standard deviation of split frequencies: 0.008570 910500 -- (-1363.455) (-1363.942) (-1369.380) [-1362.217] * (-1363.703) (-1363.503) [-1363.043] (-1362.435) -- 0:00:06 911000 -- (-1362.976) (-1367.129) (-1369.459) [-1363.547] * (-1363.475) [-1366.564] (-1363.756) (-1363.547) -- 0:00:06 911500 -- [-1365.030] (-1367.063) (-1366.071) (-1364.282) * [-1363.602] (-1367.916) (-1364.330) (-1363.215) -- 0:00:06 912000 -- [-1364.571] (-1371.426) (-1362.283) (-1367.181) * (-1366.547) (-1364.216) [-1364.473] (-1366.625) -- 0:00:06 912500 -- (-1363.773) [-1364.403] (-1361.868) (-1368.132) * (-1366.067) (-1363.611) [-1362.632] (-1366.926) -- 0:00:06 913000 -- (-1363.746) (-1364.796) (-1364.319) [-1363.969] * (-1364.025) (-1362.358) (-1362.210) [-1367.393] -- 0:00:06 913500 -- (-1367.963) (-1363.337) (-1362.256) [-1364.508] * (-1363.799) [-1362.495] (-1363.270) (-1363.899) -- 0:00:06 914000 -- [-1366.982] (-1363.222) (-1363.914) (-1362.935) * (-1366.222) (-1365.412) (-1364.263) [-1364.851] -- 0:00:06 914500 -- (-1365.316) (-1365.054) [-1365.248] (-1364.688) * (-1364.050) (-1366.670) [-1363.443] (-1364.150) -- 0:00:06 915000 -- [-1362.637] (-1362.353) (-1362.408) (-1363.714) * (-1364.276) (-1363.033) [-1363.140] (-1365.236) -- 0:00:06 Average standard deviation of split frequencies: 0.008606 915500 -- (-1364.899) [-1366.129] (-1362.509) (-1365.020) * (-1364.836) (-1364.708) [-1363.272] (-1365.523) -- 0:00:06 916000 -- (-1365.994) (-1362.726) [-1363.091] (-1362.648) * (-1368.959) [-1366.004] (-1364.202) (-1366.312) -- 0:00:06 916500 -- (-1366.777) (-1367.949) [-1364.976] (-1364.354) * (-1364.940) [-1365.545] (-1365.007) (-1365.229) -- 0:00:06 917000 -- [-1364.339] (-1364.037) (-1364.183) (-1366.186) * (-1365.364) (-1363.279) [-1367.573] (-1366.358) -- 0:00:06 917500 -- (-1368.758) (-1367.919) (-1363.363) [-1363.744] * [-1365.752] (-1363.464) (-1363.458) (-1367.547) -- 0:00:06 918000 -- (-1363.772) [-1362.965] (-1367.080) (-1362.722) * (-1364.015) (-1365.394) (-1364.798) [-1365.265] -- 0:00:06 918500 -- (-1363.644) (-1363.071) (-1364.341) [-1362.547] * [-1364.481] (-1365.707) (-1363.190) (-1362.744) -- 0:00:06 919000 -- (-1363.346) (-1363.988) [-1365.504] (-1363.881) * (-1364.021) (-1364.028) (-1366.417) [-1365.118] -- 0:00:06 919500 -- (-1365.890) (-1364.416) (-1364.447) [-1367.171] * [-1363.343] (-1365.117) (-1367.309) (-1362.523) -- 0:00:06 920000 -- (-1368.127) (-1366.887) (-1363.440) [-1364.030] * (-1364.974) (-1364.909) [-1363.753] (-1364.119) -- 0:00:05 Average standard deviation of split frequencies: 0.008875 920500 -- (-1368.388) (-1363.580) [-1365.314] (-1365.350) * [-1363.995] (-1365.417) (-1364.150) (-1366.853) -- 0:00:05 921000 -- (-1370.377) (-1366.614) (-1367.842) [-1365.513] * (-1365.277) (-1363.098) (-1365.827) [-1365.076] -- 0:00:05 921500 -- [-1365.906] (-1368.026) (-1364.268) (-1364.042) * [-1364.655] (-1364.242) (-1362.351) (-1371.795) -- 0:00:05 922000 -- (-1364.582) [-1364.007] (-1364.217) (-1367.391) * (-1364.690) (-1365.029) (-1366.378) [-1362.555] -- 0:00:05 922500 -- (-1363.128) (-1364.900) [-1366.213] (-1368.091) * (-1366.114) (-1366.765) (-1364.938) [-1364.385] -- 0:00:05 923000 -- [-1362.771] (-1365.241) (-1365.143) (-1364.035) * (-1364.022) (-1366.579) (-1362.937) [-1362.643] -- 0:00:05 923500 -- (-1363.176) (-1366.366) (-1366.276) [-1363.438] * (-1363.829) (-1367.144) [-1365.229] (-1361.892) -- 0:00:05 924000 -- [-1363.466] (-1365.024) (-1365.169) (-1362.687) * (-1362.268) (-1362.879) [-1367.159] (-1365.760) -- 0:00:05 924500 -- [-1363.192] (-1364.206) (-1363.047) (-1369.271) * (-1362.219) (-1363.132) [-1365.628] (-1365.671) -- 0:00:05 925000 -- [-1362.789] (-1364.768) (-1366.996) (-1364.844) * [-1363.482] (-1365.277) (-1364.272) (-1364.323) -- 0:00:05 Average standard deviation of split frequencies: 0.008711 925500 -- [-1365.336] (-1364.422) (-1365.220) (-1362.056) * (-1367.664) [-1362.863] (-1362.338) (-1362.975) -- 0:00:05 926000 -- (-1366.348) (-1364.089) (-1362.983) [-1363.329] * (-1363.571) (-1367.122) [-1362.426] (-1362.924) -- 0:00:05 926500 -- (-1363.998) [-1369.027] (-1363.721) (-1363.356) * (-1362.639) (-1362.084) (-1365.255) [-1364.157] -- 0:00:05 927000 -- (-1362.794) (-1364.811) [-1363.346] (-1363.831) * (-1362.396) (-1363.295) [-1366.082] (-1363.515) -- 0:00:05 927500 -- [-1363.060] (-1363.950) (-1369.100) (-1362.967) * [-1362.284] (-1364.885) (-1363.379) (-1365.344) -- 0:00:05 928000 -- (-1364.347) (-1363.513) (-1363.283) [-1364.263] * (-1362.052) [-1364.675] (-1362.780) (-1362.154) -- 0:00:05 928500 -- (-1362.811) [-1364.472] (-1363.682) (-1363.666) * (-1366.063) [-1363.899] (-1363.125) (-1362.883) -- 0:00:05 929000 -- (-1362.643) [-1364.908] (-1364.312) (-1363.603) * (-1364.292) (-1364.007) (-1362.233) [-1364.605] -- 0:00:05 929500 -- (-1364.174) (-1370.636) [-1364.671] (-1363.234) * [-1362.860] (-1366.192) (-1366.281) (-1363.821) -- 0:00:05 930000 -- (-1363.392) (-1367.360) [-1363.756] (-1365.416) * (-1364.002) (-1364.952) [-1362.889] (-1364.809) -- 0:00:05 Average standard deviation of split frequencies: 0.008667 930500 -- [-1366.007] (-1363.125) (-1365.822) (-1362.641) * [-1365.615] (-1365.998) (-1362.999) (-1365.450) -- 0:00:05 931000 -- [-1363.116] (-1364.532) (-1363.267) (-1364.063) * (-1365.931) [-1363.466] (-1364.687) (-1362.051) -- 0:00:05 931500 -- (-1364.691) (-1363.490) [-1364.014] (-1363.446) * (-1364.360) [-1365.137] (-1363.533) (-1362.633) -- 0:00:05 932000 -- [-1366.233] (-1367.937) (-1365.013) (-1364.641) * (-1363.658) (-1365.529) (-1364.527) [-1364.980] -- 0:00:05 932500 -- (-1365.089) [-1367.180] (-1364.375) (-1366.210) * (-1365.499) (-1368.817) [-1363.478] (-1366.183) -- 0:00:05 933000 -- (-1366.100) [-1369.292] (-1363.266) (-1368.488) * (-1366.996) (-1366.770) (-1366.860) [-1363.938] -- 0:00:05 933500 -- (-1363.901) (-1366.717) [-1363.454] (-1369.890) * (-1365.042) (-1366.500) (-1365.971) [-1365.708] -- 0:00:04 934000 -- (-1364.152) (-1366.168) [-1363.093] (-1367.172) * (-1365.534) [-1363.432] (-1363.394) (-1364.053) -- 0:00:04 934500 -- (-1362.931) (-1366.154) (-1364.868) [-1362.768] * (-1365.463) (-1363.319) (-1362.915) [-1365.511] -- 0:00:04 935000 -- [-1365.141] (-1364.224) (-1364.926) (-1364.448) * (-1365.199) [-1363.680] (-1362.998) (-1365.745) -- 0:00:04 Average standard deviation of split frequencies: 0.008674 935500 -- (-1364.647) (-1363.884) (-1364.163) [-1366.048] * (-1363.651) (-1363.589) [-1363.149] (-1367.717) -- 0:00:04 936000 -- [-1364.334] (-1366.845) (-1367.865) (-1366.073) * [-1364.945] (-1363.670) (-1366.549) (-1365.270) -- 0:00:04 936500 -- (-1363.691) [-1366.818] (-1362.542) (-1364.260) * (-1367.781) (-1364.254) (-1368.042) [-1362.939] -- 0:00:04 937000 -- (-1362.622) (-1369.623) (-1363.216) [-1365.452] * (-1366.562) [-1368.876] (-1364.508) (-1362.529) -- 0:00:04 937500 -- [-1363.326] (-1363.467) (-1365.005) (-1365.675) * (-1362.528) (-1364.332) [-1365.453] (-1363.391) -- 0:00:04 938000 -- [-1368.840] (-1366.080) (-1367.099) (-1367.208) * [-1363.300] (-1364.283) (-1365.893) (-1363.769) -- 0:00:04 938500 -- (-1367.547) (-1362.403) [-1362.548] (-1364.018) * (-1362.828) [-1364.048] (-1364.116) (-1363.321) -- 0:00:04 939000 -- (-1369.772) [-1363.290] (-1364.268) (-1362.912) * (-1362.569) (-1362.429) (-1363.665) [-1365.113] -- 0:00:04 939500 -- (-1366.014) [-1363.901] (-1362.633) (-1363.523) * [-1362.866] (-1364.645) (-1362.342) (-1368.210) -- 0:00:04 940000 -- (-1373.617) (-1364.149) (-1363.244) [-1364.666] * (-1364.758) [-1363.391] (-1362.498) (-1363.894) -- 0:00:04 Average standard deviation of split frequencies: 0.008798 940500 -- (-1370.645) (-1364.702) (-1367.930) [-1363.845] * (-1363.181) (-1363.170) (-1362.685) [-1363.781] -- 0:00:04 941000 -- (-1364.212) (-1362.674) (-1367.437) [-1363.152] * (-1362.031) (-1365.438) (-1362.684) [-1362.896] -- 0:00:04 941500 -- (-1366.150) (-1367.361) (-1367.021) [-1363.000] * (-1365.636) (-1364.226) (-1362.550) [-1362.715] -- 0:00:04 942000 -- (-1364.759) [-1367.145] (-1365.700) (-1366.900) * (-1365.641) (-1363.913) (-1365.131) [-1364.726] -- 0:00:04 942500 -- (-1362.510) [-1366.958] (-1365.136) (-1362.851) * (-1364.911) [-1363.058] (-1363.664) (-1364.067) -- 0:00:04 943000 -- [-1364.582] (-1362.176) (-1364.454) (-1365.408) * [-1365.031] (-1364.429) (-1364.393) (-1364.887) -- 0:00:04 943500 -- (-1364.071) (-1364.028) [-1364.223] (-1362.421) * (-1363.978) (-1364.271) [-1363.956] (-1363.750) -- 0:00:04 944000 -- [-1363.244] (-1364.684) (-1363.528) (-1362.173) * (-1367.859) [-1363.106] (-1362.732) (-1363.698) -- 0:00:04 944500 -- (-1362.280) [-1362.342] (-1364.095) (-1366.380) * (-1363.998) (-1364.348) [-1365.853] (-1367.326) -- 0:00:04 945000 -- [-1363.134] (-1364.511) (-1363.498) (-1364.663) * (-1365.049) (-1365.132) (-1364.022) [-1364.351] -- 0:00:04 Average standard deviation of split frequencies: 0.008720 945500 -- (-1364.779) (-1362.156) [-1363.179] (-1364.175) * (-1363.934) [-1363.044] (-1365.343) (-1367.492) -- 0:00:04 946000 -- (-1365.226) [-1361.962] (-1366.926) (-1364.666) * (-1363.029) [-1362.839] (-1365.186) (-1363.617) -- 0:00:04 946500 -- [-1362.018] (-1366.894) (-1365.707) (-1365.726) * [-1364.807] (-1363.618) (-1364.012) (-1363.686) -- 0:00:04 947000 -- (-1367.784) (-1366.096) [-1362.778] (-1363.460) * (-1367.549) [-1363.541] (-1371.056) (-1364.116) -- 0:00:03 947500 -- (-1371.154) (-1364.878) [-1362.955] (-1363.830) * (-1363.374) [-1363.027] (-1364.241) (-1363.841) -- 0:00:03 948000 -- (-1365.200) (-1364.969) [-1365.881] (-1364.753) * (-1363.582) [-1362.697] (-1366.274) (-1365.002) -- 0:00:03 948500 -- (-1364.345) (-1364.676) (-1364.334) [-1367.662] * (-1366.619) (-1363.919) (-1363.965) [-1365.039] -- 0:00:03 949000 -- (-1362.527) [-1363.472] (-1364.811) (-1364.129) * (-1362.808) [-1363.295] (-1366.821) (-1368.501) -- 0:00:03 949500 -- [-1363.141] (-1363.584) (-1368.771) (-1365.434) * (-1362.227) [-1370.478] (-1363.247) (-1363.458) -- 0:00:03 950000 -- (-1362.177) (-1366.603) (-1366.268) [-1366.369] * (-1364.636) (-1363.548) [-1366.366] (-1362.543) -- 0:00:03 Average standard deviation of split frequencies: 0.008678 950500 -- (-1362.194) [-1363.635] (-1366.392) (-1364.799) * [-1364.060] (-1362.739) (-1366.795) (-1362.543) -- 0:00:03 951000 -- (-1364.278) [-1363.601] (-1365.102) (-1364.773) * (-1362.716) (-1365.542) [-1362.909] (-1365.270) -- 0:00:03 951500 -- (-1363.699) [-1364.484] (-1362.795) (-1367.779) * [-1362.990] (-1372.088) (-1362.458) (-1365.107) -- 0:00:03 952000 -- (-1363.072) (-1363.335) (-1365.557) [-1367.887] * [-1365.072] (-1370.168) (-1362.266) (-1363.359) -- 0:00:03 952500 -- [-1362.843] (-1363.855) (-1364.534) (-1365.786) * [-1363.200] (-1363.570) (-1365.844) (-1364.309) -- 0:00:03 953000 -- [-1366.468] (-1365.472) (-1364.385) (-1364.125) * (-1364.828) [-1363.283] (-1369.748) (-1364.975) -- 0:00:03 953500 -- [-1362.803] (-1367.522) (-1362.289) (-1364.051) * (-1366.717) [-1362.542] (-1365.693) (-1364.451) -- 0:00:03 954000 -- [-1363.211] (-1367.172) (-1366.523) (-1364.079) * [-1362.588] (-1364.891) (-1368.637) (-1363.693) -- 0:00:03 954500 -- (-1362.764) [-1363.886] (-1363.995) (-1362.039) * [-1362.453] (-1365.357) (-1365.467) (-1365.880) -- 0:00:03 955000 -- (-1362.219) (-1362.866) (-1362.379) [-1362.801] * [-1362.908] (-1364.191) (-1365.493) (-1365.097) -- 0:00:03 Average standard deviation of split frequencies: 0.008547 955500 -- (-1364.884) (-1366.674) [-1363.434] (-1367.634) * [-1362.289] (-1364.160) (-1366.198) (-1364.649) -- 0:00:03 956000 -- (-1364.181) (-1367.125) [-1364.453] (-1362.282) * [-1362.107] (-1365.622) (-1371.319) (-1364.589) -- 0:00:03 956500 -- [-1363.540] (-1366.572) (-1364.273) (-1363.661) * (-1362.908) (-1363.339) [-1366.478] (-1368.763) -- 0:00:03 957000 -- (-1362.544) (-1369.632) (-1367.264) [-1364.361] * (-1366.032) [-1363.074] (-1364.774) (-1363.341) -- 0:00:03 957500 -- [-1362.195] (-1363.635) (-1367.520) (-1364.375) * (-1364.000) [-1363.979] (-1364.439) (-1363.612) -- 0:00:03 958000 -- (-1365.587) [-1362.896] (-1368.166) (-1363.070) * (-1365.152) (-1369.278) [-1363.153] (-1363.411) -- 0:00:03 958500 -- [-1363.243] (-1365.222) (-1365.483) (-1366.779) * (-1365.212) (-1367.329) (-1362.827) [-1363.116] -- 0:00:03 959000 -- [-1362.612] (-1365.622) (-1364.680) (-1370.947) * (-1364.003) (-1364.935) [-1365.304] (-1363.521) -- 0:00:03 959500 -- (-1364.223) [-1362.695] (-1369.657) (-1363.643) * (-1362.758) (-1363.844) (-1364.398) [-1362.841] -- 0:00:03 960000 -- (-1364.054) (-1365.535) (-1370.093) [-1363.432] * (-1363.114) [-1364.383] (-1365.368) (-1364.430) -- 0:00:02 Average standard deviation of split frequencies: 0.008400 960500 -- [-1362.819] (-1362.919) (-1364.197) (-1365.857) * (-1364.176) (-1364.585) (-1363.967) [-1364.900] -- 0:00:02 961000 -- (-1364.644) (-1364.930) [-1365.034] (-1365.683) * (-1365.912) (-1368.442) (-1364.433) [-1364.794] -- 0:00:02 961500 -- (-1364.255) [-1363.523] (-1362.757) (-1363.828) * (-1366.094) (-1362.251) [-1363.955] (-1363.965) -- 0:00:02 962000 -- [-1366.342] (-1367.213) (-1365.598) (-1363.665) * (-1365.292) (-1365.185) [-1363.089] (-1364.142) -- 0:00:02 962500 -- (-1366.225) [-1363.372] (-1362.649) (-1369.230) * (-1362.479) (-1364.222) (-1366.326) [-1362.720] -- 0:00:02 963000 -- (-1365.335) (-1362.920) (-1362.743) [-1362.380] * (-1362.236) (-1366.499) (-1365.152) [-1365.392] -- 0:00:02 963500 -- (-1363.638) (-1363.749) [-1362.810] (-1362.579) * (-1363.550) (-1366.530) (-1364.211) [-1364.658] -- 0:00:02 964000 -- [-1364.925] (-1364.066) (-1362.399) (-1364.651) * (-1363.790) (-1367.547) (-1364.602) [-1362.523] -- 0:00:02 964500 -- (-1364.696) (-1365.050) (-1362.260) [-1365.273] * (-1363.898) (-1366.550) (-1365.019) [-1362.756] -- 0:00:02 965000 -- (-1363.351) (-1366.401) [-1363.353] (-1365.407) * [-1362.539] (-1367.345) (-1364.074) (-1362.763) -- 0:00:02 Average standard deviation of split frequencies: 0.008648 965500 -- [-1363.040] (-1367.316) (-1365.789) (-1364.340) * [-1363.305] (-1363.395) (-1366.360) (-1362.715) -- 0:00:02 966000 -- (-1366.775) [-1364.591] (-1365.417) (-1362.675) * (-1366.923) (-1362.922) (-1366.787) [-1363.829] -- 0:00:02 966500 -- [-1364.526] (-1366.459) (-1365.600) (-1362.258) * [-1364.960] (-1363.158) (-1364.590) (-1364.639) -- 0:00:02 967000 -- [-1362.088] (-1367.323) (-1364.182) (-1366.277) * [-1362.350] (-1364.946) (-1362.830) (-1364.033) -- 0:00:02 967500 -- (-1362.957) (-1363.563) [-1363.016] (-1365.170) * [-1364.106] (-1365.142) (-1363.639) (-1363.082) -- 0:00:02 968000 -- [-1362.022] (-1365.323) (-1363.889) (-1363.875) * [-1368.226] (-1365.222) (-1363.208) (-1364.659) -- 0:00:02 968500 -- (-1362.694) [-1363.406] (-1367.629) (-1363.037) * (-1367.046) (-1364.823) [-1365.449] (-1363.722) -- 0:00:02 969000 -- (-1365.031) (-1362.205) (-1364.865) [-1363.037] * (-1371.911) [-1363.012] (-1363.433) (-1362.151) -- 0:00:02 969500 -- (-1363.323) (-1364.486) [-1365.340] (-1363.018) * (-1362.975) [-1364.486] (-1363.521) (-1362.919) -- 0:00:02 970000 -- (-1362.932) (-1364.091) [-1363.285] (-1363.510) * [-1362.593] (-1367.998) (-1367.176) (-1367.390) -- 0:00:02 Average standard deviation of split frequencies: 0.008170 970500 -- [-1362.198] (-1362.885) (-1365.336) (-1362.317) * (-1362.571) (-1364.611) (-1363.338) [-1362.881] -- 0:00:02 971000 -- (-1363.508) (-1367.827) (-1364.250) [-1362.406] * (-1363.023) [-1366.132] (-1363.548) (-1365.911) -- 0:00:02 971500 -- (-1362.426) (-1368.434) [-1365.428] (-1364.847) * (-1362.153) [-1364.783] (-1365.466) (-1363.080) -- 0:00:02 972000 -- (-1362.849) (-1368.091) (-1366.834) [-1365.410] * (-1368.766) (-1367.249) (-1363.021) [-1363.689] -- 0:00:02 972500 -- [-1363.049] (-1364.802) (-1368.687) (-1365.049) * (-1367.461) (-1365.559) [-1364.712] (-1365.646) -- 0:00:02 973000 -- (-1367.180) (-1362.891) [-1366.037] (-1364.158) * (-1365.864) (-1370.679) [-1366.794] (-1364.221) -- 0:00:02 973500 -- (-1366.355) (-1363.376) (-1366.110) [-1365.193] * (-1365.612) [-1367.148] (-1363.151) (-1369.036) -- 0:00:01 974000 -- (-1363.412) (-1364.280) [-1366.005] (-1365.502) * [-1364.656] (-1367.952) (-1362.830) (-1364.920) -- 0:00:01 974500 -- (-1363.426) (-1371.357) (-1362.231) [-1365.113] * (-1362.855) (-1366.859) (-1362.944) [-1365.170] -- 0:00:01 975000 -- [-1363.251] (-1366.717) (-1363.926) (-1365.258) * (-1362.118) (-1365.922) (-1364.323) [-1365.311] -- 0:00:01 Average standard deviation of split frequencies: 0.008154 975500 -- (-1366.272) [-1363.860] (-1368.260) (-1363.403) * (-1367.515) (-1363.705) (-1362.900) [-1363.367] -- 0:00:01 976000 -- [-1363.618] (-1363.786) (-1365.868) (-1367.354) * [-1366.001] (-1364.627) (-1363.120) (-1364.788) -- 0:00:01 976500 -- [-1363.424] (-1364.056) (-1364.332) (-1365.622) * (-1362.386) (-1364.730) (-1363.200) [-1363.791] -- 0:00:01 977000 -- (-1362.878) (-1362.077) (-1364.386) [-1367.464] * (-1362.343) (-1363.240) (-1362.681) [-1363.355] -- 0:00:01 977500 -- (-1364.610) [-1362.785] (-1366.903) (-1365.454) * [-1362.627] (-1363.524) (-1362.975) (-1366.347) -- 0:00:01 978000 -- (-1364.296) [-1362.529] (-1367.417) (-1363.444) * (-1365.631) (-1364.060) [-1362.557] (-1366.068) -- 0:00:01 978500 -- (-1362.513) (-1363.244) [-1367.422] (-1364.237) * (-1363.336) [-1364.483] (-1362.913) (-1365.548) -- 0:00:01 979000 -- (-1364.702) [-1365.291] (-1363.569) (-1365.708) * (-1362.579) (-1364.413) (-1365.349) [-1364.003] -- 0:00:01 979500 -- (-1364.648) [-1364.256] (-1366.424) (-1363.932) * (-1363.234) (-1365.085) (-1366.410) [-1364.378] -- 0:00:01 980000 -- [-1364.113] (-1362.906) (-1363.206) (-1364.805) * (-1368.247) (-1364.166) [-1365.580] (-1364.843) -- 0:00:01 Average standard deviation of split frequencies: 0.007861 980500 -- (-1365.640) (-1362.985) [-1367.721] (-1362.245) * (-1364.576) [-1364.024] (-1363.435) (-1365.756) -- 0:00:01 981000 -- (-1362.330) (-1363.172) (-1368.934) [-1363.190] * [-1363.735] (-1365.900) (-1364.414) (-1363.747) -- 0:00:01 981500 -- (-1363.428) (-1363.978) (-1363.218) [-1363.190] * [-1362.481] (-1364.111) (-1363.069) (-1363.983) -- 0:00:01 982000 -- [-1364.543] (-1364.851) (-1364.430) (-1362.330) * (-1364.178) [-1363.711] (-1362.343) (-1363.135) -- 0:00:01 982500 -- (-1364.228) [-1365.044] (-1364.481) (-1362.524) * [-1365.368] (-1364.604) (-1361.905) (-1362.576) -- 0:00:01 983000 -- (-1364.292) [-1362.053] (-1365.940) (-1363.727) * (-1364.683) [-1365.902] (-1362.173) (-1363.354) -- 0:00:01 983500 -- (-1362.572) [-1362.052] (-1364.790) (-1363.311) * (-1363.666) [-1365.506] (-1367.468) (-1365.965) -- 0:00:01 984000 -- [-1362.812] (-1365.642) (-1364.075) (-1363.775) * (-1364.082) [-1364.884] (-1368.435) (-1365.091) -- 0:00:01 984500 -- (-1362.603) (-1362.616) (-1362.123) [-1363.400] * (-1365.700) [-1363.586] (-1367.790) (-1363.580) -- 0:00:01 985000 -- (-1363.925) [-1363.634] (-1362.485) (-1363.838) * (-1365.860) (-1363.077) (-1365.563) [-1362.932] -- 0:00:01 Average standard deviation of split frequencies: 0.007875 985500 -- (-1363.385) (-1366.358) [-1364.373] (-1364.898) * (-1370.529) (-1366.394) (-1366.186) [-1365.597] -- 0:00:01 986000 -- (-1363.544) (-1364.350) [-1365.539] (-1367.715) * (-1367.751) (-1363.697) [-1363.194] (-1367.493) -- 0:00:01 986500 -- (-1363.001) (-1366.581) [-1365.048] (-1368.682) * (-1368.410) (-1364.779) [-1364.154] (-1364.740) -- 0:00:01 987000 -- (-1362.299) (-1365.175) (-1365.921) [-1363.921] * [-1363.052] (-1364.309) (-1366.071) (-1362.517) -- 0:00:00 987500 -- (-1362.458) (-1364.922) [-1364.437] (-1367.614) * [-1365.221] (-1365.315) (-1365.517) (-1363.136) -- 0:00:00 988000 -- (-1363.009) (-1363.698) [-1363.293] (-1367.135) * (-1366.102) [-1363.212] (-1362.781) (-1363.633) -- 0:00:00 988500 -- [-1364.423] (-1366.780) (-1364.387) (-1366.079) * (-1371.570) [-1363.939] (-1368.923) (-1363.155) -- 0:00:00 989000 -- (-1363.575) [-1362.427] (-1364.319) (-1363.349) * (-1364.100) (-1362.867) [-1367.759] (-1363.034) -- 0:00:00 989500 -- (-1364.672) (-1363.310) [-1364.372] (-1364.064) * (-1362.379) [-1364.020] (-1363.643) (-1364.654) -- 0:00:00 990000 -- [-1364.179] (-1365.639) (-1361.924) (-1363.741) * [-1362.509] (-1366.840) (-1363.867) (-1363.839) -- 0:00:00 Average standard deviation of split frequencies: 0.008117 990500 -- (-1363.634) (-1367.748) [-1365.523] (-1365.381) * (-1364.751) (-1365.225) (-1366.023) [-1363.488] -- 0:00:00 991000 -- (-1363.268) [-1365.885] (-1363.712) (-1363.778) * (-1364.751) (-1371.170) [-1362.188] (-1363.261) -- 0:00:00 991500 -- (-1364.536) (-1363.793) [-1363.811] (-1364.559) * (-1365.979) (-1365.572) [-1364.585] (-1364.654) -- 0:00:00 992000 -- (-1365.022) (-1362.559) (-1365.567) [-1364.545] * (-1364.488) [-1364.669] (-1363.823) (-1365.142) -- 0:00:00 992500 -- [-1364.542] (-1362.737) (-1367.816) (-1365.022) * (-1364.046) (-1364.349) [-1363.586] (-1362.685) -- 0:00:00 993000 -- (-1362.881) (-1364.793) [-1365.253] (-1362.354) * (-1362.546) (-1362.141) (-1365.612) [-1363.324] -- 0:00:00 993500 -- (-1367.743) [-1362.685] (-1362.329) (-1365.290) * [-1363.383] (-1362.194) (-1363.891) (-1363.125) -- 0:00:00 994000 -- (-1364.513) (-1363.187) [-1365.705] (-1362.474) * (-1362.415) (-1363.379) [-1363.695] (-1363.832) -- 0:00:00 994500 -- (-1364.925) (-1363.906) [-1363.434] (-1364.688) * (-1365.224) (-1363.683) (-1363.619) [-1363.934] -- 0:00:00 995000 -- (-1364.204) (-1366.921) (-1364.088) [-1365.153] * (-1365.694) [-1363.505] (-1364.079) (-1362.448) -- 0:00:00 Average standard deviation of split frequencies: 0.008130 995500 -- [-1363.205] (-1362.313) (-1362.837) (-1363.749) * (-1362.735) (-1364.610) [-1365.567] (-1364.346) -- 0:00:00 996000 -- (-1363.256) (-1364.896) [-1363.002] (-1365.367) * (-1362.724) (-1366.360) (-1369.519) [-1363.514] -- 0:00:00 996500 -- (-1365.261) (-1364.048) (-1364.924) [-1365.334] * [-1365.018] (-1367.019) (-1365.426) (-1363.320) -- 0:00:00 997000 -- (-1365.771) (-1363.121) (-1362.734) [-1369.156] * [-1364.084] (-1368.231) (-1363.519) (-1362.410) -- 0:00:00 997500 -- (-1365.770) (-1362.026) (-1368.925) [-1362.989] * (-1365.631) (-1364.162) [-1366.783] (-1365.347) -- 0:00:00 998000 -- (-1366.543) (-1362.515) [-1363.534] (-1366.435) * (-1363.395) (-1362.619) [-1362.864] (-1363.167) -- 0:00:00 998500 -- (-1363.805) (-1362.743) [-1365.538] (-1366.965) * (-1362.897) [-1365.184] (-1363.908) (-1365.353) -- 0:00:00 999000 -- (-1369.382) [-1363.646] (-1365.054) (-1364.590) * [-1362.684] (-1363.428) (-1363.488) (-1366.033) -- 0:00:00 999500 -- (-1365.760) (-1364.969) (-1363.167) [-1362.546] * (-1363.649) (-1362.868) [-1367.675] (-1362.521) -- 0:00:00 1000000 -- (-1365.164) (-1367.719) (-1363.044) [-1367.009] * [-1363.414] (-1367.538) (-1364.076) (-1363.914) -- 0:00:00 Average standard deviation of split frequencies: 0.007731 Analysis completed in 1 mins 15 seconds Analysis used 74.16 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1361.77 Likelihood of best state for "cold" chain of run 2 was -1361.77 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 76.0 % ( 80 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.6 % ( 24 %) Dirichlet(Pi{all}) 27.4 % ( 16 %) Slider(Pi{all}) 78.6 % ( 56 %) Multiplier(Alpha{1,2}) 77.5 % ( 55 %) Multiplier(Alpha{3}) 17.4 % ( 29 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 71 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 87 %) ParsSPR(Tau{all},V{all}) 28.3 % ( 21 %) Multiplier(V{all}) 97.3 % ( 98 %) Nodeslider(V{all}) 30.4 % ( 17 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.9 % ( 58 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.6 % ( 27 %) Dirichlet(Pi{all}) 27.7 % ( 27 %) Slider(Pi{all}) 78.7 % ( 58 %) Multiplier(Alpha{1,2}) 77.3 % ( 53 %) Multiplier(Alpha{3}) 17.5 % ( 21 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 66 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 27 %) Multiplier(V{all}) 97.4 % ( 96 %) Nodeslider(V{all}) 30.2 % ( 22 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.80 0.64 0.50 2 | 166884 0.82 0.67 3 | 166420 166614 0.84 4 | 166711 167058 166313 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166299 0.82 0.66 3 | 166429 166591 0.84 4 | 167616 166626 166439 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1363.57 | 2 2 2 | | 1 1 | | 1 1 1 1 2 2* 2 1 | | 2 * 1 1 21 2 1 | |2 2 2 1 22 1 1 * 2 | | * 1 *22 1 11 2* 1 2 222 21* 2 12| | 11 2 1 2 2 * 2 2 2 | | 1 1 2 2 222 1 * 2 21 * * 1 1 1| | 1 1 2 * 1 1 2 | |1 2 21 1 * 1 | | 2 1 1 2 1 1 1 1 | | 1 | | | | 2 2 | | 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1365.33 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1363.54 -1366.43 2 -1363.54 -1366.66 -------------------------------------- TOTAL -1363.54 -1366.55 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897703 0.090334 0.346355 1.480789 0.861307 1466.17 1483.58 1.000 r(A<->C){all} 0.164386 0.019525 0.000169 0.447856 0.128052 88.37 165.12 1.000 r(A<->G){all} 0.171182 0.020389 0.000105 0.451545 0.134775 453.30 473.82 1.000 r(A<->T){all} 0.161557 0.019262 0.000037 0.445107 0.126177 190.89 212.45 1.021 r(C<->G){all} 0.163240 0.021572 0.000100 0.463016 0.117682 117.60 165.59 1.002 r(C<->T){all} 0.175586 0.021828 0.000162 0.476840 0.137348 221.95 244.04 1.012 r(G<->T){all} 0.164048 0.019741 0.000057 0.452387 0.125172 236.66 245.33 1.000 pi(A){all} 0.235676 0.000177 0.210036 0.261400 0.235627 1407.65 1454.32 1.001 pi(C){all} 0.316860 0.000219 0.287623 0.344544 0.316534 1131.41 1214.70 1.000 pi(G){all} 0.273956 0.000201 0.246402 0.300802 0.273766 1281.54 1290.58 1.000 pi(T){all} 0.173508 0.000143 0.150317 0.196709 0.173103 1248.42 1287.01 1.000 alpha{1,2} 0.432779 0.237202 0.000118 1.423052 0.255054 1003.82 1207.02 1.000 alpha{3} 0.461632 0.243672 0.000147 1.481021 0.295598 1054.36 1098.21 1.000 pinvar{all} 0.998461 0.000003 0.994966 0.999999 0.999024 1078.15 1202.02 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ...**. 8 -- .**... 9 -- ..**** 10 -- .*.*** 11 -- .*...* 12 -- .*..*. 13 -- ..**.. 14 -- ..*..* 15 -- .***.* 16 -- .**.** 17 -- .*.*.. 18 -- ..*.*. 19 -- ...*.* 20 -- .****. 21 -- ....** 22 -- ...*** 23 -- .*.**. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 468 0.155896 0.007537 0.150566 0.161226 2 8 438 0.145903 0.008480 0.139907 0.151899 2 9 438 0.145903 0.001884 0.144570 0.147235 2 10 435 0.144903 0.001413 0.143904 0.145903 2 11 434 0.144570 0.002827 0.142572 0.146569 2 12 431 0.143571 0.013662 0.133911 0.153231 2 13 429 0.142905 0.016488 0.131246 0.154564 2 14 427 0.142239 0.017430 0.129913 0.154564 2 15 425 0.141572 0.007066 0.136576 0.146569 2 16 424 0.141239 0.005653 0.137242 0.145237 2 17 422 0.140573 0.004711 0.137242 0.143904 2 18 422 0.140573 0.006595 0.135909 0.145237 2 19 416 0.138574 0.001884 0.137242 0.139907 2 20 405 0.134910 0.010835 0.127249 0.142572 2 21 402 0.133911 0.009422 0.127249 0.140573 2 22 309 0.102931 0.002355 0.101266 0.104597 2 23 280 0.093271 0.013191 0.083944 0.102598 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.098954 0.009391 0.000126 0.302607 0.070114 1.000 2 length{all}[2] 0.099138 0.010237 0.000014 0.296074 0.068492 1.000 2 length{all}[3] 0.099267 0.009853 0.000027 0.288815 0.069650 1.000 2 length{all}[4] 0.097392 0.009394 0.000014 0.293798 0.068805 1.000 2 length{all}[5] 0.099189 0.010173 0.000005 0.297850 0.068547 1.000 2 length{all}[6] 0.097478 0.009342 0.000062 0.300039 0.066036 1.000 2 length{all}[7] 0.100012 0.011429 0.000492 0.342639 0.064595 1.000 2 length{all}[8] 0.098629 0.010045 0.000376 0.312792 0.067356 1.000 2 length{all}[9] 0.100926 0.009607 0.000275 0.300067 0.071189 0.998 2 length{all}[10] 0.097666 0.010238 0.000145 0.307302 0.060053 0.999 2 length{all}[11] 0.111982 0.012494 0.000067 0.342163 0.081115 0.998 2 length{all}[12] 0.099492 0.009777 0.000659 0.297251 0.071672 0.998 2 length{all}[13] 0.102580 0.010096 0.000386 0.295656 0.065903 0.998 2 length{all}[14] 0.096126 0.009473 0.000013 0.288925 0.061099 0.998 2 length{all}[15] 0.105517 0.011638 0.000226 0.323044 0.071250 0.998 2 length{all}[16] 0.090655 0.009000 0.000599 0.300447 0.060557 0.998 2 length{all}[17] 0.102760 0.009327 0.000109 0.288953 0.075294 1.003 2 length{all}[18] 0.103910 0.010344 0.000174 0.308966 0.070985 0.999 2 length{all}[19] 0.101157 0.012159 0.000036 0.312728 0.066010 0.998 2 length{all}[20] 0.106337 0.010907 0.000020 0.339799 0.072631 0.998 2 length{all}[21] 0.100413 0.010899 0.000395 0.319862 0.067722 1.004 2 length{all}[22] 0.101690 0.009988 0.000408 0.288443 0.075898 1.010 2 length{all}[23] 0.114229 0.011878 0.000040 0.325192 0.081946 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007731 Maximum standard deviation of split frequencies = 0.017430 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.010 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |---------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |----------------------------------------------------------------------- C4 (4) | |---------------------------------------------------------------------- C5 (5) | \-------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 44 trees 90 % credible set contains 90 trees 95 % credible set contains 97 trees 99 % credible set contains 103 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1005 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sites with gaps or missing data are removed. 12 ambiguity characters in seq. 1 6 ambiguity characters in seq. 2 12 ambiguity characters in seq. 3 12 ambiguity characters in seq. 4 12 ambiguity characters in seq. 5 12 ambiguity characters in seq. 6 4 sites are removed. 1 2 334 335 Sequences read.. Counting site patterns.. 0:00 Compressing, 56 patterns at 331 / 331 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 56 patterns at 331 / 331 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 54656 bytes for conP 4928 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.099700 0.071308 0.087217 0.024145 0.014132 0.075572 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1409.060034 Iterating by ming2 Initial: fx= 1409.060034 x= 0.09970 0.07131 0.08722 0.02415 0.01413 0.07557 0.30000 1.30000 1 h-m-p 0.0000 0.0000 792.3330 ++ 1381.868678 m 0.0000 13 | 1/8 2 h-m-p 0.0004 0.0032 81.6929 ----------.. | 1/8 3 h-m-p 0.0000 0.0000 723.9529 ++ 1365.752473 m 0.0000 43 | 2/8 4 h-m-p 0.0003 0.0046 66.1546 ----------.. | 2/8 5 h-m-p 0.0000 0.0001 647.2615 ++ 1304.255835 m 0.0001 73 | 3/8 6 h-m-p 0.0014 0.0072 42.2105 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 565.5058 ++ 1300.025858 m 0.0000 104 | 4/8 8 h-m-p 0.0003 0.0149 21.0439 ----------.. | 4/8 9 h-m-p 0.0000 0.0000 461.5714 ++ 1292.306422 m 0.0000 134 | 5/8 10 h-m-p 0.0009 0.0236 13.4769 -----------.. | 5/8 11 h-m-p 0.0000 0.0000 326.7404 ++ 1288.148743 m 0.0000 165 | 6/8 12 h-m-p 0.3596 8.0000 0.0000 Y 1288.148743 0 0.0899 176 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 -----C 1288.148743 0 0.0004 194 Out.. lnL = -1288.148743 195 lfun, 195 eigenQcodon, 1170 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.028925 0.109761 0.100568 0.031581 0.011180 0.012272 0.299876 0.644357 0.375693 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 10.571948 np = 9 lnL0 = -1381.297312 Iterating by ming2 Initial: fx= 1381.297312 x= 0.02892 0.10976 0.10057 0.03158 0.01118 0.01227 0.29988 0.64436 0.37569 1 h-m-p 0.0000 0.0000 755.6771 ++ 1360.645862 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0000 401.2629 ++ 1358.860687 m 0.0000 26 | 2/9 3 h-m-p 0.0000 0.0001 301.2177 ++ 1340.407094 m 0.0001 38 | 3/9 4 h-m-p 0.0000 0.0000 256.7145 ++ 1337.997710 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0002 794.4364 ++ 1292.093850 m 0.0002 62 | 5/9 6 h-m-p 0.0000 0.0001 545.4544 ++ 1288.148741 m 0.0001 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0000 ++ 1288.148741 m 8.0000 86 | 6/9 8 h-m-p 0.0571 8.0000 0.0070 ++++ 1288.148739 m 8.0000 103 | 6/9 9 h-m-p 0.0126 0.0628 4.3482 ++ 1288.148728 m 0.0628 118 | 7/9 10 h-m-p 0.3533 1.7665 0.1853 ++ 1288.148714 m 1.7665 130 | 8/9 11 h-m-p 0.8070 7.5389 0.1077 ------------C 1288.148714 0 0.0000 156 | 8/9 12 h-m-p 0.0001 0.0696 2.7040 +++++ 1288.148682 m 0.0696 172 | 9/9 13 h-m-p 0.0160 8.0000 0.0000 Y 1288.148682 0 0.0160 184 | 9/9 14 h-m-p 0.0160 8.0000 0.0000 Y 1288.148682 0 0.0160 196 Out.. lnL = -1288.148682 197 lfun, 591 eigenQcodon, 2364 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.072009 0.031295 0.103709 0.012402 0.105943 0.071631 0.000100 0.992549 0.197239 0.277460 1.406690 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.867746 np = 11 lnL0 = -1407.744675 Iterating by ming2 Initial: fx= 1407.744675 x= 0.07201 0.03129 0.10371 0.01240 0.10594 0.07163 0.00011 0.99255 0.19724 0.27746 1.40669 1 h-m-p 0.0000 0.0000 685.1061 ++ 1406.973123 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 493.5715 ++ 1384.825317 m 0.0001 30 | 2/11 3 h-m-p 0.0000 0.0002 188.7174 ++ 1361.700108 m 0.0002 44 | 3/11 4 h-m-p 0.0004 0.0035 87.9182 ++ 1314.446098 m 0.0035 58 | 4/11 5 h-m-p 0.0000 0.0000 80751.3924 ++ 1314.059947 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0000 299672.1612 ++ 1310.154834 m 0.0000 86 | 6/11 7 h-m-p 0.0012 0.0061 35.6042 ++ 1307.614295 m 0.0061 100 | 7/11 8 h-m-p 0.0097 4.8331 31.9525 -------------.. | 7/11 9 h-m-p 0.0000 0.0002 293.8209 +++ 1288.148725 m 0.0002 140 | 8/11 10 h-m-p 1.6000 8.0000 0.0000 ++ 1288.148725 m 8.0000 154 | 8/11 11 h-m-p 0.0464 8.0000 0.0015 -----Y 1288.148725 0 0.0000 176 | 8/11 12 h-m-p 0.0160 8.0000 0.0001 -----C 1288.148725 0 0.0000 198 | 8/11 13 h-m-p 0.0160 8.0000 0.0002 +++++ 1288.148725 m 8.0000 218 | 8/11 14 h-m-p 0.0160 8.0000 1.7026 -----------N 1288.148725 0 0.0000 246 | 8/11 15 h-m-p 0.0160 8.0000 0.0000 Y 1288.148725 0 0.0160 260 | 8/11 16 h-m-p 0.1096 8.0000 0.0000 N 1288.148725 0 0.0274 277 Out.. lnL = -1288.148725 278 lfun, 1112 eigenQcodon, 5004 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1288.176791 S = -1288.143880 -0.012662 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:03 did 20 / 56 patterns 0:03 did 30 / 56 patterns 0:03 did 40 / 56 patterns 0:03 did 50 / 56 patterns 0:03 did 56 / 56 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.088858 0.050957 0.040690 0.071910 0.054236 0.021456 0.000100 0.650493 1.079756 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 17.036331 np = 9 lnL0 = -1388.562176 Iterating by ming2 Initial: fx= 1388.562176 x= 0.08886 0.05096 0.04069 0.07191 0.05424 0.02146 0.00011 0.65049 1.07976 1 h-m-p 0.0000 0.0000 704.2227 ++ 1387.723813 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0043 113.0514 +++++ 1338.488463 m 0.0043 29 | 2/9 3 h-m-p 0.0000 0.0001 473.4303 ++ 1318.317238 m 0.0001 41 | 3/9 4 h-m-p 0.0002 0.0009 135.2103 ++ 1311.956799 m 0.0009 53 | 4/9 5 h-m-p 0.0001 0.0005 70.6812 ++ 1308.059135 m 0.0005 65 | 5/9 6 h-m-p 0.0000 0.0000 186.9021 ++ 1305.337433 m 0.0000 77 | 6/9 7 h-m-p 0.0002 0.0019 28.7293 ++ 1304.089078 m 0.0019 89 | 7/9 8 h-m-p 0.0445 8.0000 0.9488 --------------.. | 7/9 9 h-m-p 0.0000 0.0002 303.7405 +++ 1288.148682 m 0.0002 128 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 N 1288.148682 0 1.6000 140 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 N 1288.148682 0 0.0160 153 Out.. lnL = -1288.148682 154 lfun, 1694 eigenQcodon, 9240 P(t) Time used: 0:05 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.077954 0.097561 0.068172 0.011694 0.015856 0.094649 0.000100 0.900000 0.391639 1.335292 1.300008 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 18.485971 np = 11 lnL0 = -1392.337577 Iterating by ming2 Initial: fx= 1392.337577 x= 0.07795 0.09756 0.06817 0.01169 0.01586 0.09465 0.00011 0.90000 0.39164 1.33529 1.30001 1 h-m-p 0.0000 0.0000 620.0443 ++ 1391.960419 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0003 300.5943 +++ 1371.956515 m 0.0003 31 | 2/11 3 h-m-p 0.0000 0.0000 314.9586 ++ 1366.301996 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0005 755.4072 +++ 1304.690749 m 0.0005 60 | 4/11 5 h-m-p 0.0005 0.0024 58.7725 ++ 1297.851249 m 0.0024 74 | 5/11 6 h-m-p 0.0000 0.0000 3208.2765 ++ 1295.066463 m 0.0000 88 | 6/11 7 h-m-p 0.0000 0.0000 90591.7336 ++ 1291.626214 m 0.0000 102 | 7/11 8 h-m-p 0.0026 0.0128 51.3679 ++ 1288.148724 m 0.0128 116 | 8/11 9 h-m-p 1.6000 8.0000 0.0004 ++ 1288.148724 m 8.0000 130 | 8/11 10 h-m-p 0.0415 8.0000 0.0677 ---------C 1288.148724 0 0.0000 156 | 8/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1288.148724 m 8.0000 176 | 8/11 12 h-m-p 0.0013 0.6425 1.2313 +++++ 1288.148682 m 0.6425 196 | 9/11 13 h-m-p 1.6000 8.0000 0.0350 ----C 1288.148682 0 0.0016 214 | 9/11 14 h-m-p 1.6000 8.0000 0.0000 Y 1288.148682 0 0.4000 230 | 9/11 15 h-m-p 0.4184 8.0000 0.0000 Y 1288.148682 0 0.1046 246 | 9/11 16 h-m-p 0.1707 8.0000 0.0000 +Y 1288.148682 0 0.6827 263 | 9/11 17 h-m-p 0.0914 8.0000 0.0000 Y 1288.148682 0 0.0229 279 | 9/11 18 h-m-p 1.6000 8.0000 0.0000 N 1288.148682 0 1.6000 295 | 9/11 19 h-m-p 0.7619 8.0000 0.0000 ----N 1288.148682 0 0.0007 315 Out.. lnL = -1288.148682 316 lfun, 3792 eigenQcodon, 20856 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1288.291280 S = -1288.150956 -0.063707 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:11 did 20 / 56 patterns 0:11 did 30 / 56 patterns 0:11 did 40 / 56 patterns 0:11 did 50 / 56 patterns 0:11 did 56 / 56 patterns 0:11 Time used: 0:11 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=335 NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD NC_002677_1_NP_302328_1_1200_rmlB LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD NZ_CP029543_1_WP_041323079_1_2117_rfbB --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD NZ_AP014567_1_WP_041323079_1_2176_rfbB --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD ************************************************ NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV NC_002677_1_NP_302328_1_1200_rmlB HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV NZ_CP029543_1_WP_041323079_1_2117_rfbB HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV NZ_AP014567_1_WP_041323079_1_2176_rfbB HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV ************************************************** NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS NC_002677_1_NP_302328_1_1200_rmlB IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS NZ_CP029543_1_WP_041323079_1_2117_rfbB IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS NZ_AP014567_1_WP_041323079_1_2176_rfbB IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ************************************************** NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG NC_002677_1_NP_302328_1_1200_rmlB ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG NZ_CP029543_1_WP_041323079_1_2117_rfbB ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG NZ_AP014567_1_WP_041323079_1_2176_rfbB ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG ************************************************** NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT NC_002677_1_NP_302328_1_1200_rmlB RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT NZ_CP029543_1_WP_041323079_1_2117_rfbB RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT NZ_AP014567_1_WP_041323079_1_2176_rfbB RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT ************************************************** NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD NC_002677_1_NP_302328_1_1200_rmlB VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD NZ_CP029543_1_WP_041323079_1_2117_rfbB VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD NZ_AP014567_1_WP_041323079_1_2176_rfbB VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD ************************************************** NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo NC_002677_1_NP_302328_1_1200_rmlB EGLRATIDWYRNNESWWRPLKDAVEARYEERGR-- NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo NZ_CP029543_1_WP_041323079_1_2117_rfbB EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo NZ_AP014567_1_WP_041323079_1_2176_rfbB EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo *********************************
>NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >NC_002677_1_NP_302328_1_1200_rmlB TTGACCATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >NZ_CP029543_1_WP_041323079_1_2117_rfbB ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- ----- >NZ_AP014567_1_WP_041323079_1_2176_rfbB ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG- -----
>NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >NC_002677_1_NP_302328_1_1200_rmlB LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >NZ_CP029543_1_WP_041323079_1_2117_rfbB --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR >NZ_AP014567_1_WP_041323079_1_2176_rfbB --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
#NEXUS [ID: 0826122305] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 NC_002677_1_NP_302328_1_1200_rmlB NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 NZ_CP029543_1_WP_041323079_1_2117_rfbB NZ_AP014567_1_WP_041323079_1_2176_rfbB ; end; begin trees; translate 1 NC_011896_1_WP_041323079_1_2095_MLBR_RS09950, 2 NC_002677_1_NP_302328_1_1200_rmlB, 3 NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450, 4 NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760, 5 NZ_CP029543_1_WP_041323079_1_2117_rfbB, 6 NZ_AP014567_1_WP_041323079_1_2176_rfbB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07011418,2:0.06849167,3:0.06964979,4:0.06880469,5:0.06854681,6:0.06603596); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07011418,2:0.06849167,3:0.06964979,4:0.06880469,5:0.06854681,6:0.06603596); end;
Estimated marginal likelihoods for runs sampled in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1363.54 -1366.43 2 -1363.54 -1366.66 -------------------------------------- TOTAL -1363.54 -1366.55 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897703 0.090334 0.346355 1.480789 0.861307 1466.17 1483.58 1.000 r(A<->C){all} 0.164386 0.019525 0.000169 0.447856 0.128052 88.37 165.12 1.000 r(A<->G){all} 0.171182 0.020389 0.000105 0.451545 0.134775 453.30 473.82 1.000 r(A<->T){all} 0.161557 0.019262 0.000037 0.445107 0.126177 190.89 212.45 1.021 r(C<->G){all} 0.163240 0.021572 0.000100 0.463016 0.117682 117.60 165.59 1.002 r(C<->T){all} 0.175586 0.021828 0.000162 0.476840 0.137348 221.95 244.04 1.012 r(G<->T){all} 0.164048 0.019741 0.000057 0.452387 0.125172 236.66 245.33 1.000 pi(A){all} 0.235676 0.000177 0.210036 0.261400 0.235627 1407.65 1454.32 1.001 pi(C){all} 0.316860 0.000219 0.287623 0.344544 0.316534 1131.41 1214.70 1.000 pi(G){all} 0.273956 0.000201 0.246402 0.300802 0.273766 1281.54 1290.58 1.000 pi(T){all} 0.173508 0.000143 0.150317 0.196709 0.173103 1248.42 1287.01 1.000 alpha{1,2} 0.432779 0.237202 0.000118 1.423052 0.255054 1003.82 1207.02 1.000 alpha{3} 0.461632 0.243672 0.000147 1.481021 0.295598 1054.36 1098.21 1.000 pinvar{all} 0.998461 0.000003 0.994966 0.999999 0.999024 1078.15 1202.02 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rmlB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 331 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0 TTC 7 7 7 7 7 7 | TCC 4 4 4 4 4 4 | TAC 11 11 11 11 11 11 | TGC 2 2 2 2 2 2 Leu TTA 4 4 4 4 4 4 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 5 5 5 5 5 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 7 7 7 7 7 7 | Arg CGT 1 1 1 1 1 1 CTC 5 5 5 5 5 5 | CCC 4 4 4 4 4 4 | CAC 10 10 10 10 10 10 | CGC 11 11 11 11 11 11 CTA 4 4 4 4 4 4 | CCA 5 5 5 5 5 5 | Gln CAA 3 3 3 3 3 3 | CGA 4 4 4 4 4 4 CTG 9 9 9 9 9 9 | CCG 6 6 6 6 6 6 | CAG 3 3 3 3 3 3 | CGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2 ATC 10 10 10 10 10 10 | ACC 14 14 14 14 14 14 | AAC 17 17 17 17 17 17 | AGC 1 1 1 1 1 1 ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 2 2 2 2 2 2 Met ATG 5 5 5 5 5 5 | ACG 5 5 5 5 5 5 | AAG 5 5 5 5 5 5 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1 GTC 14 14 14 14 14 14 | GCC 13 13 13 13 13 13 | GAC 24 24 24 24 24 24 | GGC 14 14 14 14 14 14 GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 11 11 11 11 11 11 | GGA 5 5 5 5 5 5 GTG 15 15 15 15 15 15 | GCG 6 6 6 6 6 6 | GAG 7 7 7 7 7 7 | GGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_041323079_1_2095_MLBR_RS09950 position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 #2: NC_002677_1_NP_302328_1_1200_rmlB position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 #3: NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450 position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 #4: NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760 position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 #5: NZ_CP029543_1_WP_041323079_1_2117_rfbB position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 #6: NZ_AP014567_1_WP_041323079_1_2176_rfbB position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0 TTC 42 | TCC 24 | TAC 66 | TGC 12 Leu L TTA 24 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 30 | TCG 30 | TAG 0 | Trp W TGG 42 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 0 | His H CAT 42 | Arg R CGT 6 CTC 30 | CCC 24 | CAC 60 | CGC 66 CTA 24 | CCA 30 | Gln Q CAA 18 | CGA 24 CTG 54 | CCG 36 | CAG 18 | CGG 42 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 12 ATC 60 | ACC 84 | AAC 102 | AGC 6 ATA 6 | ACA 18 | Lys K AAA 12 | Arg R AGA 12 Met M ATG 30 | ACG 30 | AAG 30 | AGG 12 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 18 | Asp D GAT 18 | Gly G GGT 6 GTC 84 | GCC 78 | GAC 144 | GGC 84 GTA 0 | GCA 18 | Glu E GAA 66 | GGA 30 GTG 90 | GCG 36 | GAG 42 | GGG 12 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.15408 C:0.23867 A:0.23565 G:0.37160 position 2: T:0.26284 C:0.22659 A:0.32628 G:0.18429 position 3: T:0.09970 C:0.48640 A:0.14502 G:0.26888 Average T:0.17221 C:0.31722 A:0.23565 G:0.27492 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1288.148743 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299876 1.300008 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_041323079_1_2095_MLBR_RS09950: 0.000004, NC_002677_1_NP_302328_1_1200_rmlB: 0.000004, NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450: 0.000004, NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760: 0.000004, NZ_CP029543_1_WP_041323079_1_2117_rfbB: 0.000004, NZ_AP014567_1_WP_041323079_1_2176_rfbB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29988 omega (dN/dS) = 1.30001 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 837.4 155.6 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 837.4 155.6 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 837.4 155.6 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 837.4 155.6 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 837.4 155.6 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 837.4 155.6 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1288.148682 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_041323079_1_2095_MLBR_RS09950: 0.000004, NC_002677_1_NP_302328_1_1200_rmlB: 0.000004, NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450: 0.000004, NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760: 0.000004, NZ_CP029543_1_WP_041323079_1_2117_rfbB: 0.000004, NZ_AP014567_1_WP_041323079_1_2176_rfbB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1288.148725 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.654186 0.174572 0.000001 1.362175 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_041323079_1_2095_MLBR_RS09950: 0.000004, NC_002677_1_NP_302328_1_1200_rmlB: 0.000004, NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450: 0.000004, NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760: 0.000004, NZ_CP029543_1_WP_041323079_1_2117_rfbB: 0.000004, NZ_AP014567_1_WP_041323079_1_2176_rfbB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.65419 0.17457 0.17124 w: 0.00000 1.00000 1.36217 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 846.7 146.3 0.4078 0.0000 0.0000 0.0 0.0 7..2 0.000 846.7 146.3 0.4078 0.0000 0.0000 0.0 0.0 7..3 0.000 846.7 146.3 0.4078 0.0000 0.0000 0.0 0.0 7..4 0.000 846.7 146.3 0.4078 0.0000 0.0000 0.0 0.0 7..5 0.000 846.7 146.3 0.4078 0.0000 0.0000 0.0 0.0 7..6 0.000 846.7 146.3 0.4078 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323079_1_2095_MLBR_RS09950) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323079_1_2095_MLBR_RS09950) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1288.148682 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.114779 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_041323079_1_2095_MLBR_RS09950: 0.000004, NC_002677_1_NP_302328_1_1200_rmlB: 0.000004, NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450: 0.000004, NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760: 0.000004, NZ_CP029543_1_WP_041323079_1_2117_rfbB: 0.000004, NZ_AP014567_1_WP_041323079_1_2176_rfbB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.11478 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1288.148682 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.935245 2.955078 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_041323079_1_2095_MLBR_RS09950: 0.000004, NC_002677_1_NP_302328_1_1200_rmlB: 0.000004, NZ_LVXE01000050_1_WP_041323079_1_2118_A3216_RS11450: 0.000004, NZ_LYPH01000079_1_WP_041323079_1_2651_A8144_RS12760: 0.000004, NZ_CP029543_1_WP_041323079_1_2117_rfbB: 0.000004, NZ_AP014567_1_WP_041323079_1_2176_rfbB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.93524 (p1 = 0.00001) w = 2.95508 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.95508 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 846.7 146.3 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_041323079_1_2095_MLBR_RS09950) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.090 0.092 0.094 0.096 0.098 0.101 0.103 0.106 0.109 0.111 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.110 0.108 0.105 0.103 0.101 0.099 0.097 0.094 0.093 0.091 Time used: 0:11
Model 1: NearlyNeutral -1288.148682 Model 2: PositiveSelection -1288.148725 Model 0: one-ratio -1288.148743 Model 7: beta -1288.148682 Model 8: beta&w>1 -1288.148682 Model 0 vs 1 1.2199999991935329E-4 Model 2 vs 1 8.600000001024455E-5 Model 8 vs 7 0.0