--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:25:14 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rmlB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1363.54         -1366.43
2      -1363.54         -1366.66
--------------------------------------
TOTAL    -1363.54         -1366.55
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897703    0.090334    0.346355    1.480789    0.861307   1466.17   1483.58    1.000
r(A<->C){all}   0.164386    0.019525    0.000169    0.447856    0.128052     88.37    165.12    1.000
r(A<->G){all}   0.171182    0.020389    0.000105    0.451545    0.134775    453.30    473.82    1.000
r(A<->T){all}   0.161557    0.019262    0.000037    0.445107    0.126177    190.89    212.45    1.021
r(C<->G){all}   0.163240    0.021572    0.000100    0.463016    0.117682    117.60    165.59    1.002
r(C<->T){all}   0.175586    0.021828    0.000162    0.476840    0.137348    221.95    244.04    1.012
r(G<->T){all}   0.164048    0.019741    0.000057    0.452387    0.125172    236.66    245.33    1.000
pi(A){all}      0.235676    0.000177    0.210036    0.261400    0.235627   1407.65   1454.32    1.001
pi(C){all}      0.316860    0.000219    0.287623    0.344544    0.316534   1131.41   1214.70    1.000
pi(G){all}      0.273956    0.000201    0.246402    0.300802    0.273766   1281.54   1290.58    1.000
pi(T){all}      0.173508    0.000143    0.150317    0.196709    0.173103   1248.42   1287.01    1.000
alpha{1,2}      0.432779    0.237202    0.000118    1.423052    0.255054   1003.82   1207.02    1.000
alpha{3}        0.461632    0.243672    0.000147    1.481021    0.295598   1054.36   1098.21    1.000
pinvar{all}     0.998461    0.000003    0.994966    0.999999    0.999024   1078.15   1202.02    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1288.148682
Model 2: PositiveSelection	-1288.148725
Model 0: one-ratio	-1288.148743
Model 7: beta	-1288.148682
Model 8: beta&w>1	-1288.148682


Model 0 vs 1	1.2199999991935329E-4

Model 2 vs 1	8.600000001024455E-5

Model 8 vs 7	0.0
>C1
MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
LRATIDWYRNNESWWRPLKDAVEARYEERGRoo
>C2
LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
>C3
MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
LRATIDWYRNNESWWRPLKDAVEARYEERGRoo
>C4
MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
LRATIDWYRNNESWWRPLKDAVEARYEERGRoo
>C5
MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
LRATIDWYRNNESWWRPLKDAVEARYEERGRoo
>C6
MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
LRATIDWYRNNESWWRPLKDAVEARYEERGRoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=335 

C1              --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
C2              LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
C3              --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
C4              --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
C5              --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
C6              --MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
                  ************************************************

C1              HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
C2              HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
C3              HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
C4              HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
C5              HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
C6              HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
                **************************************************

C1              IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
C2              IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
C3              IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
C4              IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
C5              IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
C6              IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
                **************************************************

C1              ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
C2              ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
C3              ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
C4              ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
C5              ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
C6              ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
                **************************************************

C1              RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
C2              RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
C3              RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
C4              RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
C5              RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
C6              RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
                **************************************************

C1              VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
C2              VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
C3              VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
C4              VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
C5              VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
C6              VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
                **************************************************

C1              EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo
C2              EGLRATIDWYRNNESWWRPLKDAVEARYEERGR--
C3              EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo
C4              EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo
C5              EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo
C6              EGLRATIDWYRNNESWWRPLKDAVEARYEERGRoo
                *********************************  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  333 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  333 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10020]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10020]--->[10020]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.506 Mb, Max= 30.892 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
C2              MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
C3              MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
C4              MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
C5              MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
C6              MRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVDHA
                **************************************************

C1              VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
C2              VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
C3              VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
C4              VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
C5              VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
C6              VRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNVIG
                **************************************************

C1              TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
C2              TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
C3              TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
C4              TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
C5              TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
C6              TFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYSAT
                **************************************************

C1              KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
C2              KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
C3              KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
C4              KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
C5              KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
C6              KAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
                **************************************************

C1              PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
C2              PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
C3              PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
C4              PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
C5              PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
C6              PKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLTVL
                **************************************************

C1              RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
C2              RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
C3              RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
C4              RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
C5              RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
C6              RTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFDEG
                **************************************************

C1              LRATIDWYRNNESWWRPLKDAVEARYEERGR
C2              LRATIDWYRNNESWWRPLKDAVEARYEERGR
C3              LRATIDWYRNNESWWRPLKDAVEARYEERGR
C4              LRATIDWYRNNESWWRPLKDAVEARYEERGR
C5              LRATIDWYRNNESWWRPLKDAVEARYEERGR
C6              LRATIDWYRNNESWWRPLKDAVEARYEERGR
                *******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
C2              TTGACCATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
C3              ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
C4              ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
C5              ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
C6              ------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
                      ********************************************

C1              TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
C2              TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
C3              TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
C4              TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
C5              TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
C6              TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
                **************************************************

C1              TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
C2              TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
C3              TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
C4              TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
C5              TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
C6              TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
                **************************************************

C1              CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
C2              CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
C3              CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
C4              CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
C5              CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
C6              CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
                **************************************************

C1              CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
C2              CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
C3              CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
C4              CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
C5              CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
C6              CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
                **************************************************

C1              ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
C2              ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
C3              ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
C4              ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
C5              ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
C6              ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
                **************************************************

C1              ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
C2              ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
C3              ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
C4              ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
C5              ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
C6              ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
                **************************************************

C1              GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
C2              GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
C3              GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
C4              GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
C5              GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
C6              GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
                **************************************************

C1              CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
C2              CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
C3              CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
C4              CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
C5              CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
C6              CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
                **************************************************

C1              GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
C2              GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
C3              GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
C4              GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
C5              GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
C6              GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
                **************************************************

C1              CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
C2              CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
C3              CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
C4              CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
C5              CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
C6              CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
                **************************************************

C1              AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
C2              AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
C3              AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
C4              AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
C5              AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
C6              AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
                **************************************************

C1              CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
C2              CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
C3              CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
C4              CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
C5              CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
C6              CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
                **************************************************

C1              CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
C2              CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
C3              CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
C4              CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
C5              CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
C6              CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
                **************************************************

C1              TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
C2              TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
C3              TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
C4              TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
C5              TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
C6              TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
                **************************************************

C1              GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
C2              GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
C3              GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
C4              GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
C5              GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
C6              GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
                **************************************************

C1              CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
C2              CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
C3              CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
C4              CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
C5              CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
C6              CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
                **************************************************

C1              CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
C2              CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
C3              CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
C4              CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
C5              CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
C6              CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
                **************************************************

C1              GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
C2              GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
C3              GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
C4              GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
C5              GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
C6              GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
                **************************************************

C1              GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
C2              GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
C3              GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
C4              GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
C5              GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
C6              GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
                ************************************************* 

C1              -----
C2              -----
C3              -----
C4              -----
C5              -----
C6              -----
                     



>C1
------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
-----
>C2
TTGACCATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
-----
>C3
------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
-----
>C4
------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
-----
>C5
------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
-----
>C6
------ATGCGGTTATTGGTCACCGGCGGAGCGGGCTTTATCGGAGCCAA
TTTTGTGCATAACGCGGTGCGCGACCATCCCGACGATACGGTGACGGTGC
TAGACGCCATGACTTACGCAGGCAGACACGAGTCGCTGGCCGATGTCGAC
CATGCTGTCAGGCTGGTGCAAGGCAATATCACCGACACCAAGCTGGTTTT
CCGACTGGTCGCCGAGTCCGACGTGGTTGTGCATTTCGCCGCCGAAACCC
ATGTGGACAACGCGCTCGACGACCCAGAACCGTTCCTACGCACCAACGTC
ATCGGGACGTTCACCATCCTGGAGGCAGTGCGACACCACAGTGTGCGGCT
GCACCACATCTCGACCGACGAAGTCTATGGCGACCTAGAGCTCGACGAAC
CAACAAGGTTTACTGAGTCAACGCCCTACAACCCGTCGAGTCCGTACTCG
GCAACCAAAGCCGCCGGCGACATGTTGGTCCGGGCTTGGGTGCGCTCCTA
CGGCGTGCGTGCGACGATTTCCAACTGCTCCAACAACTACGGACCATACC
AGCACGTCGAAAAGTTCATTCCGCGCCAAATCACCAATGTGCTCACCGGC
CGCCGGCCCAAGTTATACGGCACCGGCGTCAACGTCCGCGACTGGATCCA
CGTCGACGACCACAACAGCGCCGTCTGGCAAATCCTCGAGAAAGGCCAGA
TAGGCCGCACTTACCTCATCGGAGCCGAAAACGGGCATAACAACCTGACC
GTGTTGCGCACACTGCTACAGATGATGGGCCGAGACCCCAACGATTTCGA
CCATGTCACCGACCGCGTCGGCCACGACTTACGGTACGCGATCGACCCAA
CACCGCTGTACAACGAATTATGCTGGGCTCCAAAGCACGCCAACTTCGAC
GAGGGATTGCGCGCCACCATTGACTGGTATCGGAACAACGAATCGTGGTG
GAGACCGTTGAAGGACGCCGTGGAAGCGCGCTACGAAGAACGAGGTCGG-
-----
>C1
ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
>C2
LTMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
>C3
ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
>C4
ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
>C5
ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR
>C6
ooMRLLVTGGAGFIGANFVHNAVRDHPDDTVTVLDAMTYAGRHESLADVD
HAVRLVQGNITDTKLVFRLVAESDVVVHFAAETHVDNALDDPEPFLRTNV
IGTFTILEAVRHHSVRLHHISTDEVYGDLELDEPTRFTESTPYNPSSPYS
ATKAAGDMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTG
RRPKLYGTGVNVRDWIHVDDHNSAVWQILEKGQIGRTYLIGAENGHNNLT
VLRTLLQMMGRDPNDFDHVTDRVGHDLRYAIDPTPLYNELCWAPKHANFD
EGLRATIDWYRNNESWWRPLKDAVEARYEERGR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1005 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789426
      Setting output file names to "/data/11res/rmlB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2009010337
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0826122305
      Seed = 543160335
      Swapseed = 1579789426
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 7 unique site patterns
      Division 2 has 7 unique site patterns
      Division 3 has 7 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2230.699382 -- -24.965149
         Chain 2 -- -2230.699382 -- -24.965149
         Chain 3 -- -2230.699382 -- -24.965149
         Chain 4 -- -2230.699382 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2230.699382 -- -24.965149
         Chain 2 -- -2230.699384 -- -24.965149
         Chain 3 -- -2230.699043 -- -24.965149
         Chain 4 -- -2230.699384 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2230.699] (-2230.699) (-2230.699) (-2230.699) * [-2230.699] (-2230.699) (-2230.699) (-2230.699) 
        500 -- (-1384.490) [-1366.848] (-1372.110) (-1389.401) * [-1372.428] (-1375.730) (-1389.295) (-1382.474) -- 0:00:00
       1000 -- (-1373.328) [-1372.838] (-1377.947) (-1378.945) * (-1368.708) (-1376.232) [-1370.585] (-1385.240) -- 0:00:00
       1500 -- (-1372.835) (-1374.990) [-1367.116] (-1379.236) * (-1376.074) (-1384.761) [-1370.977] (-1379.843) -- 0:00:00
       2000 -- (-1370.994) (-1378.811) [-1366.519] (-1373.753) * (-1370.872) [-1373.614] (-1368.114) (-1370.719) -- 0:00:00
       2500 -- (-1376.463) (-1382.956) (-1370.703) [-1371.062] * (-1369.907) [-1375.790] (-1381.009) (-1371.871) -- 0:00:00
       3000 -- (-1373.491) (-1370.287) [-1375.869] (-1367.419) * (-1369.242) [-1370.136] (-1378.424) (-1372.513) -- 0:00:00
       3500 -- (-1378.367) (-1375.158) (-1374.016) [-1372.348] * [-1368.333] (-1375.544) (-1380.882) (-1370.776) -- 0:00:00
       4000 -- (-1374.047) (-1383.065) [-1373.823] (-1373.222) * [-1372.582] (-1371.748) (-1375.081) (-1371.099) -- 0:00:00
       4500 -- (-1366.975) [-1371.339] (-1378.362) (-1372.546) * (-1370.219) [-1371.338] (-1374.266) (-1376.743) -- 0:00:00
       5000 -- (-1380.960) (-1377.035) [-1377.878] (-1374.513) * [-1374.897] (-1372.069) (-1372.051) (-1372.514) -- 0:00:00

      Average standard deviation of split frequencies: 0.121422

       5500 -- [-1376.162] (-1368.509) (-1374.560) (-1368.355) * [-1372.638] (-1371.070) (-1372.281) (-1369.263) -- 0:00:00
       6000 -- (-1370.165) (-1370.683) [-1369.795] (-1384.179) * (-1374.331) [-1372.947] (-1377.391) (-1370.958) -- 0:00:00
       6500 -- (-1381.978) [-1373.495] (-1372.632) (-1373.434) * (-1380.745) [-1372.574] (-1373.220) (-1372.391) -- 0:00:00
       7000 -- [-1371.546] (-1374.308) (-1379.459) (-1376.577) * (-1373.990) [-1379.821] (-1377.617) (-1374.486) -- 0:00:00
       7500 -- (-1375.153) [-1377.613] (-1376.765) (-1373.013) * (-1381.750) [-1372.537] (-1369.181) (-1378.433) -- 0:00:00
       8000 -- [-1370.614] (-1371.562) (-1376.275) (-1371.387) * (-1373.465) [-1368.663] (-1378.617) (-1374.710) -- 0:00:00
       8500 -- [-1367.889] (-1370.160) (-1372.581) (-1377.414) * (-1369.721) (-1369.911) [-1375.413] (-1371.960) -- 0:00:00
       9000 -- [-1368.908] (-1372.034) (-1372.741) (-1370.743) * (-1363.523) (-1375.428) [-1376.443] (-1373.261) -- 0:00:00
       9500 -- (-1371.105) (-1371.185) [-1370.785] (-1371.011) * (-1363.960) (-1377.986) [-1367.071] (-1371.073) -- 0:00:00
      10000 -- (-1368.693) (-1377.121) [-1369.452] (-1373.658) * [-1364.859] (-1376.433) (-1375.041) (-1371.323) -- 0:00:00

      Average standard deviation of split frequencies: 0.103856

      10500 -- (-1371.261) (-1369.270) (-1373.829) [-1373.395] * (-1364.157) [-1370.553] (-1364.851) (-1373.614) -- 0:01:34
      11000 -- (-1375.319) (-1370.681) (-1376.488) [-1375.737] * (-1364.300) (-1369.080) [-1364.076] (-1375.074) -- 0:01:29
      11500 -- (-1367.780) (-1376.338) (-1378.287) [-1368.904] * (-1365.773) (-1371.931) [-1362.669] (-1371.048) -- 0:01:25
      12000 -- [-1371.133] (-1376.192) (-1371.747) (-1374.318) * (-1362.763) (-1380.791) [-1362.532] (-1380.708) -- 0:01:22
      12500 -- [-1369.880] (-1375.945) (-1374.093) (-1369.326) * [-1362.761] (-1373.639) (-1365.721) (-1373.677) -- 0:01:19
      13000 -- (-1373.484) [-1373.403] (-1373.259) (-1365.189) * (-1362.674) (-1381.620) (-1367.192) [-1372.550] -- 0:01:15
      13500 -- (-1373.553) (-1367.978) [-1372.152] (-1364.416) * (-1363.750) (-1378.963) (-1363.363) [-1372.473] -- 0:01:13
      14000 -- (-1379.540) [-1372.118] (-1366.534) (-1365.121) * [-1364.920] (-1370.295) (-1363.355) (-1374.491) -- 0:01:10
      14500 -- [-1370.626] (-1379.558) (-1376.107) (-1363.529) * (-1366.496) (-1381.190) (-1365.372) [-1371.957] -- 0:01:07
      15000 -- [-1367.437] (-1367.226) (-1380.480) (-1364.985) * (-1365.500) (-1371.738) [-1362.745] (-1373.868) -- 0:01:05

      Average standard deviation of split frequencies: 0.071331

      15500 -- (-1374.892) [-1368.484] (-1377.356) (-1362.751) * (-1364.241) [-1372.874] (-1365.711) (-1377.192) -- 0:01:03
      16000 -- (-1371.110) (-1371.036) [-1375.586] (-1363.671) * [-1363.032] (-1375.294) (-1362.557) (-1374.594) -- 0:01:01
      16500 -- (-1376.090) [-1368.957] (-1378.390) (-1363.179) * (-1363.751) (-1376.544) [-1362.236] (-1378.078) -- 0:00:59
      17000 -- [-1375.016] (-1374.295) (-1375.567) (-1362.638) * (-1364.597) (-1372.188) (-1362.291) [-1376.529] -- 0:00:57
      17500 -- [-1372.647] (-1371.110) (-1370.977) (-1363.622) * [-1363.597] (-1378.816) (-1363.786) (-1375.044) -- 0:00:56
      18000 -- (-1368.897) [-1370.871] (-1369.319) (-1363.634) * (-1365.456) (-1373.932) [-1365.991] (-1372.748) -- 0:00:54
      18500 -- (-1370.880) [-1370.123] (-1378.534) (-1363.853) * (-1364.777) [-1369.222] (-1365.359) (-1374.604) -- 0:00:53
      19000 -- (-1374.830) (-1378.498) [-1375.752] (-1362.795) * [-1363.067] (-1368.920) (-1364.237) (-1376.240) -- 0:00:51
      19500 -- (-1369.851) (-1382.723) (-1382.653) [-1364.045] * (-1364.145) [-1371.511] (-1363.074) (-1381.249) -- 0:00:50
      20000 -- [-1375.288] (-1386.949) (-1369.398) (-1365.527) * (-1363.341) (-1366.809) (-1363.218) [-1370.562] -- 0:00:49

      Average standard deviation of split frequencies: 0.048154

      20500 -- (-1366.737) (-1365.196) (-1374.354) [-1367.414] * (-1364.672) (-1371.666) (-1368.163) [-1370.684] -- 0:00:47
      21000 -- (-1371.964) (-1362.270) [-1370.524] (-1365.682) * (-1369.156) (-1374.018) [-1363.074] (-1372.839) -- 0:00:46
      21500 -- (-1369.750) [-1363.425] (-1382.388) (-1365.735) * (-1371.759) (-1374.491) (-1363.981) [-1371.915] -- 0:00:45
      22000 -- (-1382.576) (-1362.871) [-1363.581] (-1364.850) * (-1364.602) [-1368.062] (-1364.849) (-1377.034) -- 0:00:44
      22500 -- (-1377.780) (-1366.944) [-1363.601] (-1371.498) * (-1366.829) (-1369.080) [-1364.637] (-1371.249) -- 0:00:43
      23000 -- (-1384.681) (-1368.599) (-1362.951) [-1366.181] * [-1365.017] (-1375.393) (-1364.398) (-1373.523) -- 0:00:42
      23500 -- (-1372.279) (-1363.396) [-1365.783] (-1365.582) * (-1364.866) (-1379.395) (-1365.922) [-1379.761] -- 0:01:23
      24000 -- (-1374.490) (-1364.152) [-1368.643] (-1364.363) * (-1366.288) (-1373.744) (-1364.631) [-1374.146] -- 0:01:21
      24500 -- (-1374.982) [-1366.244] (-1365.051) (-1364.705) * [-1365.121] (-1367.726) (-1365.014) (-1376.697) -- 0:01:19
      25000 -- (-1372.902) (-1366.183) [-1364.171] (-1363.655) * (-1369.471) [-1369.245] (-1367.288) (-1372.748) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-1380.159) [-1362.917] (-1366.935) (-1364.983) * (-1366.677) [-1371.387] (-1365.671) (-1378.746) -- 0:01:16
      26000 -- (-1369.539) (-1365.843) (-1367.029) [-1363.551] * [-1363.507] (-1371.956) (-1363.550) (-1377.192) -- 0:01:14
      26500 -- (-1379.519) (-1362.864) [-1363.709] (-1362.293) * (-1363.403) (-1375.411) (-1363.662) [-1368.955] -- 0:01:13
      27000 -- (-1374.553) [-1366.101] (-1365.217) (-1362.971) * (-1363.665) (-1374.809) (-1366.617) [-1374.729] -- 0:01:12
      27500 -- [-1376.507] (-1367.313) (-1363.875) (-1364.590) * (-1363.054) (-1376.571) [-1364.427] (-1373.125) -- 0:01:10
      28000 -- (-1369.815) [-1365.634] (-1363.882) (-1363.443) * [-1364.034] (-1371.772) (-1365.141) (-1373.278) -- 0:01:09
      28500 -- (-1376.863) [-1363.591] (-1366.127) (-1363.490) * (-1363.667) [-1366.459] (-1363.001) (-1375.759) -- 0:01:08
      29000 -- (-1366.970) [-1363.899] (-1366.804) (-1363.311) * (-1363.070) [-1368.253] (-1362.912) (-1377.446) -- 0:01:06
      29500 -- [-1373.719] (-1365.227) (-1363.923) (-1362.800) * [-1362.770] (-1373.728) (-1363.173) (-1380.911) -- 0:01:05
      30000 -- (-1369.715) (-1365.081) [-1366.850] (-1363.875) * [-1362.372] (-1376.978) (-1361.927) (-1374.520) -- 0:01:04

      Average standard deviation of split frequencies: 0.033050

      30500 -- (-1374.462) (-1366.909) [-1365.096] (-1364.657) * [-1362.874] (-1373.497) (-1365.336) (-1371.993) -- 0:01:03
      31000 -- [-1372.831] (-1367.904) (-1362.944) (-1365.361) * [-1362.501] (-1370.974) (-1366.430) (-1377.020) -- 0:01:02
      31500 -- (-1378.897) (-1366.608) [-1362.960] (-1363.075) * (-1365.328) [-1373.874] (-1365.971) (-1378.409) -- 0:01:01
      32000 -- (-1382.049) (-1363.386) [-1364.742] (-1367.085) * (-1364.793) (-1372.209) (-1364.317) [-1370.840] -- 0:01:00
      32500 -- (-1375.190) [-1364.308] (-1364.221) (-1368.870) * [-1363.573] (-1368.483) (-1365.338) (-1370.503) -- 0:00:59
      33000 -- [-1368.458] (-1364.667) (-1364.036) (-1368.714) * (-1364.954) [-1365.682] (-1368.772) (-1376.416) -- 0:00:58
      33500 -- (-1373.426) [-1364.601] (-1366.965) (-1362.873) * [-1368.397] (-1373.068) (-1367.847) (-1366.537) -- 0:00:57
      34000 -- [-1371.987] (-1366.201) (-1366.205) (-1362.179) * (-1371.187) (-1373.866) (-1363.373) [-1372.921] -- 0:00:56
      34500 -- (-1374.195) (-1363.466) (-1367.111) [-1363.519] * (-1368.654) [-1372.204] (-1364.056) (-1376.604) -- 0:00:55
      35000 -- (-1377.891) (-1362.793) [-1363.373] (-1362.793) * (-1365.543) (-1370.490) [-1363.859] (-1378.967) -- 0:00:55

      Average standard deviation of split frequencies: 0.036166

      35500 -- (-1375.504) (-1363.630) (-1365.298) [-1362.622] * (-1365.880) (-1377.094) (-1363.371) [-1381.043] -- 0:00:54
      36000 -- [-1367.924] (-1363.853) (-1366.934) (-1362.317) * (-1366.255) (-1379.212) [-1363.489] (-1377.966) -- 0:00:53
      36500 -- (-1372.414) (-1363.418) (-1365.428) [-1364.331] * (-1365.011) (-1372.970) [-1364.551] (-1375.905) -- 0:00:52
      37000 -- [-1371.745] (-1362.700) (-1367.509) (-1362.463) * (-1363.757) (-1374.062) [-1365.085] (-1371.313) -- 0:01:18
      37500 -- (-1381.688) [-1363.466] (-1366.694) (-1362.925) * (-1364.780) [-1371.651] (-1363.498) (-1375.264) -- 0:01:17
      38000 -- (-1368.288) (-1363.038) (-1366.529) [-1364.856] * (-1363.524) (-1378.780) (-1363.418) [-1373.514] -- 0:01:15
      38500 -- (-1375.652) [-1362.797] (-1367.527) (-1362.917) * (-1365.335) (-1368.777) (-1364.992) [-1372.518] -- 0:01:14
      39000 -- [-1377.184] (-1363.101) (-1367.300) (-1365.824) * (-1363.755) [-1374.498] (-1364.553) (-1371.866) -- 0:01:13
      39500 -- [-1375.802] (-1364.238) (-1365.451) (-1366.597) * [-1363.652] (-1372.629) (-1363.231) (-1374.294) -- 0:01:12
      40000 -- (-1375.825) (-1362.674) [-1369.230] (-1366.101) * (-1363.860) [-1367.647] (-1364.242) (-1371.719) -- 0:01:12

      Average standard deviation of split frequencies: 0.038833

      40500 -- (-1371.267) (-1362.665) (-1366.856) [-1364.628] * (-1364.748) (-1378.766) (-1363.094) [-1367.714] -- 0:01:11
      41000 -- (-1372.242) (-1363.889) (-1363.899) [-1362.972] * (-1364.020) (-1373.983) [-1363.392] (-1374.126) -- 0:01:10
      41500 -- (-1372.430) (-1364.381) [-1364.197] (-1363.384) * (-1364.591) [-1369.816] (-1362.333) (-1368.652) -- 0:01:09
      42000 -- (-1370.402) (-1364.274) (-1364.601) [-1363.154] * (-1364.145) (-1371.898) (-1364.554) [-1369.969] -- 0:01:08
      42500 -- [-1370.441] (-1362.440) (-1365.328) (-1365.417) * [-1363.336] (-1375.459) (-1362.686) (-1372.654) -- 0:01:07
      43000 -- [-1365.591] (-1367.243) (-1373.092) (-1375.368) * (-1363.632) [-1375.173] (-1362.608) (-1368.837) -- 0:01:06
      43500 -- [-1372.476] (-1364.973) (-1368.375) (-1365.860) * (-1367.252) (-1374.244) (-1363.003) [-1377.652] -- 0:01:05
      44000 -- [-1375.100] (-1366.461) (-1367.918) (-1365.904) * (-1366.221) [-1371.314] (-1362.435) (-1376.656) -- 0:01:05
      44500 -- [-1372.275] (-1364.755) (-1363.830) (-1366.996) * (-1365.156) [-1377.253] (-1363.856) (-1375.693) -- 0:01:04
      45000 -- (-1378.655) [-1366.573] (-1363.675) (-1365.835) * (-1364.524) (-1369.489) (-1362.651) [-1373.111] -- 0:01:03

      Average standard deviation of split frequencies: 0.036600

      45500 -- (-1377.962) (-1364.973) (-1362.850) [-1363.686] * (-1366.637) [-1374.448] (-1365.219) (-1378.201) -- 0:01:02
      46000 -- (-1375.747) (-1366.710) [-1361.839] (-1363.148) * (-1365.841) (-1375.540) (-1364.406) [-1372.709] -- 0:01:02
      46500 -- [-1375.424] (-1364.841) (-1365.337) (-1362.754) * [-1365.088] (-1377.638) (-1364.920) (-1373.935) -- 0:01:01
      47000 -- (-1370.469) (-1364.896) (-1364.764) [-1363.851] * (-1364.507) (-1373.242) (-1367.869) [-1371.111] -- 0:01:00
      47500 -- (-1379.353) [-1365.087] (-1363.609) (-1366.139) * (-1365.095) (-1378.061) [-1363.216] (-1373.979) -- 0:01:00
      48000 -- (-1374.905) (-1362.735) [-1366.677] (-1367.062) * (-1363.371) [-1371.079] (-1365.334) (-1372.385) -- 0:00:59
      48500 -- [-1372.327] (-1367.087) (-1362.298) (-1363.920) * (-1363.656) (-1373.672) [-1363.229] (-1373.252) -- 0:00:58
      49000 -- (-1374.412) [-1363.810] (-1362.250) (-1365.580) * (-1363.450) (-1368.261) (-1368.465) [-1373.131] -- 0:00:58
      49500 -- (-1371.728) (-1364.179) [-1362.175] (-1364.240) * (-1364.083) [-1375.414] (-1364.666) (-1376.084) -- 0:00:57
      50000 -- (-1368.803) [-1362.772] (-1363.434) (-1364.996) * [-1363.664] (-1372.571) (-1363.809) (-1366.900) -- 0:00:57

      Average standard deviation of split frequencies: 0.036286

      50500 -- (-1379.725) (-1367.142) [-1364.319] (-1364.360) * (-1364.693) [-1371.762] (-1367.552) (-1375.884) -- 0:01:15
      51000 -- (-1374.024) (-1365.984) (-1364.996) [-1363.081] * [-1365.895] (-1376.111) (-1362.256) (-1377.643) -- 0:01:14
      51500 -- [-1374.616] (-1373.521) (-1366.414) (-1365.963) * (-1364.422) [-1376.430] (-1364.599) (-1370.386) -- 0:01:13
      52000 -- (-1372.878) (-1365.920) (-1364.692) [-1363.636] * [-1362.505] (-1373.597) (-1366.912) (-1376.522) -- 0:01:12
      52500 -- (-1374.342) (-1364.236) (-1369.755) [-1363.878] * (-1365.000) [-1370.736] (-1363.526) (-1376.005) -- 0:01:12
      53000 -- (-1370.994) (-1363.775) (-1369.755) [-1363.245] * (-1362.638) (-1371.523) [-1361.979] (-1377.645) -- 0:01:11
      53500 -- [-1373.764] (-1366.283) (-1365.440) (-1362.361) * [-1363.225] (-1374.152) (-1362.976) (-1369.616) -- 0:01:10
      54000 -- (-1373.839) (-1366.159) (-1363.904) [-1363.106] * [-1363.748] (-1375.013) (-1363.161) (-1368.093) -- 0:01:10
      54500 -- (-1369.264) (-1366.927) (-1365.616) [-1363.213] * (-1364.403) (-1374.595) [-1363.108] (-1374.544) -- 0:01:09
      55000 -- (-1374.738) (-1365.016) [-1364.821] (-1363.643) * (-1363.097) (-1378.063) [-1362.323] (-1369.240) -- 0:01:08

      Average standard deviation of split frequencies: 0.029684

      55500 -- (-1392.515) [-1366.130] (-1365.119) (-1365.362) * (-1364.048) (-1382.525) [-1367.551] (-1368.153) -- 0:01:08
      56000 -- (-1365.172) (-1363.896) (-1366.289) [-1366.535] * (-1366.104) (-1376.856) (-1369.849) [-1367.177] -- 0:01:07
      56500 -- [-1364.176] (-1363.375) (-1365.469) (-1368.341) * (-1364.965) [-1372.211] (-1367.474) (-1362.650) -- 0:01:06
      57000 -- [-1364.280] (-1366.595) (-1363.801) (-1363.674) * (-1365.932) (-1374.538) [-1364.161] (-1362.884) -- 0:01:06
      57500 -- [-1364.746] (-1363.482) (-1366.858) (-1362.797) * [-1365.207] (-1371.451) (-1363.943) (-1367.034) -- 0:01:05
      58000 -- (-1364.861) (-1364.046) [-1366.289] (-1363.358) * [-1363.375] (-1373.749) (-1363.864) (-1372.013) -- 0:01:04
      58500 -- (-1365.570) (-1362.420) (-1363.684) [-1362.565] * [-1366.190] (-1377.087) (-1363.796) (-1364.190) -- 0:01:04
      59000 -- (-1364.948) (-1362.886) [-1365.164] (-1362.631) * (-1363.524) [-1376.495] (-1361.952) (-1364.646) -- 0:01:03
      59500 -- [-1368.202] (-1362.810) (-1364.433) (-1368.039) * (-1364.309) (-1373.567) (-1362.512) [-1364.124] -- 0:01:03
      60000 -- [-1363.466] (-1363.665) (-1366.448) (-1364.048) * (-1365.252) [-1371.633] (-1362.170) (-1363.669) -- 0:01:02

      Average standard deviation of split frequencies: 0.024606

      60500 -- (-1365.223) [-1364.033] (-1364.081) (-1366.199) * (-1362.934) [-1371.930] (-1371.229) (-1366.948) -- 0:01:02
      61000 -- (-1365.471) (-1368.373) [-1365.038] (-1365.501) * (-1363.605) [-1368.854] (-1368.869) (-1362.439) -- 0:01:01
      61500 -- (-1364.115) [-1367.500] (-1364.100) (-1363.631) * [-1363.429] (-1375.492) (-1369.619) (-1365.021) -- 0:01:01
      62000 -- (-1362.876) [-1366.878] (-1363.129) (-1364.084) * (-1363.612) (-1373.644) (-1368.572) [-1362.842] -- 0:01:00
      62500 -- [-1362.730] (-1364.757) (-1362.723) (-1363.380) * (-1363.562) [-1372.742] (-1368.350) (-1363.455) -- 0:01:00
      63000 -- (-1364.819) [-1363.241] (-1365.181) (-1364.908) * [-1364.927] (-1372.511) (-1367.649) (-1363.510) -- 0:00:59
      63500 -- (-1367.720) (-1364.515) [-1363.795] (-1362.954) * (-1367.810) (-1379.797) (-1365.174) [-1363.604] -- 0:01:13
      64000 -- (-1363.802) (-1362.039) [-1365.453] (-1363.683) * (-1362.791) (-1374.828) (-1363.946) [-1363.254] -- 0:01:13
      64500 -- (-1363.717) (-1362.430) [-1362.580] (-1365.160) * (-1364.084) (-1372.679) (-1363.879) [-1363.933] -- 0:01:12
      65000 -- (-1364.606) [-1363.703] (-1361.947) (-1364.525) * (-1366.545) (-1369.812) [-1365.537] (-1364.690) -- 0:01:11

      Average standard deviation of split frequencies: 0.027499

      65500 -- (-1366.894) (-1368.084) (-1362.326) [-1366.256] * [-1363.354] (-1372.756) (-1365.435) (-1365.329) -- 0:01:11
      66000 -- (-1364.125) (-1364.766) (-1363.342) [-1363.431] * (-1366.320) (-1379.468) (-1366.784) [-1365.478] -- 0:01:10
      66500 -- (-1364.064) [-1363.625] (-1363.470) (-1364.490) * [-1366.012] (-1376.670) (-1362.945) (-1363.982) -- 0:01:10
      67000 -- (-1363.668) (-1364.296) [-1363.356] (-1364.835) * (-1368.355) [-1372.808] (-1363.769) (-1365.045) -- 0:01:09
      67500 -- (-1364.638) (-1362.377) [-1363.116] (-1365.261) * (-1366.439) [-1375.450] (-1362.935) (-1362.338) -- 0:01:09
      68000 -- (-1364.852) [-1362.649] (-1364.707) (-1364.777) * (-1362.708) (-1375.599) (-1363.364) [-1365.087] -- 0:01:08
      68500 -- (-1365.357) (-1363.291) (-1363.408) [-1363.935] * (-1363.092) (-1369.081) (-1364.028) [-1364.814] -- 0:01:07
      69000 -- (-1363.894) [-1364.105] (-1363.116) (-1369.727) * (-1363.540) (-1380.375) (-1363.544) [-1363.165] -- 0:01:07
      69500 -- (-1365.939) (-1363.466) (-1365.551) [-1362.748] * (-1363.588) (-1366.904) [-1366.251] (-1365.124) -- 0:01:06
      70000 -- (-1368.417) (-1362.860) [-1365.812] (-1363.800) * (-1362.958) [-1363.756] (-1365.714) (-1363.689) -- 0:01:06

      Average standard deviation of split frequencies: 0.022607

      70500 -- (-1364.588) [-1363.909] (-1363.261) (-1364.673) * [-1364.937] (-1362.997) (-1363.178) (-1368.048) -- 0:01:05
      71000 -- (-1363.243) (-1366.668) (-1363.315) [-1362.238] * (-1366.040) [-1363.021] (-1362.576) (-1365.300) -- 0:01:05
      71500 -- [-1362.520] (-1365.266) (-1364.125) (-1365.710) * [-1364.133] (-1363.001) (-1362.072) (-1362.547) -- 0:01:04
      72000 -- (-1365.168) [-1363.385] (-1366.331) (-1362.657) * [-1366.358] (-1363.720) (-1364.644) (-1362.146) -- 0:01:04
      72500 -- (-1365.343) (-1362.484) (-1364.182) [-1362.965] * [-1367.207] (-1363.394) (-1362.566) (-1364.630) -- 0:01:03
      73000 -- [-1368.738] (-1361.995) (-1366.790) (-1363.127) * (-1366.959) [-1366.269] (-1362.492) (-1367.944) -- 0:01:03
      73500 -- (-1370.181) (-1364.180) (-1367.238) [-1363.734] * [-1364.959] (-1363.423) (-1364.588) (-1365.534) -- 0:01:03
      74000 -- (-1367.401) (-1364.180) (-1370.418) [-1364.100] * (-1365.861) [-1364.629] (-1363.698) (-1362.966) -- 0:01:02
      74500 -- (-1363.589) (-1364.240) (-1367.068) [-1365.170] * (-1364.655) (-1364.381) [-1368.866] (-1364.402) -- 0:01:02
      75000 -- [-1363.590] (-1364.651) (-1365.103) (-1365.293) * (-1363.219) (-1365.948) [-1364.290] (-1365.774) -- 0:01:01

      Average standard deviation of split frequencies: 0.021709

      75500 -- (-1363.035) (-1363.060) [-1364.762] (-1363.948) * (-1362.722) (-1363.900) [-1363.145] (-1363.345) -- 0:01:01
      76000 -- (-1362.811) [-1363.634] (-1364.249) (-1364.477) * (-1362.692) [-1364.791] (-1363.696) (-1366.127) -- 0:01:00
      76500 -- (-1365.990) (-1363.835) [-1365.706] (-1364.229) * (-1363.142) [-1363.622] (-1366.429) (-1362.228) -- 0:01:00
      77000 -- (-1364.688) (-1363.139) (-1363.838) [-1370.038] * (-1364.695) (-1363.620) (-1363.672) [-1362.413] -- 0:01:11
      77500 -- (-1364.482) [-1364.942] (-1364.437) (-1366.490) * (-1366.096) (-1363.892) (-1363.882) [-1362.414] -- 0:01:11
      78000 -- (-1364.249) (-1365.272) (-1367.450) [-1365.675] * (-1365.059) [-1363.918] (-1363.998) (-1363.407) -- 0:01:10
      78500 -- (-1363.461) (-1362.670) (-1364.150) [-1363.580] * [-1369.212] (-1364.325) (-1366.056) (-1362.073) -- 0:01:10
      79000 -- (-1364.580) [-1362.650] (-1367.687) (-1363.514) * (-1363.369) (-1363.183) [-1364.661] (-1362.036) -- 0:01:09
      79500 -- (-1363.263) (-1362.967) (-1366.132) [-1363.541] * (-1364.372) (-1366.376) [-1365.793] (-1362.036) -- 0:01:09
      80000 -- [-1363.666] (-1363.318) (-1364.784) (-1362.972) * (-1365.042) (-1366.657) [-1363.707] (-1362.422) -- 0:01:09

      Average standard deviation of split frequencies: 0.022760

      80500 -- (-1365.971) (-1362.707) (-1365.258) [-1363.088] * (-1363.768) (-1364.997) [-1366.237] (-1366.682) -- 0:01:08
      81000 -- [-1363.494] (-1363.080) (-1363.182) (-1362.546) * (-1363.231) (-1365.620) (-1364.263) [-1365.873] -- 0:01:08
      81500 -- [-1364.978] (-1364.288) (-1363.034) (-1366.657) * [-1363.292] (-1365.746) (-1364.380) (-1365.030) -- 0:01:07
      82000 -- (-1363.749) (-1367.431) (-1368.103) [-1363.861] * (-1364.591) (-1365.198) [-1364.247] (-1363.938) -- 0:01:07
      82500 -- (-1364.151) (-1365.204) [-1365.944] (-1365.676) * (-1364.060) [-1365.091] (-1363.866) (-1364.358) -- 0:01:06
      83000 -- (-1365.380) (-1364.618) [-1364.460] (-1368.748) * (-1364.964) [-1364.341] (-1368.387) (-1365.024) -- 0:01:06
      83500 -- (-1366.292) [-1364.835] (-1367.631) (-1365.250) * (-1364.141) (-1367.666) [-1364.211] (-1364.390) -- 0:01:05
      84000 -- (-1363.108) (-1364.699) [-1364.416] (-1365.316) * (-1366.217) [-1362.599] (-1366.521) (-1364.511) -- 0:01:05
      84500 -- (-1364.767) (-1367.416) [-1364.300] (-1364.514) * [-1368.232] (-1363.185) (-1363.745) (-1366.143) -- 0:01:05
      85000 -- (-1363.164) (-1365.222) [-1363.451] (-1366.432) * (-1365.095) (-1362.745) [-1367.076] (-1364.499) -- 0:01:04

      Average standard deviation of split frequencies: 0.022214

      85500 -- (-1362.965) [-1364.231] (-1364.625) (-1368.198) * (-1363.738) (-1364.061) (-1365.719) [-1365.177] -- 0:01:04
      86000 -- (-1363.849) [-1363.121] (-1363.952) (-1364.630) * [-1364.101] (-1363.027) (-1365.650) (-1362.916) -- 0:01:03
      86500 -- (-1366.137) [-1364.054] (-1363.013) (-1369.699) * [-1364.144] (-1369.988) (-1366.864) (-1363.994) -- 0:01:03
      87000 -- (-1368.841) (-1366.875) [-1368.641] (-1368.562) * (-1368.942) (-1362.360) (-1364.813) [-1363.181] -- 0:01:02
      87500 -- [-1363.384] (-1366.158) (-1366.927) (-1363.589) * [-1368.151] (-1362.439) (-1365.944) (-1362.448) -- 0:01:02
      88000 -- (-1364.838) (-1365.012) [-1367.272] (-1368.692) * (-1365.260) (-1363.558) [-1364.912] (-1369.216) -- 0:01:02
      88500 -- (-1364.511) (-1364.697) [-1365.717] (-1368.042) * (-1367.400) (-1364.515) (-1362.847) [-1366.137] -- 0:01:01
      89000 -- (-1367.334) [-1367.258] (-1368.314) (-1362.768) * (-1363.669) (-1362.923) (-1362.999) [-1364.067] -- 0:01:01
      89500 -- (-1368.035) (-1365.687) (-1367.147) [-1362.934] * (-1363.656) (-1365.805) [-1362.552] (-1365.186) -- 0:01:01
      90000 -- (-1363.575) [-1366.612] (-1365.253) (-1365.171) * (-1364.590) (-1367.903) (-1362.731) [-1362.405] -- 0:01:00

      Average standard deviation of split frequencies: 0.025130

      90500 -- (-1364.042) [-1364.121] (-1363.702) (-1363.391) * (-1362.416) (-1365.065) [-1363.410] (-1364.433) -- 0:01:10
      91000 -- [-1365.063] (-1363.007) (-1363.867) (-1369.618) * (-1362.670) (-1364.608) (-1362.557) [-1364.024] -- 0:01:09
      91500 -- [-1364.869] (-1364.503) (-1365.026) (-1364.093) * (-1365.055) (-1365.243) [-1362.288] (-1365.175) -- 0:01:09
      92000 -- (-1365.311) [-1364.538] (-1366.956) (-1371.571) * (-1365.103) (-1367.521) (-1366.476) [-1362.699] -- 0:01:09
      92500 -- (-1364.120) (-1363.504) (-1368.502) [-1362.799] * (-1364.686) [-1365.707] (-1362.293) (-1364.308) -- 0:01:08
      93000 -- (-1362.574) (-1363.325) [-1364.190] (-1363.541) * (-1362.916) (-1365.793) [-1365.001] (-1364.037) -- 0:01:08
      93500 -- (-1363.509) (-1363.801) (-1363.310) [-1362.811] * [-1363.479] (-1365.539) (-1365.340) (-1365.718) -- 0:01:07
      94000 -- (-1364.918) [-1363.517] (-1363.928) (-1362.527) * [-1363.474] (-1366.249) (-1366.829) (-1363.684) -- 0:01:07
      94500 -- (-1367.887) (-1363.883) [-1362.521] (-1362.530) * (-1364.133) (-1365.490) [-1364.977] (-1364.142) -- 0:01:07
      95000 -- (-1365.317) (-1363.419) (-1362.634) [-1366.609] * (-1363.827) [-1364.576] (-1367.695) (-1364.736) -- 0:01:06

      Average standard deviation of split frequencies: 0.028917

      95500 -- (-1363.261) (-1364.139) [-1362.796] (-1364.053) * [-1365.116] (-1364.594) (-1369.201) (-1362.357) -- 0:01:06
      96000 -- (-1364.851) (-1362.033) [-1362.178] (-1362.571) * (-1365.680) (-1368.249) [-1367.915] (-1364.707) -- 0:01:05
      96500 -- (-1365.617) [-1362.179] (-1362.202) (-1363.176) * [-1362.952] (-1365.344) (-1366.375) (-1364.141) -- 0:01:05
      97000 -- (-1365.928) (-1366.101) (-1364.897) [-1364.454] * (-1366.402) [-1363.057] (-1364.235) (-1366.952) -- 0:01:05
      97500 -- [-1362.005] (-1364.342) (-1363.240) (-1369.549) * (-1363.746) [-1365.508] (-1365.233) (-1362.967) -- 0:01:04
      98000 -- [-1362.820] (-1364.613) (-1362.786) (-1363.857) * [-1363.819] (-1363.542) (-1366.531) (-1363.185) -- 0:01:04
      98500 -- (-1362.688) (-1362.268) (-1363.087) [-1365.192] * (-1366.877) (-1369.409) (-1364.540) [-1362.761] -- 0:01:04
      99000 -- [-1363.003] (-1367.518) (-1366.369) (-1365.487) * (-1368.883) [-1364.489] (-1366.664) (-1363.696) -- 0:01:03
      99500 -- (-1362.818) [-1366.293] (-1365.033) (-1364.850) * (-1367.611) [-1363.729] (-1365.684) (-1365.036) -- 0:01:03
      100000 -- (-1363.469) (-1365.381) [-1363.495] (-1363.783) * [-1365.782] (-1363.434) (-1365.374) (-1365.498) -- 0:01:02

      Average standard deviation of split frequencies: 0.024975

      100500 -- (-1363.772) (-1363.274) [-1363.521] (-1364.200) * (-1364.862) [-1363.916] (-1365.229) (-1366.231) -- 0:01:02
      101000 -- (-1362.615) (-1364.055) [-1364.403] (-1365.123) * (-1365.692) (-1367.414) (-1363.394) [-1366.371] -- 0:01:02
      101500 -- (-1363.989) (-1363.106) [-1365.770] (-1365.854) * (-1365.586) (-1370.173) (-1363.381) [-1363.104] -- 0:01:01
      102000 -- (-1364.853) (-1364.550) [-1365.258] (-1364.855) * [-1363.796] (-1364.058) (-1364.444) (-1363.028) -- 0:01:01
      102500 -- (-1362.772) [-1363.105] (-1365.055) (-1362.368) * (-1363.341) [-1366.160] (-1364.352) (-1364.906) -- 0:01:01
      103000 -- (-1362.687) (-1362.491) [-1365.686] (-1362.843) * [-1364.204] (-1363.487) (-1364.352) (-1364.075) -- 0:01:00
      103500 -- (-1362.752) (-1362.915) [-1363.604] (-1365.013) * (-1365.569) (-1361.927) [-1363.018] (-1366.700) -- 0:01:00
      104000 -- (-1362.556) [-1363.005] (-1363.451) (-1366.400) * (-1366.237) (-1362.604) [-1364.560] (-1365.988) -- 0:01:08
      104500 -- (-1363.223) [-1362.677] (-1363.529) (-1363.811) * (-1365.946) (-1362.176) (-1364.265) [-1361.933] -- 0:01:08
      105000 -- (-1369.070) (-1362.825) [-1362.893] (-1365.649) * (-1365.200) (-1361.992) (-1363.194) [-1362.119] -- 0:01:08

      Average standard deviation of split frequencies: 0.025624

      105500 -- (-1368.993) [-1363.260] (-1363.697) (-1363.431) * (-1369.796) (-1363.678) (-1362.439) [-1362.119] -- 0:01:07
      106000 -- (-1367.690) [-1363.169] (-1364.747) (-1368.959) * (-1369.798) [-1361.991] (-1363.523) (-1362.118) -- 0:01:07
      106500 -- (-1368.138) (-1363.067) (-1364.833) [-1364.678] * (-1370.566) [-1364.967] (-1363.738) (-1362.997) -- 0:01:07
      107000 -- (-1364.579) (-1362.756) [-1363.461] (-1363.020) * (-1371.907) [-1363.690] (-1362.055) (-1363.593) -- 0:01:06
      107500 -- [-1370.672] (-1363.338) (-1363.235) (-1363.212) * (-1367.137) (-1363.589) [-1364.616] (-1363.839) -- 0:01:06
      108000 -- [-1363.551] (-1363.504) (-1363.168) (-1366.449) * (-1363.769) [-1364.434] (-1364.107) (-1365.119) -- 0:01:06
      108500 -- (-1363.410) (-1363.592) [-1363.146] (-1363.521) * (-1364.075) (-1366.304) (-1363.037) [-1362.793] -- 0:01:05
      109000 -- [-1363.511] (-1362.970) (-1362.239) (-1364.150) * (-1362.815) (-1365.292) [-1362.816] (-1362.778) -- 0:01:05
      109500 -- (-1363.391) [-1363.188] (-1364.573) (-1365.810) * (-1363.869) (-1365.078) [-1362.415] (-1362.731) -- 0:01:05
      110000 -- (-1367.672) (-1363.805) [-1362.973] (-1364.888) * (-1362.150) (-1363.281) (-1362.486) [-1362.360] -- 0:01:04

      Average standard deviation of split frequencies: 0.027215

      110500 -- [-1364.315] (-1363.843) (-1365.809) (-1365.459) * (-1364.652) (-1365.011) [-1363.651] (-1362.108) -- 0:01:04
      111000 -- (-1370.655) (-1364.220) [-1364.791] (-1365.264) * [-1362.539] (-1362.908) (-1365.793) (-1363.086) -- 0:01:04
      111500 -- [-1364.293] (-1365.778) (-1367.997) (-1364.978) * [-1362.579] (-1365.209) (-1365.190) (-1365.285) -- 0:01:03
      112000 -- (-1363.753) [-1365.969] (-1362.818) (-1367.043) * [-1363.837] (-1366.613) (-1362.343) (-1363.438) -- 0:01:03
      112500 -- [-1363.729] (-1365.466) (-1363.036) (-1365.818) * (-1364.368) (-1367.644) (-1362.193) [-1363.556] -- 0:01:03
      113000 -- (-1364.534) [-1366.854] (-1364.362) (-1368.057) * (-1363.828) (-1364.612) [-1362.442] (-1363.832) -- 0:01:02
      113500 -- [-1362.729] (-1368.365) (-1363.775) (-1364.261) * (-1362.800) [-1368.330] (-1364.880) (-1362.092) -- 0:01:02
      114000 -- (-1367.567) (-1366.733) (-1363.023) [-1365.498] * (-1363.270) (-1366.595) [-1364.880] (-1362.581) -- 0:01:02
      114500 -- [-1367.631] (-1363.929) (-1363.142) (-1363.744) * (-1364.656) (-1364.795) [-1365.710] (-1362.079) -- 0:01:01
      115000 -- (-1365.963) (-1363.739) [-1362.944] (-1372.330) * (-1363.804) (-1365.186) (-1364.794) [-1363.813] -- 0:01:01

      Average standard deviation of split frequencies: 0.024383

      115500 -- (-1364.094) (-1363.670) [-1363.492] (-1366.649) * (-1365.677) [-1364.015] (-1368.677) (-1367.560) -- 0:01:01
      116000 -- (-1363.168) (-1361.906) (-1362.665) [-1365.417] * (-1364.024) (-1364.946) (-1367.825) [-1368.177] -- 0:01:00
      116500 -- (-1362.850) (-1363.259) [-1363.006] (-1363.309) * (-1364.242) (-1362.109) [-1364.420] (-1363.014) -- 0:01:00
      117000 -- (-1364.233) (-1364.283) [-1363.985] (-1363.090) * (-1363.335) (-1362.251) [-1365.919] (-1363.042) -- 0:01:00
      117500 -- [-1363.417] (-1362.107) (-1365.657) (-1362.707) * [-1363.140] (-1365.026) (-1364.578) (-1366.047) -- 0:01:07
      118000 -- (-1362.481) (-1362.425) (-1363.865) [-1364.998] * (-1362.437) (-1363.472) [-1365.815] (-1364.678) -- 0:01:07
      118500 -- (-1366.056) (-1365.152) (-1364.226) [-1363.136] * (-1363.927) [-1362.583] (-1363.338) (-1363.878) -- 0:01:06
      119000 -- (-1363.556) [-1364.061] (-1363.868) (-1363.714) * [-1366.054] (-1363.787) (-1362.275) (-1363.405) -- 0:01:06
      119500 -- (-1365.628) [-1362.780] (-1363.325) (-1367.259) * (-1364.529) [-1368.180] (-1362.539) (-1364.829) -- 0:01:06
      120000 -- (-1364.603) [-1362.981] (-1364.562) (-1365.047) * (-1370.620) (-1363.851) [-1364.920] (-1363.197) -- 0:01:06

      Average standard deviation of split frequencies: 0.024525

      120500 -- (-1365.709) (-1364.685) (-1365.932) [-1364.774] * (-1369.264) (-1364.174) (-1361.935) [-1364.508] -- 0:01:05
      121000 -- (-1367.806) (-1363.182) [-1368.427] (-1364.482) * (-1366.458) [-1364.282] (-1364.009) (-1364.921) -- 0:01:05
      121500 -- (-1366.167) (-1367.595) (-1364.237) [-1363.532] * (-1367.246) [-1363.101] (-1362.064) (-1362.462) -- 0:01:05
      122000 -- (-1366.560) (-1366.428) (-1364.149) [-1362.010] * (-1364.006) (-1370.645) (-1361.918) [-1362.479] -- 0:01:04
      122500 -- (-1369.358) (-1366.589) [-1368.369] (-1362.088) * (-1366.748) (-1366.278) [-1362.526] (-1362.346) -- 0:01:04
      123000 -- [-1364.664] (-1366.309) (-1365.624) (-1366.603) * (-1366.092) (-1365.396) [-1363.949] (-1362.285) -- 0:01:04
      123500 -- (-1366.038) (-1366.588) (-1365.458) [-1363.464] * (-1365.157) [-1363.149] (-1364.021) (-1364.927) -- 0:01:03
      124000 -- (-1363.672) (-1363.465) (-1366.607) [-1362.739] * [-1365.609] (-1364.731) (-1362.732) (-1364.046) -- 0:01:03
      124500 -- [-1363.474] (-1364.616) (-1365.455) (-1362.999) * (-1364.879) (-1365.419) [-1362.926] (-1362.536) -- 0:01:03
      125000 -- (-1364.796) [-1366.622] (-1365.573) (-1365.067) * (-1368.191) (-1368.295) (-1362.368) [-1362.800] -- 0:01:03

      Average standard deviation of split frequencies: 0.022804

      125500 -- (-1365.238) (-1364.170) [-1364.549] (-1366.772) * (-1363.021) (-1366.604) (-1362.495) [-1367.743] -- 0:01:02
      126000 -- (-1363.366) [-1362.408] (-1365.385) (-1370.993) * [-1365.129] (-1364.469) (-1363.274) (-1363.924) -- 0:01:02
      126500 -- (-1364.399) (-1363.271) (-1363.212) [-1366.086] * [-1364.780] (-1366.418) (-1363.389) (-1364.859) -- 0:01:02
      127000 -- (-1365.155) [-1363.226] (-1363.497) (-1363.828) * (-1364.153) [-1365.760] (-1362.725) (-1364.163) -- 0:01:01
      127500 -- (-1365.293) (-1362.358) (-1364.544) [-1363.460] * [-1363.344] (-1363.013) (-1362.559) (-1363.019) -- 0:01:01
      128000 -- (-1368.021) [-1365.665] (-1363.522) (-1362.206) * [-1362.338] (-1364.096) (-1366.507) (-1362.704) -- 0:01:01
      128500 -- [-1363.434] (-1367.684) (-1364.744) (-1362.999) * [-1362.266] (-1362.929) (-1368.377) (-1362.551) -- 0:01:01
      129000 -- (-1364.851) (-1365.009) [-1365.312] (-1364.475) * (-1368.609) (-1365.679) (-1365.026) [-1363.435] -- 0:01:00
      129500 -- (-1366.556) (-1364.042) (-1366.511) [-1363.367] * [-1364.801] (-1367.527) (-1366.287) (-1366.409) -- 0:01:00
      130000 -- (-1363.490) [-1364.731] (-1368.579) (-1368.804) * (-1365.336) (-1363.003) (-1364.777) [-1366.270] -- 0:01:00

      Average standard deviation of split frequencies: 0.022026

      130500 -- (-1365.702) [-1363.003] (-1368.489) (-1371.194) * (-1366.647) (-1363.242) [-1364.221] (-1363.243) -- 0:01:06
      131000 -- [-1363.419] (-1365.993) (-1363.913) (-1363.906) * (-1366.275) (-1367.203) [-1368.256] (-1363.082) -- 0:01:06
      131500 -- (-1366.828) (-1362.814) [-1362.868] (-1363.158) * (-1366.353) (-1363.135) [-1363.736] (-1365.784) -- 0:01:06
      132000 -- (-1365.456) (-1364.375) [-1363.232] (-1365.677) * (-1369.100) (-1369.088) (-1365.214) [-1365.208] -- 0:01:05
      132500 -- (-1364.988) (-1365.015) (-1363.536) [-1364.466] * (-1365.623) (-1366.817) [-1364.964] (-1363.337) -- 0:01:05
      133000 -- (-1363.863) (-1365.127) (-1371.915) [-1364.445] * (-1366.240) (-1367.738) [-1364.492] (-1363.797) -- 0:01:05
      133500 -- [-1363.240] (-1363.974) (-1368.335) (-1363.665) * (-1366.173) (-1366.717) (-1364.496) [-1362.713] -- 0:01:04
      134000 -- (-1362.576) [-1363.584] (-1363.447) (-1366.219) * (-1362.280) (-1365.739) [-1366.377] (-1362.684) -- 0:01:04
      134500 -- (-1364.265) [-1365.411] (-1364.319) (-1366.735) * (-1363.158) (-1364.519) [-1365.741] (-1363.318) -- 0:01:04
      135000 -- (-1364.693) (-1363.556) (-1364.213) [-1363.686] * (-1369.701) [-1364.747] (-1364.672) (-1364.201) -- 0:01:04

      Average standard deviation of split frequencies: 0.021375

      135500 -- (-1367.137) (-1364.772) (-1364.455) [-1363.303] * [-1364.492] (-1367.076) (-1365.262) (-1366.543) -- 0:01:03
      136000 -- (-1370.565) (-1364.891) (-1362.808) [-1364.573] * (-1362.442) [-1365.770] (-1364.301) (-1366.440) -- 0:01:03
      136500 -- (-1364.091) (-1364.875) (-1362.499) [-1363.294] * (-1361.952) (-1363.618) [-1365.344] (-1369.005) -- 0:01:03
      137000 -- (-1363.887) [-1364.315] (-1363.890) (-1363.400) * (-1362.309) (-1363.553) [-1365.601] (-1364.277) -- 0:01:02
      137500 -- [-1362.212] (-1366.252) (-1362.396) (-1370.677) * (-1362.002) (-1366.297) [-1362.667] (-1364.177) -- 0:01:02
      138000 -- (-1367.472) [-1366.856] (-1363.876) (-1364.069) * [-1364.367] (-1365.549) (-1363.030) (-1366.124) -- 0:01:02
      138500 -- (-1364.822) [-1364.788] (-1362.631) (-1363.066) * [-1365.106] (-1364.842) (-1365.529) (-1366.089) -- 0:01:02
      139000 -- [-1368.268] (-1365.385) (-1366.343) (-1363.369) * (-1361.940) (-1363.520) (-1367.159) [-1365.647] -- 0:01:01
      139500 -- [-1367.692] (-1365.201) (-1364.280) (-1365.472) * (-1364.112) (-1364.353) [-1364.686] (-1366.664) -- 0:01:01
      140000 -- (-1363.184) [-1364.536] (-1363.672) (-1365.128) * (-1366.129) (-1362.908) [-1363.723] (-1365.108) -- 0:01:01

      Average standard deviation of split frequencies: 0.022155

      140500 -- (-1362.790) [-1362.596] (-1362.861) (-1363.082) * (-1365.798) (-1363.124) (-1364.555) [-1363.652] -- 0:01:01
      141000 -- (-1364.212) (-1362.797) [-1363.956] (-1363.085) * (-1363.414) (-1363.861) [-1363.188] (-1363.734) -- 0:01:00
      141500 -- (-1363.813) (-1362.699) (-1364.206) [-1363.027] * (-1363.206) (-1364.592) (-1364.775) [-1362.707] -- 0:01:00
      142000 -- (-1363.458) (-1362.976) (-1362.744) [-1362.951] * (-1363.602) (-1363.766) [-1369.988] (-1363.978) -- 0:01:00
      142500 -- (-1365.580) (-1362.505) [-1362.382] (-1363.907) * (-1364.941) (-1363.429) [-1364.979] (-1366.522) -- 0:01:00
      143000 -- (-1365.231) (-1362.848) [-1362.260] (-1365.291) * (-1365.819) (-1363.659) (-1363.799) [-1367.047] -- 0:00:59
      143500 -- (-1362.486) (-1362.980) [-1366.031] (-1362.940) * (-1365.320) (-1365.526) [-1363.762] (-1366.393) -- 0:00:59
      144000 -- (-1363.528) [-1362.059] (-1364.224) (-1362.939) * (-1367.362) (-1362.821) [-1365.373] (-1366.544) -- 0:01:05
      144500 -- [-1363.083] (-1364.013) (-1363.734) (-1363.450) * (-1365.602) [-1365.279] (-1362.288) (-1363.185) -- 0:01:05
      145000 -- (-1366.499) [-1365.221] (-1362.924) (-1362.894) * [-1366.179] (-1362.139) (-1364.350) (-1364.605) -- 0:01:04

      Average standard deviation of split frequencies: 0.023621

      145500 -- [-1363.548] (-1365.925) (-1364.011) (-1364.902) * (-1365.972) [-1365.283] (-1363.652) (-1363.634) -- 0:01:04
      146000 -- (-1365.837) [-1367.934] (-1363.297) (-1362.804) * (-1365.233) (-1364.655) [-1366.672] (-1363.418) -- 0:01:04
      146500 -- [-1365.033] (-1364.424) (-1363.397) (-1365.082) * [-1368.281] (-1364.908) (-1363.745) (-1363.056) -- 0:01:04
      147000 -- (-1364.937) (-1364.091) [-1364.825] (-1365.310) * (-1364.233) [-1366.022] (-1363.136) (-1362.989) -- 0:01:03
      147500 -- (-1364.939) (-1364.445) [-1365.400] (-1369.781) * [-1364.407] (-1365.813) (-1363.562) (-1362.756) -- 0:01:03
      148000 -- (-1366.577) (-1364.535) (-1364.230) [-1364.473] * (-1364.236) (-1363.427) [-1362.261] (-1365.038) -- 0:01:03
      148500 -- [-1365.271] (-1366.892) (-1363.815) (-1364.096) * (-1363.624) (-1364.381) (-1366.710) [-1362.683] -- 0:01:03
      149000 -- (-1366.035) (-1364.653) [-1362.576] (-1368.027) * [-1363.436] (-1366.304) (-1363.056) (-1363.418) -- 0:01:02
      149500 -- (-1366.020) (-1365.300) [-1361.861] (-1364.296) * (-1362.935) (-1365.701) [-1363.513] (-1363.725) -- 0:01:02
      150000 -- (-1366.741) (-1364.696) (-1362.074) [-1364.945] * (-1368.950) (-1365.515) (-1363.701) [-1363.718] -- 0:01:02

      Average standard deviation of split frequencies: 0.024042

      150500 -- (-1364.811) [-1363.179] (-1365.047) (-1363.123) * (-1368.750) (-1365.325) [-1362.230] (-1368.053) -- 0:01:02
      151000 -- [-1363.497] (-1365.889) (-1367.378) (-1362.464) * (-1364.865) [-1363.061] (-1364.356) (-1364.522) -- 0:01:01
      151500 -- (-1364.496) [-1365.791] (-1365.168) (-1363.511) * (-1363.940) (-1363.360) [-1363.836] (-1364.349) -- 0:01:01
      152000 -- (-1364.045) (-1363.276) [-1367.716] (-1372.322) * (-1366.716) (-1362.769) (-1364.091) [-1363.741] -- 0:01:01
      152500 -- [-1363.399] (-1363.436) (-1364.515) (-1365.101) * (-1369.880) [-1362.951] (-1364.129) (-1363.479) -- 0:01:01
      153000 -- (-1363.530) [-1366.546] (-1363.901) (-1365.367) * [-1363.888] (-1366.022) (-1363.302) (-1363.298) -- 0:01:00
      153500 -- (-1363.371) (-1363.250) (-1363.145) [-1365.174] * [-1366.997] (-1362.314) (-1363.323) (-1363.685) -- 0:01:00
      154000 -- (-1363.371) (-1368.087) (-1364.785) [-1365.640] * (-1363.907) [-1362.549] (-1363.714) (-1363.253) -- 0:01:00
      154500 -- (-1364.670) (-1363.570) [-1363.484] (-1362.828) * [-1365.538] (-1363.308) (-1364.407) (-1364.839) -- 0:01:00
      155000 -- (-1362.996) (-1363.405) (-1363.680) [-1366.445] * [-1364.753] (-1364.545) (-1361.810) (-1365.063) -- 0:00:59

      Average standard deviation of split frequencies: 0.025952

      155500 -- (-1363.997) (-1363.136) [-1364.783] (-1364.935) * (-1364.789) (-1364.852) (-1362.251) [-1366.328] -- 0:00:59
      156000 -- (-1364.147) (-1366.573) (-1365.161) [-1365.191] * (-1364.831) [-1364.831] (-1362.230) (-1364.767) -- 0:00:59
      156500 -- [-1365.520] (-1363.519) (-1364.732) (-1362.712) * [-1366.119] (-1366.326) (-1363.748) (-1365.152) -- 0:00:59
      157000 -- (-1365.506) (-1362.929) [-1368.460] (-1363.558) * [-1364.624] (-1362.026) (-1362.471) (-1364.367) -- 0:00:59
      157500 -- [-1363.942] (-1363.409) (-1367.171) (-1362.774) * (-1362.869) (-1362.253) [-1365.419] (-1362.734) -- 0:01:04
      158000 -- [-1363.291] (-1364.541) (-1372.769) (-1363.098) * (-1363.320) (-1362.395) (-1362.368) [-1365.249] -- 0:01:03
      158500 -- (-1362.955) [-1364.264] (-1371.539) (-1365.236) * (-1363.888) (-1362.529) (-1362.772) [-1365.313] -- 0:01:03
      159000 -- [-1362.501] (-1365.595) (-1367.019) (-1363.300) * (-1364.193) (-1363.657) (-1361.875) [-1366.242] -- 0:01:03
      159500 -- [-1364.596] (-1365.807) (-1371.935) (-1365.495) * (-1362.981) [-1363.765] (-1361.875) (-1364.918) -- 0:01:03
      160000 -- (-1364.410) (-1363.151) [-1367.406] (-1365.345) * (-1364.234) (-1366.433) [-1363.447] (-1364.902) -- 0:01:02

      Average standard deviation of split frequencies: 0.025917

      160500 -- [-1364.445] (-1363.813) (-1367.956) (-1364.305) * (-1363.637) [-1366.415] (-1364.790) (-1365.656) -- 0:01:02
      161000 -- [-1366.408] (-1368.358) (-1370.327) (-1364.259) * (-1364.339) (-1365.339) [-1363.005] (-1366.937) -- 0:01:02
      161500 -- (-1370.732) (-1366.763) [-1363.274] (-1364.761) * (-1364.720) [-1363.581] (-1363.754) (-1368.680) -- 0:01:02
      162000 -- (-1366.648) [-1364.860] (-1366.378) (-1367.868) * (-1364.290) (-1363.836) [-1366.699] (-1363.199) -- 0:01:02
      162500 -- (-1365.280) (-1364.662) [-1365.160] (-1362.694) * (-1363.769) (-1363.337) (-1363.027) [-1365.651] -- 0:01:01
      163000 -- (-1366.041) (-1364.031) (-1363.770) [-1362.348] * [-1363.937] (-1365.367) (-1365.038) (-1364.755) -- 0:01:01
      163500 -- (-1364.467) (-1363.904) (-1363.478) [-1363.358] * (-1363.535) (-1362.735) (-1365.530) [-1365.688] -- 0:01:01
      164000 -- (-1362.749) (-1366.140) [-1364.169] (-1363.792) * (-1363.713) (-1363.842) [-1363.163] (-1363.756) -- 0:01:01
      164500 -- (-1363.838) (-1364.377) [-1363.514] (-1365.157) * (-1367.662) (-1365.017) [-1363.465] (-1364.543) -- 0:01:00
      165000 -- (-1363.399) [-1363.828] (-1362.364) (-1365.590) * (-1364.697) (-1362.732) (-1363.909) [-1363.026] -- 0:01:00

      Average standard deviation of split frequencies: 0.024422

      165500 -- (-1364.508) (-1368.570) (-1364.859) [-1363.313] * [-1364.442] (-1366.602) (-1363.119) (-1363.661) -- 0:01:00
      166000 -- (-1366.250) [-1364.379] (-1370.100) (-1363.089) * (-1364.358) (-1364.329) (-1362.447) [-1363.525] -- 0:01:00
      166500 -- (-1367.751) [-1363.340] (-1372.431) (-1363.951) * [-1364.659] (-1363.964) (-1363.437) (-1363.892) -- 0:01:00
      167000 -- (-1365.055) (-1366.100) [-1367.432] (-1365.412) * (-1362.983) (-1364.745) [-1364.011] (-1362.831) -- 0:00:59
      167500 -- (-1363.954) (-1365.264) [-1364.335] (-1364.382) * (-1363.530) (-1364.826) (-1364.020) [-1366.745] -- 0:00:59
      168000 -- (-1365.666) (-1365.018) (-1363.688) [-1367.078] * [-1362.463] (-1362.786) (-1366.988) (-1368.413) -- 0:00:59
      168500 -- (-1366.517) (-1364.789) [-1363.589] (-1364.874) * (-1364.020) (-1363.152) (-1374.295) [-1362.602] -- 0:00:59
      169000 -- (-1365.740) (-1364.456) [-1364.635] (-1364.644) * [-1363.393] (-1363.110) (-1366.440) (-1364.717) -- 0:00:59
      169500 -- (-1365.789) (-1363.680) (-1370.744) [-1363.842] * (-1363.008) (-1365.126) (-1367.632) [-1362.787] -- 0:00:58
      170000 -- [-1365.136] (-1363.590) (-1363.202) (-1367.840) * (-1370.781) [-1366.463] (-1364.863) (-1363.366) -- 0:00:58

      Average standard deviation of split frequencies: 0.023412

      170500 -- [-1367.544] (-1364.480) (-1367.947) (-1364.178) * (-1368.707) (-1367.830) [-1364.697] (-1362.627) -- 0:01:03
      171000 -- [-1362.621] (-1363.544) (-1365.319) (-1364.315) * (-1362.873) [-1366.401] (-1365.845) (-1366.625) -- 0:01:03
      171500 -- (-1363.322) [-1367.079] (-1366.861) (-1371.961) * (-1367.328) (-1366.442) [-1363.476] (-1364.689) -- 0:01:02
      172000 -- [-1363.134] (-1369.374) (-1366.106) (-1363.706) * [-1364.495] (-1364.110) (-1362.786) (-1362.688) -- 0:01:02
      172500 -- [-1364.462] (-1368.693) (-1367.400) (-1363.539) * (-1364.190) [-1364.392] (-1363.569) (-1366.650) -- 0:01:02
      173000 -- (-1363.170) (-1363.542) (-1363.921) [-1363.810] * [-1363.604] (-1365.865) (-1364.426) (-1369.142) -- 0:01:02
      173500 -- (-1368.189) [-1364.745] (-1364.540) (-1363.445) * (-1362.462) [-1364.314] (-1364.152) (-1367.665) -- 0:01:01
      174000 -- [-1363.598] (-1364.263) (-1364.593) (-1363.389) * (-1363.139) [-1364.706] (-1369.621) (-1366.479) -- 0:01:01
      174500 -- [-1364.811] (-1366.685) (-1364.795) (-1364.962) * (-1366.458) [-1363.562] (-1364.138) (-1363.870) -- 0:01:01
      175000 -- (-1365.260) (-1368.311) [-1363.340] (-1363.960) * (-1366.617) (-1363.268) (-1364.668) [-1364.924] -- 0:01:01

      Average standard deviation of split frequencies: 0.022231

      175500 -- (-1365.259) (-1369.730) [-1364.524] (-1363.465) * (-1365.851) (-1362.177) [-1365.076] (-1365.598) -- 0:01:01
      176000 -- (-1363.039) (-1365.365) (-1363.246) [-1362.738] * (-1366.992) (-1362.517) [-1363.149] (-1366.159) -- 0:01:00
      176500 -- (-1363.182) (-1366.124) (-1363.612) [-1363.890] * (-1367.493) [-1362.671] (-1365.509) (-1367.754) -- 0:01:00
      177000 -- (-1367.378) (-1364.437) [-1363.236] (-1362.541) * (-1368.884) (-1363.546) [-1364.841] (-1363.224) -- 0:01:00
      177500 -- (-1363.427) [-1363.066] (-1363.231) (-1363.221) * (-1363.642) (-1365.476) (-1362.982) [-1363.803] -- 0:01:00
      178000 -- (-1364.065) (-1362.642) (-1366.913) [-1362.717] * (-1366.653) (-1366.221) [-1362.770] (-1363.355) -- 0:01:00
      178500 -- (-1363.499) (-1364.074) [-1366.873] (-1362.827) * [-1367.785] (-1366.886) (-1362.776) (-1368.142) -- 0:00:59
      179000 -- [-1364.924] (-1363.395) (-1364.543) (-1362.764) * [-1367.125] (-1365.965) (-1363.036) (-1365.539) -- 0:00:59
      179500 -- (-1365.209) (-1362.753) [-1365.309] (-1363.040) * (-1365.056) [-1363.592] (-1363.797) (-1365.232) -- 0:00:59
      180000 -- (-1363.247) [-1362.733] (-1364.466) (-1363.544) * [-1368.859] (-1364.231) (-1365.110) (-1368.479) -- 0:00:59

      Average standard deviation of split frequencies: 0.022469

      180500 -- (-1366.371) [-1362.511] (-1363.840) (-1364.646) * (-1368.095) (-1366.044) (-1365.448) [-1367.355] -- 0:00:59
      181000 -- (-1365.928) (-1363.535) [-1362.712] (-1364.954) * (-1364.897) (-1368.329) (-1366.040) [-1374.281] -- 0:00:58
      181500 -- (-1366.867) [-1362.365] (-1363.538) (-1362.710) * [-1364.362] (-1369.541) (-1366.647) (-1367.765) -- 0:00:58
      182000 -- (-1364.280) (-1362.349) [-1363.279] (-1362.779) * (-1362.544) (-1362.851) [-1362.569] (-1366.284) -- 0:00:58
      182500 -- (-1364.621) (-1367.756) (-1364.288) [-1362.807] * (-1366.441) (-1363.281) [-1365.368] (-1367.597) -- 0:00:58
      183000 -- (-1364.329) [-1364.958] (-1363.986) (-1363.051) * [-1362.843] (-1363.751) (-1365.512) (-1364.036) -- 0:00:58
      183500 -- (-1362.458) (-1366.840) [-1365.154] (-1366.424) * (-1365.560) (-1364.147) (-1369.924) [-1363.123] -- 0:00:57
      184000 -- (-1362.797) [-1367.167] (-1367.737) (-1364.615) * (-1363.645) (-1363.207) (-1367.815) [-1363.415] -- 0:01:02
      184500 -- (-1363.082) (-1363.332) [-1367.160] (-1366.541) * (-1367.269) [-1364.027] (-1364.906) (-1365.071) -- 0:01:01
      185000 -- (-1362.244) [-1362.385] (-1367.282) (-1363.838) * (-1366.508) (-1363.002) (-1367.274) [-1365.800] -- 0:01:01

      Average standard deviation of split frequencies: 0.021476

      185500 -- (-1362.751) (-1367.915) (-1367.362) [-1363.496] * (-1367.837) [-1362.918] (-1365.174) (-1369.438) -- 0:01:01
      186000 -- (-1364.120) [-1362.771] (-1366.462) (-1364.337) * (-1365.911) [-1363.318] (-1366.647) (-1365.073) -- 0:01:01
      186500 -- (-1364.120) (-1362.471) (-1365.606) [-1365.327] * (-1365.433) [-1362.610] (-1369.101) (-1366.732) -- 0:01:01
      187000 -- [-1364.542] (-1361.958) (-1365.063) (-1363.199) * (-1363.688) (-1362.730) (-1367.031) [-1362.686] -- 0:01:00
      187500 -- (-1362.718) (-1362.593) [-1369.302] (-1366.582) * (-1363.840) [-1367.406] (-1364.891) (-1362.753) -- 0:01:00
      188000 -- [-1362.672] (-1362.174) (-1362.469) (-1366.628) * (-1364.343) (-1363.166) (-1362.878) [-1361.793] -- 0:01:00
      188500 -- (-1365.335) (-1365.990) (-1363.003) [-1364.770] * (-1367.127) (-1362.824) (-1363.035) [-1363.355] -- 0:01:00
      189000 -- (-1364.492) (-1365.528) [-1362.863] (-1365.440) * [-1364.031] (-1362.868) (-1362.233) (-1362.230) -- 0:01:00
      189500 -- (-1363.858) [-1362.424] (-1362.536) (-1369.578) * (-1366.464) [-1362.839] (-1362.859) (-1362.830) -- 0:00:59
      190000 -- (-1363.629) [-1362.089] (-1362.796) (-1362.794) * (-1363.347) (-1363.486) (-1365.495) [-1363.096] -- 0:00:59

      Average standard deviation of split frequencies: 0.020820

      190500 -- (-1364.373) (-1362.006) (-1363.194) [-1362.635] * (-1368.655) [-1367.727] (-1365.654) (-1362.066) -- 0:00:59
      191000 -- (-1368.287) (-1362.279) (-1363.671) [-1364.702] * (-1365.649) (-1367.577) [-1361.980] (-1363.704) -- 0:00:59
      191500 -- (-1363.372) (-1362.279) [-1365.757] (-1364.861) * (-1367.418) [-1365.792] (-1363.322) (-1362.939) -- 0:00:59
      192000 -- (-1363.003) (-1366.555) [-1363.319] (-1367.022) * (-1366.565) (-1365.235) [-1362.204] (-1363.673) -- 0:00:58
      192500 -- [-1364.768] (-1363.943) (-1363.550) (-1367.425) * (-1367.734) (-1367.471) [-1362.053] (-1363.597) -- 0:00:58
      193000 -- (-1364.392) (-1365.872) [-1364.435] (-1365.713) * [-1366.636] (-1363.136) (-1362.084) (-1366.321) -- 0:00:58
      193500 -- [-1365.656] (-1364.300) (-1364.160) (-1365.396) * (-1363.328) (-1363.838) (-1365.352) [-1362.707] -- 0:00:58
      194000 -- (-1363.577) (-1363.841) (-1363.690) [-1371.135] * (-1364.622) (-1364.415) (-1363.080) [-1364.702] -- 0:00:58
      194500 -- [-1366.498] (-1363.205) (-1365.511) (-1366.039) * (-1364.780) [-1363.846] (-1362.516) (-1363.928) -- 0:00:57
      195000 -- (-1365.137) (-1363.277) [-1363.390] (-1367.243) * [-1363.370] (-1371.164) (-1366.434) (-1362.037) -- 0:00:57

      Average standard deviation of split frequencies: 0.020380

      195500 -- (-1364.023) (-1369.003) [-1363.126] (-1365.596) * [-1363.146] (-1368.410) (-1365.857) (-1362.366) -- 0:00:57
      196000 -- (-1364.578) (-1366.241) [-1364.920] (-1362.671) * [-1363.536] (-1367.626) (-1363.765) (-1363.010) -- 0:00:57
      196500 -- (-1364.999) (-1361.861) (-1366.068) [-1364.658] * [-1363.659] (-1362.612) (-1367.134) (-1363.711) -- 0:00:57
      197000 -- (-1364.395) (-1361.909) [-1366.365] (-1366.034) * [-1363.871] (-1363.762) (-1364.241) (-1363.110) -- 0:00:57
      197500 -- (-1363.415) [-1363.495] (-1364.946) (-1366.380) * (-1363.581) (-1362.963) (-1365.349) [-1362.487] -- 0:01:00
      198000 -- (-1363.932) (-1362.617) [-1364.160] (-1369.280) * (-1363.133) (-1363.907) (-1365.160) [-1364.046] -- 0:01:00
      198500 -- (-1363.974) [-1364.770] (-1364.403) (-1367.411) * (-1362.915) (-1363.888) (-1365.387) [-1364.382] -- 0:01:00
      199000 -- (-1364.525) (-1363.343) (-1364.337) [-1367.536] * (-1363.073) [-1363.467] (-1363.747) (-1366.123) -- 0:01:00
      199500 -- (-1363.369) [-1363.812] (-1365.161) (-1367.796) * (-1363.913) (-1367.987) (-1363.966) [-1362.159] -- 0:01:00
      200000 -- (-1363.254) (-1363.557) (-1365.156) [-1366.800] * (-1364.686) (-1362.587) (-1364.387) [-1365.098] -- 0:00:59

      Average standard deviation of split frequencies: 0.020882

      200500 -- (-1365.854) (-1364.103) [-1365.505] (-1365.669) * [-1363.585] (-1364.198) (-1367.517) (-1368.957) -- 0:00:59
      201000 -- [-1364.497] (-1364.201) (-1366.156) (-1365.370) * (-1363.799) (-1365.964) [-1364.822] (-1364.506) -- 0:00:59
      201500 -- (-1363.227) (-1362.935) (-1365.539) [-1365.149] * [-1364.801] (-1364.668) (-1365.827) (-1363.834) -- 0:00:59
      202000 -- (-1366.439) (-1365.940) (-1366.161) [-1364.613] * [-1362.653] (-1362.519) (-1366.532) (-1363.594) -- 0:00:59
      202500 -- [-1364.339] (-1363.266) (-1366.646) (-1369.039) * (-1362.529) (-1365.856) (-1365.774) [-1363.963] -- 0:00:59
      203000 -- (-1364.151) [-1363.129] (-1368.658) (-1363.542) * (-1366.357) (-1365.095) [-1362.890] (-1366.125) -- 0:00:58
      203500 -- (-1363.496) [-1372.134] (-1364.277) (-1363.016) * [-1364.718] (-1363.199) (-1362.203) (-1366.361) -- 0:00:58
      204000 -- (-1364.489) (-1369.801) (-1364.685) [-1363.186] * (-1369.049) [-1365.642] (-1362.589) (-1364.244) -- 0:00:58
      204500 -- (-1364.770) (-1362.938) (-1365.959) [-1366.984] * (-1367.387) (-1367.445) [-1363.625] (-1367.487) -- 0:00:58
      205000 -- [-1364.174] (-1366.753) (-1370.788) (-1365.951) * (-1375.108) (-1363.564) (-1366.549) [-1366.490] -- 0:00:58

      Average standard deviation of split frequencies: 0.019632

      205500 -- (-1364.516) (-1362.198) (-1370.122) [-1364.822] * (-1370.506) [-1363.829] (-1364.405) (-1364.905) -- 0:00:57
      206000 -- [-1364.764] (-1364.477) (-1372.172) (-1365.392) * (-1370.137) [-1363.542] (-1363.536) (-1364.510) -- 0:00:57
      206500 -- [-1363.028] (-1365.782) (-1371.896) (-1364.425) * [-1362.614] (-1367.065) (-1363.671) (-1365.574) -- 0:00:57
      207000 -- (-1366.209) (-1363.026) [-1363.431] (-1363.302) * [-1363.404] (-1368.944) (-1363.732) (-1363.420) -- 0:00:57
      207500 -- (-1363.212) (-1364.159) (-1366.409) [-1363.178] * (-1364.827) [-1365.523] (-1363.555) (-1363.131) -- 0:00:57
      208000 -- (-1362.218) (-1364.515) (-1362.514) [-1365.189] * [-1364.221] (-1366.799) (-1364.006) (-1364.175) -- 0:00:57
      208500 -- (-1362.072) (-1363.738) [-1362.394] (-1363.245) * (-1366.145) (-1366.054) (-1366.143) [-1365.472] -- 0:00:56
      209000 -- (-1361.901) (-1364.989) (-1362.585) [-1363.053] * (-1364.413) (-1365.284) (-1367.613) [-1366.831] -- 0:00:56
      209500 -- (-1363.734) [-1364.414] (-1363.463) (-1367.088) * (-1366.038) (-1364.904) (-1366.282) [-1363.465] -- 0:00:56
      210000 -- (-1363.857) [-1364.401] (-1364.475) (-1364.431) * (-1365.740) (-1364.011) [-1366.291] (-1367.664) -- 0:00:56

      Average standard deviation of split frequencies: 0.019803

      210500 -- (-1364.588) (-1363.398) [-1363.212] (-1364.596) * [-1363.915] (-1362.184) (-1364.854) (-1365.579) -- 0:01:00
      211000 -- [-1363.113] (-1362.938) (-1363.617) (-1363.112) * [-1362.845] (-1363.901) (-1365.742) (-1366.807) -- 0:00:59
      211500 -- (-1363.548) (-1364.708) (-1362.663) [-1362.542] * [-1363.031] (-1364.176) (-1365.359) (-1366.264) -- 0:00:59
      212000 -- (-1362.233) [-1364.305] (-1362.752) (-1364.732) * (-1364.440) (-1363.524) (-1363.907) [-1363.325] -- 0:00:59
      212500 -- (-1364.044) (-1363.188) (-1365.255) [-1366.757] * (-1365.123) (-1365.041) (-1364.178) [-1362.811] -- 0:00:59
      213000 -- (-1362.821) (-1363.145) [-1366.540] (-1369.122) * (-1365.117) (-1364.335) [-1362.995] (-1367.072) -- 0:00:59
      213500 -- (-1365.354) (-1366.453) [-1364.177] (-1364.444) * (-1363.995) [-1364.514] (-1367.336) (-1363.470) -- 0:00:58
      214000 -- (-1368.579) [-1363.431] (-1364.372) (-1364.384) * (-1362.831) (-1363.644) [-1364.621] (-1370.663) -- 0:00:58
      214500 -- (-1365.318) (-1362.466) (-1364.381) [-1363.096] * [-1364.353] (-1363.763) (-1363.864) (-1366.464) -- 0:00:58
      215000 -- [-1363.776] (-1362.225) (-1364.011) (-1363.049) * [-1369.083] (-1365.024) (-1365.521) (-1367.537) -- 0:00:58

      Average standard deviation of split frequencies: 0.020561

      215500 -- (-1363.585) (-1370.514) (-1363.215) [-1364.387] * (-1364.451) (-1367.806) (-1366.836) [-1367.288] -- 0:00:58
      216000 -- (-1369.322) (-1365.059) (-1363.753) [-1366.376] * [-1365.185] (-1367.691) (-1366.338) (-1364.887) -- 0:00:58
      216500 -- (-1365.325) (-1364.944) (-1365.732) [-1362.513] * (-1363.712) (-1361.931) [-1368.933] (-1365.117) -- 0:00:57
      217000 -- (-1364.820) (-1363.936) (-1365.338) [-1365.019] * (-1365.750) (-1364.100) (-1366.329) [-1368.635] -- 0:00:57
      217500 -- (-1367.899) [-1367.328] (-1366.856) (-1364.026) * [-1363.674] (-1364.093) (-1363.485) (-1367.984) -- 0:00:57
      218000 -- (-1362.949) (-1363.620) (-1365.487) [-1363.861] * (-1368.966) (-1365.102) [-1365.544] (-1366.082) -- 0:00:57
      218500 -- (-1363.085) (-1364.313) (-1365.717) [-1363.751] * (-1362.641) [-1362.883] (-1363.553) (-1362.287) -- 0:00:57
      219000 -- [-1366.296] (-1364.108) (-1369.822) (-1366.193) * [-1362.605] (-1362.961) (-1364.933) (-1362.260) -- 0:00:57
      219500 -- (-1362.896) [-1362.864] (-1363.741) (-1369.694) * (-1362.681) (-1364.632) (-1363.167) [-1364.780] -- 0:00:56
      220000 -- [-1362.590] (-1366.822) (-1365.883) (-1364.859) * (-1363.498) (-1364.216) (-1362.724) [-1364.880] -- 0:00:56

      Average standard deviation of split frequencies: 0.019654

      220500 -- (-1365.515) (-1366.402) [-1362.825] (-1367.768) * (-1363.881) (-1363.644) (-1362.554) [-1366.282] -- 0:00:56
      221000 -- (-1362.861) [-1363.466] (-1364.753) (-1367.945) * (-1365.371) (-1363.032) (-1362.247) [-1363.242] -- 0:00:56
      221500 -- (-1366.107) [-1363.226] (-1363.253) (-1365.907) * [-1364.863] (-1363.016) (-1361.803) (-1363.666) -- 0:00:56
      222000 -- (-1365.301) (-1365.494) (-1364.044) [-1365.742] * [-1362.672] (-1362.765) (-1362.293) (-1365.380) -- 0:00:56
      222500 -- (-1364.462) (-1362.406) [-1362.763] (-1363.340) * (-1362.475) (-1362.573) [-1362.286] (-1364.650) -- 0:00:55
      223000 -- (-1364.704) (-1364.245) (-1368.074) [-1363.499] * (-1363.650) (-1366.146) (-1365.207) [-1365.603] -- 0:00:55
      223500 -- (-1363.324) (-1363.567) [-1365.931] (-1363.211) * (-1363.142) [-1365.434] (-1365.856) (-1368.011) -- 0:00:55
      224000 -- (-1362.681) (-1363.900) [-1365.352] (-1362.689) * [-1364.300] (-1371.339) (-1374.570) (-1365.017) -- 0:00:55
      224500 -- (-1363.343) (-1365.709) [-1364.946] (-1363.244) * (-1364.412) [-1365.944] (-1369.863) (-1367.021) -- 0:00:58
      225000 -- [-1362.908] (-1363.945) (-1364.126) (-1362.785) * [-1365.148] (-1364.024) (-1368.558) (-1366.222) -- 0:00:58

      Average standard deviation of split frequencies: 0.018460

      225500 -- [-1364.570] (-1368.108) (-1363.492) (-1364.140) * [-1364.547] (-1364.592) (-1365.227) (-1367.868) -- 0:00:58
      226000 -- (-1363.059) (-1365.999) [-1364.644] (-1363.656) * [-1362.714] (-1363.553) (-1365.735) (-1366.576) -- 0:00:58
      226500 -- (-1363.039) [-1363.294] (-1363.654) (-1363.176) * (-1362.356) (-1363.984) (-1366.103) [-1365.305] -- 0:00:58
      227000 -- (-1363.161) (-1364.233) (-1364.164) [-1362.897] * [-1362.888] (-1366.939) (-1367.964) (-1365.170) -- 0:00:57
      227500 -- (-1362.944) (-1365.622) [-1364.243] (-1363.850) * (-1365.841) (-1362.896) (-1372.543) [-1364.563] -- 0:00:57
      228000 -- (-1362.684) [-1362.410] (-1364.166) (-1365.731) * [-1364.205] (-1363.067) (-1364.068) (-1363.492) -- 0:00:57
      228500 -- (-1364.288) (-1362.809) (-1364.752) [-1362.579] * (-1364.289) (-1365.606) [-1363.741] (-1366.702) -- 0:00:57
      229000 -- (-1364.489) (-1364.432) (-1363.762) [-1362.966] * (-1365.207) (-1363.898) (-1362.911) [-1366.337] -- 0:00:57
      229500 -- (-1363.600) (-1363.651) (-1363.709) [-1362.267] * (-1363.313) (-1363.999) [-1363.143] (-1363.098) -- 0:00:57
      230000 -- (-1362.250) (-1364.767) [-1369.331] (-1364.374) * (-1363.181) [-1364.341] (-1363.352) (-1365.894) -- 0:00:56

      Average standard deviation of split frequencies: 0.018802

      230500 -- (-1365.398) [-1364.207] (-1368.033) (-1368.339) * (-1363.039) (-1362.736) [-1362.711] (-1366.392) -- 0:00:56
      231000 -- [-1368.027] (-1364.148) (-1367.383) (-1362.856) * (-1365.625) (-1363.031) (-1362.806) [-1366.283] -- 0:00:56
      231500 -- (-1363.849) [-1363.370] (-1364.601) (-1363.306) * [-1363.440] (-1367.207) (-1363.385) (-1364.262) -- 0:00:56
      232000 -- [-1363.787] (-1363.284) (-1363.664) (-1364.221) * (-1362.879) (-1365.269) [-1362.950] (-1363.110) -- 0:00:56
      232500 -- (-1363.866) (-1364.583) (-1364.094) [-1365.285] * (-1364.573) (-1363.314) [-1363.413] (-1363.629) -- 0:00:56
      233000 -- [-1363.775] (-1365.639) (-1366.193) (-1364.917) * (-1367.451) (-1362.836) [-1362.418] (-1365.973) -- 0:00:55
      233500 -- [-1362.587] (-1364.527) (-1366.140) (-1363.595) * (-1362.597) (-1363.578) [-1364.278] (-1364.446) -- 0:00:55
      234000 -- (-1363.868) [-1362.548] (-1364.665) (-1364.225) * (-1367.289) (-1363.620) [-1362.221] (-1363.676) -- 0:00:55
      234500 -- (-1363.922) [-1362.473] (-1366.540) (-1363.476) * (-1364.723) [-1362.236] (-1364.403) (-1364.505) -- 0:00:55
      235000 -- [-1364.820] (-1365.742) (-1365.625) (-1370.743) * (-1363.606) (-1362.911) [-1364.855] (-1365.328) -- 0:00:55

      Average standard deviation of split frequencies: 0.017977

      235500 -- [-1365.164] (-1364.166) (-1365.602) (-1370.790) * (-1364.503) (-1367.342) (-1364.278) [-1365.608] -- 0:00:55
      236000 -- [-1362.604] (-1365.240) (-1362.800) (-1364.158) * (-1364.273) (-1363.512) [-1363.610] (-1364.356) -- 0:00:55
      236500 -- (-1363.358) (-1363.790) (-1364.303) [-1363.097] * [-1368.868] (-1364.853) (-1363.676) (-1363.401) -- 0:00:54
      237000 -- (-1362.817) (-1365.697) (-1365.567) [-1362.157] * (-1367.947) (-1364.223) (-1365.579) [-1364.969] -- 0:00:54
      237500 -- (-1362.831) [-1364.980] (-1365.744) (-1364.090) * (-1362.251) [-1364.357] (-1363.364) (-1366.693) -- 0:00:57
      238000 -- [-1364.588] (-1366.097) (-1364.019) (-1364.164) * (-1362.342) (-1364.203) [-1365.743] (-1363.724) -- 0:00:57
      238500 -- (-1364.615) (-1364.283) (-1362.695) [-1362.239] * (-1362.924) [-1362.600] (-1367.060) (-1363.174) -- 0:00:57
      239000 -- (-1367.748) (-1364.978) [-1364.115] (-1362.585) * (-1362.924) [-1365.113] (-1366.624) (-1366.939) -- 0:00:57
      239500 -- (-1364.374) (-1362.365) [-1364.053] (-1366.201) * (-1362.836) (-1364.139) (-1365.762) [-1362.938] -- 0:00:57
      240000 -- (-1364.402) (-1363.043) (-1366.114) [-1365.985] * (-1364.415) (-1362.384) (-1365.076) [-1362.927] -- 0:00:56

      Average standard deviation of split frequencies: 0.016105

      240500 -- (-1367.877) (-1363.065) [-1366.381] (-1363.125) * [-1364.415] (-1364.558) (-1368.765) (-1363.390) -- 0:00:56
      241000 -- (-1362.870) (-1362.514) [-1364.046] (-1362.736) * [-1364.415] (-1364.714) (-1367.820) (-1363.231) -- 0:00:56
      241500 -- (-1362.938) (-1363.407) [-1362.854] (-1363.002) * (-1366.773) (-1362.039) [-1363.567] (-1366.168) -- 0:00:56
      242000 -- [-1365.428] (-1363.312) (-1364.528) (-1364.062) * (-1370.947) (-1363.610) [-1363.388] (-1367.384) -- 0:00:56
      242500 -- [-1363.536] (-1363.842) (-1363.937) (-1363.681) * (-1365.903) (-1363.048) [-1366.539] (-1367.402) -- 0:00:56
      243000 -- [-1365.459] (-1362.916) (-1362.029) (-1363.420) * (-1365.191) (-1363.179) [-1364.088] (-1367.447) -- 0:00:56
      243500 -- (-1363.092) (-1365.819) (-1362.359) [-1365.570] * (-1365.492) [-1364.206] (-1365.337) (-1364.194) -- 0:00:55
      244000 -- [-1362.817] (-1364.929) (-1363.168) (-1364.922) * [-1364.009] (-1363.380) (-1362.477) (-1363.392) -- 0:00:55
      244500 -- [-1367.515] (-1366.677) (-1362.957) (-1365.518) * (-1364.936) [-1366.197] (-1363.576) (-1368.174) -- 0:00:55
      245000 -- (-1364.413) (-1364.922) (-1364.241) [-1365.881] * (-1366.113) (-1366.884) (-1367.160) [-1365.486] -- 0:00:55

      Average standard deviation of split frequencies: 0.014479

      245500 -- (-1366.239) (-1364.943) [-1363.462] (-1367.245) * (-1365.994) (-1367.910) [-1364.640] (-1362.921) -- 0:00:55
      246000 -- (-1365.151) (-1366.030) (-1362.884) [-1363.136] * [-1367.865] (-1365.680) (-1362.951) (-1367.236) -- 0:00:55
      246500 -- [-1365.600] (-1372.776) (-1367.466) (-1366.774) * (-1367.492) (-1365.023) [-1364.493] (-1366.120) -- 0:00:55
      247000 -- (-1365.845) (-1366.667) (-1364.849) [-1366.812] * (-1363.649) (-1364.632) [-1362.993] (-1363.642) -- 0:00:54
      247500 -- (-1369.204) (-1366.270) (-1367.140) [-1364.804] * (-1365.928) [-1363.666] (-1363.383) (-1362.827) -- 0:00:54
      248000 -- [-1363.487] (-1368.394) (-1368.377) (-1364.794) * (-1363.680) (-1363.117) [-1366.323] (-1364.489) -- 0:00:54
      248500 -- [-1364.105] (-1370.479) (-1367.808) (-1371.807) * (-1363.674) (-1362.618) (-1364.376) [-1366.585] -- 0:00:54
      249000 -- (-1364.614) (-1362.969) [-1365.784] (-1364.687) * (-1363.244) [-1362.847] (-1363.182) (-1370.010) -- 0:00:54
      249500 -- (-1364.902) (-1364.792) [-1366.945] (-1363.267) * (-1365.809) [-1363.103] (-1363.040) (-1363.621) -- 0:00:54
      250000 -- (-1364.460) (-1363.566) [-1363.365] (-1362.538) * (-1364.948) (-1363.965) (-1362.526) [-1363.065] -- 0:00:54

      Average standard deviation of split frequencies: 0.014000

      250500 -- [-1363.625] (-1364.519) (-1364.309) (-1363.048) * [-1367.978] (-1372.132) (-1368.066) (-1364.865) -- 0:00:53
      251000 -- (-1364.076) [-1366.694] (-1364.023) (-1362.854) * [-1365.419] (-1362.916) (-1366.545) (-1364.275) -- 0:00:56
      251500 -- (-1367.052) (-1366.694) (-1367.226) [-1363.497] * (-1364.079) (-1364.939) [-1364.262] (-1363.591) -- 0:00:56
      252000 -- (-1366.944) (-1364.157) (-1366.307) [-1364.270] * (-1366.906) (-1366.792) [-1363.281] (-1365.881) -- 0:00:56
      252500 -- (-1362.314) (-1364.157) [-1366.678] (-1364.460) * (-1365.994) [-1366.116] (-1364.163) (-1365.367) -- 0:00:56
      253000 -- (-1365.290) (-1363.288) (-1368.736) [-1362.985] * [-1364.399] (-1364.661) (-1362.580) (-1366.048) -- 0:00:56
      253500 -- [-1367.464] (-1364.249) (-1363.205) (-1363.712) * (-1362.804) (-1365.791) [-1362.514] (-1366.108) -- 0:00:55
      254000 -- [-1364.593] (-1363.680) (-1362.582) (-1363.881) * (-1367.661) [-1366.034] (-1363.430) (-1363.609) -- 0:00:55
      254500 -- (-1363.108) (-1363.216) (-1363.075) [-1363.785] * (-1367.620) (-1364.668) [-1363.530] (-1363.889) -- 0:00:55
      255000 -- (-1363.727) [-1363.099] (-1363.645) (-1365.838) * (-1362.334) [-1363.668] (-1362.528) (-1364.985) -- 0:00:55

      Average standard deviation of split frequencies: 0.014322

      255500 -- [-1364.843] (-1363.492) (-1364.361) (-1365.813) * (-1362.359) (-1362.750) (-1362.528) [-1364.515] -- 0:00:55
      256000 -- [-1365.300] (-1364.709) (-1364.396) (-1365.371) * (-1362.357) [-1364.068] (-1362.330) (-1364.121) -- 0:00:55
      256500 -- (-1365.943) [-1363.571] (-1364.523) (-1362.150) * (-1364.438) (-1369.216) [-1362.164] (-1365.471) -- 0:00:55
      257000 -- (-1367.843) (-1363.569) [-1365.953] (-1362.146) * (-1365.570) (-1367.061) (-1362.827) [-1363.563] -- 0:00:54
      257500 -- [-1365.742] (-1363.105) (-1362.147) (-1365.727) * (-1363.526) [-1364.153] (-1362.805) (-1364.323) -- 0:00:54
      258000 -- (-1363.866) [-1363.053] (-1363.076) (-1362.814) * [-1365.017] (-1362.557) (-1368.722) (-1365.170) -- 0:00:54
      258500 -- (-1367.722) (-1363.595) [-1365.836] (-1366.334) * [-1362.468] (-1362.143) (-1365.198) (-1366.619) -- 0:00:54
      259000 -- (-1366.293) [-1363.872] (-1365.836) (-1365.870) * (-1364.181) [-1362.035] (-1365.934) (-1366.379) -- 0:00:54
      259500 -- [-1362.803] (-1363.939) (-1367.977) (-1365.497) * (-1362.906) (-1362.583) [-1363.690] (-1362.784) -- 0:00:54
      260000 -- [-1365.108] (-1362.208) (-1363.435) (-1365.539) * (-1363.766) (-1366.345) [-1363.576] (-1363.683) -- 0:00:54

      Average standard deviation of split frequencies: 0.014568

      260500 -- [-1364.400] (-1363.554) (-1365.970) (-1367.539) * (-1365.019) (-1364.094) [-1363.083] (-1362.855) -- 0:00:53
      261000 -- (-1365.150) (-1363.803) (-1365.957) [-1370.416] * [-1363.643] (-1364.156) (-1366.687) (-1363.295) -- 0:00:53
      261500 -- (-1363.795) [-1363.763] (-1368.388) (-1363.585) * (-1365.927) [-1364.964] (-1368.123) (-1363.624) -- 0:00:53
      262000 -- (-1364.122) (-1364.120) (-1368.434) [-1362.710] * [-1365.711] (-1365.633) (-1369.024) (-1362.619) -- 0:00:53
      262500 -- (-1364.038) [-1363.494] (-1366.019) (-1362.220) * (-1364.061) (-1364.836) (-1367.073) [-1363.331] -- 0:00:53
      263000 -- [-1366.880] (-1364.592) (-1363.365) (-1362.836) * (-1371.066) [-1368.298] (-1366.585) (-1364.002) -- 0:00:53
      263500 -- (-1366.984) (-1364.005) [-1363.628] (-1369.965) * (-1365.164) (-1368.671) [-1367.538] (-1363.622) -- 0:00:53
      264000 -- (-1369.362) [-1363.267] (-1362.802) (-1371.121) * (-1365.588) [-1364.729] (-1367.871) (-1366.925) -- 0:00:52
      264500 -- (-1365.161) (-1363.469) [-1363.189] (-1365.228) * [-1365.637] (-1366.072) (-1367.655) (-1366.215) -- 0:00:55
      265000 -- (-1364.693) (-1366.405) (-1362.929) [-1363.741] * [-1368.288] (-1365.011) (-1365.829) (-1365.954) -- 0:00:55

      Average standard deviation of split frequencies: 0.014670

      265500 -- [-1364.287] (-1364.128) (-1363.975) (-1364.185) * (-1367.068) (-1366.955) (-1364.138) [-1363.552] -- 0:00:55
      266000 -- (-1362.766) (-1365.111) (-1366.838) [-1371.954] * (-1364.401) (-1367.070) (-1364.521) [-1362.367] -- 0:00:55
      266500 -- (-1362.904) (-1365.132) [-1361.772] (-1367.523) * (-1364.401) [-1365.892] (-1362.026) (-1362.739) -- 0:00:55
      267000 -- (-1363.541) (-1364.555) [-1364.419] (-1366.911) * (-1364.159) (-1369.385) (-1368.220) [-1362.787] -- 0:00:54
      267500 -- (-1363.527) [-1364.261] (-1365.582) (-1362.607) * [-1363.966] (-1363.574) (-1365.499) (-1365.182) -- 0:00:54
      268000 -- (-1363.905) (-1364.963) (-1363.094) [-1362.184] * (-1362.470) [-1363.529] (-1368.318) (-1363.749) -- 0:00:54
      268500 -- (-1365.343) [-1363.378] (-1363.297) (-1365.137) * (-1363.383) (-1364.406) (-1366.355) [-1362.865] -- 0:00:54
      269000 -- (-1364.966) [-1362.821] (-1363.817) (-1363.614) * (-1365.360) (-1369.586) [-1365.152] (-1370.111) -- 0:00:54
      269500 -- (-1366.375) (-1363.338) (-1365.304) [-1364.483] * [-1364.541] (-1368.331) (-1362.786) (-1368.122) -- 0:00:54
      270000 -- [-1365.797] (-1366.511) (-1364.614) (-1363.583) * (-1364.934) [-1366.144] (-1362.935) (-1364.257) -- 0:00:54

      Average standard deviation of split frequencies: 0.014997

      270500 -- (-1362.473) (-1366.028) (-1364.652) [-1362.619] * (-1363.500) [-1363.717] (-1363.977) (-1367.814) -- 0:00:53
      271000 -- (-1362.451) [-1368.106] (-1364.346) (-1362.504) * (-1364.847) [-1364.850] (-1365.109) (-1373.422) -- 0:00:53
      271500 -- (-1362.018) (-1362.329) (-1365.805) [-1363.026] * (-1367.378) (-1362.367) (-1368.374) [-1366.771] -- 0:00:53
      272000 -- (-1363.641) (-1364.901) (-1363.800) [-1367.972] * (-1365.625) (-1362.924) (-1366.541) [-1370.441] -- 0:00:53
      272500 -- (-1366.028) [-1364.680] (-1364.120) (-1366.544) * (-1363.476) (-1364.068) (-1371.639) [-1364.463] -- 0:00:53
      273000 -- (-1364.399) (-1364.634) (-1366.664) [-1362.105] * [-1365.164] (-1364.067) (-1367.780) (-1362.370) -- 0:00:53
      273500 -- (-1366.029) (-1362.695) [-1367.982] (-1365.542) * (-1368.853) (-1364.762) (-1364.358) [-1362.308] -- 0:00:53
      274000 -- (-1365.186) (-1363.220) (-1362.568) [-1363.833] * (-1367.352) (-1367.105) [-1364.324] (-1362.808) -- 0:00:52
      274500 -- (-1363.345) (-1363.972) [-1363.499] (-1363.516) * (-1366.470) [-1369.345] (-1363.931) (-1362.675) -- 0:00:52
      275000 -- [-1362.428] (-1363.693) (-1363.073) (-1362.423) * (-1366.222) [-1369.276] (-1363.969) (-1365.015) -- 0:00:52

      Average standard deviation of split frequencies: 0.013759

      275500 -- (-1364.459) (-1364.297) [-1363.797] (-1363.487) * (-1367.083) (-1371.860) (-1364.285) [-1365.124] -- 0:00:52
      276000 -- (-1366.753) (-1365.960) [-1365.186] (-1362.482) * (-1364.373) [-1368.629] (-1364.480) (-1363.895) -- 0:00:52
      276500 -- [-1363.756] (-1365.122) (-1363.881) (-1363.297) * (-1363.313) [-1366.394] (-1363.245) (-1363.886) -- 0:00:52
      277000 -- (-1364.087) (-1364.877) (-1365.516) [-1363.736] * (-1362.706) [-1365.179] (-1363.714) (-1363.172) -- 0:00:52
      277500 -- (-1364.884) (-1365.058) [-1363.315] (-1363.153) * (-1362.473) (-1363.568) (-1369.398) [-1364.470] -- 0:00:52
      278000 -- (-1364.422) (-1365.380) (-1363.132) [-1363.005] * (-1363.742) [-1364.942] (-1366.226) (-1362.176) -- 0:00:54
      278500 -- (-1365.521) [-1363.870] (-1363.428) (-1363.069) * (-1366.232) (-1363.407) [-1362.744] (-1363.799) -- 0:00:54
      279000 -- (-1366.518) (-1363.780) (-1368.166) [-1367.465] * [-1362.463] (-1363.853) (-1363.379) (-1363.406) -- 0:00:54
      279500 -- (-1367.004) (-1364.570) [-1364.005] (-1365.023) * (-1363.459) (-1365.580) [-1366.000] (-1363.428) -- 0:00:54
      280000 -- (-1364.348) (-1363.545) (-1363.711) [-1363.971] * (-1362.649) [-1363.838] (-1372.122) (-1361.959) -- 0:00:53

      Average standard deviation of split frequencies: 0.014326

      280500 -- (-1361.952) (-1365.161) (-1367.461) [-1365.406] * (-1362.285) [-1364.566] (-1367.378) (-1362.960) -- 0:00:53
      281000 -- [-1362.965] (-1363.929) (-1367.164) (-1367.003) * (-1362.507) [-1367.215] (-1366.984) (-1364.269) -- 0:00:53
      281500 -- (-1362.552) (-1365.715) (-1364.370) [-1367.743] * (-1366.726) [-1366.009] (-1363.968) (-1365.493) -- 0:00:53
      282000 -- (-1363.044) (-1365.325) (-1363.140) [-1365.478] * (-1365.255) (-1366.011) (-1362.504) [-1365.706] -- 0:00:53
      282500 -- [-1364.385] (-1367.502) (-1365.771) (-1363.762) * (-1364.699) [-1365.933] (-1363.395) (-1364.606) -- 0:00:53
      283000 -- [-1367.039] (-1365.150) (-1367.812) (-1362.968) * (-1364.508) [-1363.197] (-1364.411) (-1365.984) -- 0:00:53
      283500 -- (-1366.101) [-1363.485] (-1363.597) (-1364.131) * (-1364.826) (-1364.133) [-1363.244] (-1363.756) -- 0:00:53
      284000 -- [-1363.882] (-1363.476) (-1365.609) (-1363.348) * (-1363.466) (-1363.856) [-1363.437] (-1364.450) -- 0:00:52
      284500 -- (-1364.670) (-1363.435) (-1365.739) [-1363.285] * (-1363.728) [-1362.456] (-1363.665) (-1364.061) -- 0:00:52
      285000 -- (-1365.913) (-1369.151) (-1367.759) [-1363.070] * (-1363.838) [-1362.877] (-1364.051) (-1368.117) -- 0:00:52

      Average standard deviation of split frequencies: 0.013644

      285500 -- (-1366.357) [-1367.347] (-1365.261) (-1365.378) * (-1363.546) (-1362.712) (-1363.960) [-1362.625] -- 0:00:52
      286000 -- (-1362.740) (-1364.353) [-1363.883] (-1367.289) * (-1363.908) (-1362.474) [-1364.048] (-1363.272) -- 0:00:52
      286500 -- (-1362.353) (-1367.033) [-1363.059] (-1365.952) * [-1364.880] (-1364.681) (-1363.652) (-1363.737) -- 0:00:52
      287000 -- [-1362.633] (-1361.889) (-1363.098) (-1367.095) * [-1364.652] (-1363.874) (-1365.719) (-1364.915) -- 0:00:52
      287500 -- (-1363.863) (-1363.082) [-1365.284] (-1364.559) * (-1363.528) (-1363.060) (-1365.095) [-1362.420] -- 0:00:52
      288000 -- [-1363.199] (-1366.271) (-1365.132) (-1363.434) * [-1363.670] (-1363.083) (-1364.327) (-1362.420) -- 0:00:51
      288500 -- (-1363.459) [-1364.934] (-1364.917) (-1367.221) * (-1363.386) [-1363.074] (-1362.831) (-1363.410) -- 0:00:51
      289000 -- (-1362.855) (-1365.057) [-1366.766] (-1371.705) * (-1366.603) [-1365.797] (-1363.556) (-1363.886) -- 0:00:51
      289500 -- [-1362.222] (-1364.635) (-1366.574) (-1366.667) * (-1366.381) [-1366.270] (-1363.244) (-1370.066) -- 0:00:51
      290000 -- [-1363.364] (-1363.642) (-1366.213) (-1367.837) * [-1368.277] (-1367.014) (-1363.393) (-1366.908) -- 0:00:51

      Average standard deviation of split frequencies: 0.013515

      290500 -- (-1364.656) (-1364.278) [-1364.134] (-1365.649) * [-1364.043] (-1363.795) (-1363.730) (-1366.349) -- 0:00:51
      291000 -- (-1367.207) [-1363.679] (-1363.568) (-1364.264) * (-1363.337) [-1364.880] (-1366.766) (-1366.463) -- 0:00:51
      291500 -- (-1364.582) (-1366.731) (-1363.994) [-1364.493] * (-1362.883) [-1364.958] (-1364.491) (-1370.549) -- 0:00:53
      292000 -- (-1365.106) (-1365.964) (-1362.375) [-1363.719] * (-1363.613) (-1364.915) [-1364.961] (-1367.691) -- 0:00:53
      292500 -- (-1364.393) [-1362.361] (-1364.271) (-1364.118) * (-1365.098) (-1365.475) [-1362.489] (-1365.097) -- 0:00:53
      293000 -- (-1362.848) (-1362.641) (-1362.899) [-1364.643] * (-1366.072) (-1366.426) [-1362.798] (-1363.467) -- 0:00:53
      293500 -- (-1363.701) (-1362.103) [-1363.772] (-1363.869) * (-1366.913) [-1362.388] (-1362.868) (-1363.813) -- 0:00:52
      294000 -- (-1362.328) (-1364.403) [-1364.247] (-1364.217) * (-1366.953) (-1364.239) (-1364.469) [-1362.901] -- 0:00:52
      294500 -- [-1363.751] (-1364.075) (-1364.572) (-1365.789) * (-1364.300) (-1363.778) (-1363.534) [-1363.953] -- 0:00:52
      295000 -- (-1363.151) [-1363.138] (-1365.253) (-1364.270) * (-1362.934) [-1362.265] (-1364.438) (-1365.896) -- 0:00:52

      Average standard deviation of split frequencies: 0.013914

      295500 -- (-1368.992) (-1362.385) [-1365.729] (-1363.330) * [-1364.399] (-1362.194) (-1367.125) (-1366.971) -- 0:00:52
      296000 -- (-1367.334) (-1362.287) (-1364.783) [-1365.745] * [-1364.966] (-1362.871) (-1365.692) (-1368.711) -- 0:00:52
      296500 -- (-1364.080) [-1363.994] (-1369.361) (-1364.646) * (-1362.690) [-1363.342] (-1366.531) (-1369.483) -- 0:00:52
      297000 -- (-1362.855) (-1363.040) [-1364.893] (-1365.214) * (-1363.720) (-1363.548) [-1364.914] (-1365.096) -- 0:00:52
      297500 -- (-1363.593) (-1363.257) [-1364.251] (-1364.935) * (-1369.552) (-1363.732) [-1362.330] (-1365.151) -- 0:00:51
      298000 -- (-1363.030) [-1363.290] (-1362.669) (-1363.631) * [-1364.758] (-1363.732) (-1366.549) (-1374.330) -- 0:00:51
      298500 -- (-1363.047) (-1362.764) [-1367.045] (-1362.956) * (-1364.478) [-1363.463] (-1369.041) (-1369.960) -- 0:00:51
      299000 -- [-1364.605] (-1367.375) (-1363.805) (-1364.384) * [-1363.174] (-1362.877) (-1367.063) (-1367.065) -- 0:00:51
      299500 -- [-1364.395] (-1364.101) (-1363.863) (-1364.947) * [-1364.302] (-1366.231) (-1363.742) (-1364.478) -- 0:00:51
      300000 -- [-1367.730] (-1364.923) (-1363.951) (-1363.608) * (-1363.079) [-1364.265] (-1364.938) (-1363.919) -- 0:00:51

      Average standard deviation of split frequencies: 0.014895

      300500 -- [-1363.541] (-1364.116) (-1363.995) (-1363.990) * (-1363.054) (-1363.142) [-1366.067] (-1367.965) -- 0:00:51
      301000 -- (-1362.429) (-1362.588) (-1363.660) [-1363.908] * (-1365.023) (-1364.019) [-1363.063] (-1366.704) -- 0:00:51
      301500 -- [-1362.296] (-1362.714) (-1363.886) (-1371.495) * (-1361.916) (-1367.777) (-1365.084) [-1366.033] -- 0:00:50
      302000 -- [-1366.020] (-1364.971) (-1364.155) (-1369.351) * [-1362.972] (-1362.696) (-1364.696) (-1363.660) -- 0:00:50
      302500 -- (-1366.926) [-1362.314] (-1364.395) (-1367.318) * (-1363.364) (-1362.427) [-1365.862] (-1363.233) -- 0:00:50
      303000 -- (-1369.205) (-1362.635) (-1363.434) [-1366.195] * (-1362.932) [-1363.190] (-1363.525) (-1362.283) -- 0:00:50
      303500 -- (-1365.646) (-1363.157) [-1362.689] (-1365.712) * (-1367.988) (-1365.068) [-1364.297] (-1363.540) -- 0:00:50
      304000 -- [-1364.214] (-1363.353) (-1363.068) (-1365.309) * (-1363.694) [-1362.826] (-1364.928) (-1362.766) -- 0:00:50
      304500 -- (-1365.810) (-1362.838) (-1365.135) [-1363.264] * [-1364.812] (-1365.814) (-1364.364) (-1363.757) -- 0:00:50
      305000 -- (-1365.238) [-1365.940] (-1364.486) (-1363.015) * [-1365.011] (-1364.896) (-1364.985) (-1362.765) -- 0:00:52

      Average standard deviation of split frequencies: 0.013351

      305500 -- [-1362.975] (-1366.636) (-1366.006) (-1363.659) * (-1363.189) (-1363.542) [-1366.310] (-1363.798) -- 0:00:52
      306000 -- (-1367.263) (-1363.387) (-1364.403) [-1363.491] * (-1362.992) [-1362.742] (-1363.045) (-1369.473) -- 0:00:52
      306500 -- (-1362.763) (-1362.830) [-1364.916] (-1363.381) * (-1365.398) [-1362.989] (-1363.091) (-1366.058) -- 0:00:52
      307000 -- (-1362.836) [-1363.213] (-1364.216) (-1363.247) * (-1363.274) [-1365.416] (-1365.092) (-1364.694) -- 0:00:51
      307500 -- [-1363.564] (-1363.115) (-1366.099) (-1365.511) * (-1365.045) (-1364.792) [-1364.459] (-1366.060) -- 0:00:51
      308000 -- [-1364.214] (-1363.013) (-1366.851) (-1364.650) * (-1364.148) (-1367.845) [-1364.037] (-1368.324) -- 0:00:51
      308500 -- [-1365.214] (-1365.160) (-1365.739) (-1367.127) * (-1366.124) [-1364.817] (-1363.554) (-1363.672) -- 0:00:51
      309000 -- (-1365.601) [-1363.700] (-1368.344) (-1366.191) * [-1362.958] (-1365.979) (-1365.765) (-1363.039) -- 0:00:51
      309500 -- [-1364.605] (-1364.013) (-1363.675) (-1363.511) * (-1362.277) (-1369.847) (-1366.304) [-1363.425] -- 0:00:51
      310000 -- [-1365.229] (-1362.748) (-1367.285) (-1365.780) * [-1365.566] (-1364.597) (-1370.095) (-1363.697) -- 0:00:51

      Average standard deviation of split frequencies: 0.012858

      310500 -- (-1364.560) (-1363.369) [-1364.654] (-1369.985) * [-1363.105] (-1367.355) (-1368.732) (-1362.756) -- 0:00:51
      311000 -- (-1363.487) [-1364.373] (-1362.997) (-1371.107) * (-1365.202) (-1363.407) [-1363.943] (-1364.329) -- 0:00:50
      311500 -- (-1364.240) [-1363.721] (-1364.360) (-1369.047) * (-1368.269) (-1363.680) [-1363.963] (-1371.474) -- 0:00:50
      312000 -- (-1364.879) (-1364.766) [-1364.418] (-1363.900) * (-1362.493) (-1364.191) [-1362.960] (-1367.506) -- 0:00:50
      312500 -- [-1363.434] (-1365.837) (-1363.290) (-1363.834) * (-1366.858) [-1362.744] (-1364.212) (-1363.870) -- 0:00:50
      313000 -- (-1366.181) [-1365.304] (-1364.158) (-1363.226) * (-1366.174) [-1363.229] (-1366.575) (-1364.298) -- 0:00:50
      313500 -- (-1365.099) (-1365.139) [-1362.947] (-1362.511) * (-1366.628) (-1363.203) (-1367.799) [-1363.966] -- 0:00:50
      314000 -- (-1365.016) (-1366.803) [-1363.956] (-1362.840) * (-1368.565) (-1362.382) (-1364.203) [-1362.935] -- 0:00:50
      314500 -- (-1364.610) [-1363.886] (-1365.005) (-1363.127) * (-1369.911) [-1362.199] (-1366.031) (-1363.117) -- 0:00:50
      315000 -- (-1366.182) (-1364.720) (-1364.655) [-1362.965] * (-1364.529) (-1363.382) (-1363.283) [-1363.925] -- 0:00:50

      Average standard deviation of split frequencies: 0.012987

      315500 -- (-1364.745) (-1363.597) [-1366.519] (-1363.105) * (-1364.857) [-1366.325] (-1363.283) (-1364.702) -- 0:00:49
      316000 -- (-1362.543) [-1363.753] (-1365.024) (-1363.424) * (-1364.879) (-1363.838) [-1365.287] (-1364.921) -- 0:00:49
      316500 -- (-1365.477) [-1365.734] (-1365.074) (-1362.758) * (-1363.120) [-1365.693] (-1366.052) (-1363.450) -- 0:00:49
      317000 -- (-1367.904) (-1362.610) (-1364.845) [-1362.911] * (-1362.724) (-1364.110) (-1367.015) [-1362.641] -- 0:00:49
      317500 -- (-1365.135) (-1362.773) [-1362.673] (-1362.914) * (-1363.569) [-1365.457] (-1362.854) (-1365.175) -- 0:00:49
      318000 -- (-1364.542) (-1362.813) [-1363.054] (-1362.914) * (-1363.130) (-1364.151) (-1362.799) [-1364.746] -- 0:00:49
      318500 -- (-1367.324) (-1363.597) [-1363.750] (-1364.813) * (-1363.422) (-1363.869) [-1364.028] (-1364.162) -- 0:00:51
      319000 -- [-1365.312] (-1363.538) (-1364.735) (-1364.647) * [-1364.029] (-1363.683) (-1362.329) (-1365.778) -- 0:00:51
      319500 -- (-1367.503) [-1362.135] (-1364.833) (-1362.301) * (-1364.035) (-1362.953) (-1362.483) [-1365.910] -- 0:00:51
      320000 -- [-1363.933] (-1364.437) (-1364.411) (-1363.974) * [-1363.627] (-1364.010) (-1362.915) (-1363.695) -- 0:00:50

      Average standard deviation of split frequencies: 0.014456

      320500 -- [-1364.312] (-1363.246) (-1364.462) (-1364.346) * (-1362.241) [-1363.393] (-1366.038) (-1363.843) -- 0:00:50
      321000 -- [-1367.195] (-1362.361) (-1365.512) (-1363.838) * [-1362.499] (-1366.566) (-1364.536) (-1364.859) -- 0:00:50
      321500 -- [-1364.173] (-1363.473) (-1364.608) (-1363.433) * (-1364.676) [-1365.583] (-1362.110) (-1365.168) -- 0:00:50
      322000 -- [-1364.240] (-1364.749) (-1363.632) (-1364.553) * (-1363.955) [-1363.205] (-1364.231) (-1362.405) -- 0:00:50
      322500 -- (-1365.009) (-1363.884) [-1362.928] (-1365.022) * (-1364.281) (-1364.327) (-1362.143) [-1365.121] -- 0:00:50
      323000 -- (-1364.241) (-1363.842) (-1363.520) [-1366.092] * [-1364.863] (-1362.945) (-1365.185) (-1364.662) -- 0:00:50
      323500 -- [-1368.467] (-1364.348) (-1362.425) (-1365.403) * (-1363.458) (-1365.301) [-1362.849] (-1368.730) -- 0:00:50
      324000 -- (-1366.617) (-1366.054) [-1363.895] (-1364.631) * (-1364.282) (-1364.339) [-1362.963] (-1368.280) -- 0:00:50
      324500 -- (-1367.301) (-1363.593) (-1362.892) [-1367.241] * (-1363.987) (-1365.553) (-1363.831) [-1365.732] -- 0:00:49
      325000 -- [-1363.422] (-1366.797) (-1366.840) (-1369.608) * (-1366.484) (-1365.904) (-1364.367) [-1364.449] -- 0:00:49

      Average standard deviation of split frequencies: 0.016972

      325500 -- (-1363.112) [-1363.044] (-1364.990) (-1366.560) * (-1366.590) (-1365.610) [-1363.926] (-1366.690) -- 0:00:49
      326000 -- [-1362.868] (-1363.442) (-1363.855) (-1365.488) * [-1364.102] (-1364.395) (-1363.089) (-1362.815) -- 0:00:49
      326500 -- (-1364.753) (-1363.547) [-1363.015] (-1367.495) * (-1365.962) [-1364.122] (-1364.304) (-1364.659) -- 0:00:49
      327000 -- (-1363.907) (-1363.304) [-1362.386] (-1362.295) * [-1368.540] (-1365.357) (-1363.378) (-1365.810) -- 0:00:49
      327500 -- [-1362.355] (-1362.879) (-1363.121) (-1364.225) * (-1364.263) (-1365.119) [-1363.967] (-1363.962) -- 0:00:49
      328000 -- (-1361.957) (-1363.986) [-1363.760] (-1366.492) * (-1367.715) (-1369.393) (-1364.415) [-1369.367] -- 0:00:49
      328500 -- [-1364.988] (-1362.905) (-1363.696) (-1365.135) * [-1362.355] (-1366.658) (-1365.407) (-1369.316) -- 0:00:49
      329000 -- (-1363.673) (-1364.646) (-1363.191) [-1363.292] * (-1362.273) (-1364.206) (-1366.745) [-1369.548] -- 0:00:48
      329500 -- (-1364.145) [-1364.856] (-1362.280) (-1362.148) * (-1362.137) (-1363.030) [-1365.010] (-1368.792) -- 0:00:48
      330000 -- (-1365.035) (-1362.742) (-1362.805) [-1362.577] * (-1361.976) [-1364.082] (-1365.098) (-1368.759) -- 0:00:48

      Average standard deviation of split frequencies: 0.015365

      330500 -- (-1365.354) (-1366.577) [-1362.792] (-1364.268) * [-1363.757] (-1365.808) (-1365.119) (-1363.999) -- 0:00:48
      331000 -- [-1363.105] (-1365.180) (-1363.482) (-1362.795) * (-1365.978) (-1363.775) (-1363.297) [-1363.847] -- 0:00:48
      331500 -- (-1365.106) (-1368.620) (-1363.290) [-1364.052] * (-1363.677) (-1366.035) [-1363.004] (-1365.145) -- 0:00:50
      332000 -- (-1365.256) [-1364.800] (-1363.028) (-1368.983) * (-1363.286) [-1362.444] (-1364.451) (-1364.236) -- 0:00:50
      332500 -- (-1366.465) [-1365.059] (-1363.615) (-1364.301) * (-1363.730) [-1362.549] (-1367.783) (-1363.657) -- 0:00:50
      333000 -- [-1363.476] (-1363.159) (-1363.446) (-1371.799) * (-1363.166) [-1363.043] (-1365.217) (-1365.281) -- 0:00:50
      333500 -- (-1368.648) [-1364.802] (-1363.728) (-1370.126) * [-1363.474] (-1363.267) (-1364.240) (-1366.077) -- 0:00:49
      334000 -- [-1363.893] (-1363.624) (-1365.530) (-1367.511) * (-1363.268) (-1362.776) (-1363.568) [-1365.181] -- 0:00:49
      334500 -- [-1364.295] (-1367.323) (-1363.602) (-1367.856) * [-1363.229] (-1369.889) (-1364.631) (-1367.203) -- 0:00:49
      335000 -- (-1363.216) (-1363.850) [-1363.053] (-1366.706) * [-1363.281] (-1370.437) (-1364.621) (-1366.508) -- 0:00:49

      Average standard deviation of split frequencies: 0.015277

      335500 -- [-1364.079] (-1369.188) (-1362.597) (-1368.379) * [-1362.528] (-1363.732) (-1363.946) (-1363.214) -- 0:00:49
      336000 -- (-1363.236) [-1367.467] (-1362.519) (-1366.293) * (-1363.189) (-1368.524) [-1363.583] (-1363.312) -- 0:00:49
      336500 -- (-1363.223) (-1365.363) [-1364.014] (-1365.463) * (-1365.884) (-1368.162) [-1363.272] (-1368.760) -- 0:00:49
      337000 -- (-1363.450) [-1365.773] (-1365.120) (-1365.472) * [-1364.266] (-1366.880) (-1363.384) (-1367.419) -- 0:00:49
      337500 -- (-1363.139) (-1368.517) [-1364.654] (-1366.055) * (-1365.383) (-1362.570) [-1364.644] (-1364.294) -- 0:00:49
      338000 -- (-1363.840) (-1366.190) [-1364.175] (-1362.454) * (-1362.932) (-1362.091) (-1364.519) [-1367.160] -- 0:00:48
      338500 -- (-1363.022) (-1363.533) (-1369.669) [-1363.089] * (-1365.352) (-1364.140) [-1365.246] (-1366.936) -- 0:00:48
      339000 -- (-1364.419) (-1363.999) [-1367.528] (-1366.662) * (-1365.316) (-1363.313) (-1364.634) [-1364.132] -- 0:00:48
      339500 -- (-1366.189) (-1363.666) (-1367.465) [-1363.199] * (-1369.049) (-1365.448) (-1363.967) [-1365.189] -- 0:00:48
      340000 -- (-1364.307) [-1363.143] (-1370.694) (-1363.476) * (-1366.723) (-1365.432) (-1364.390) [-1366.820] -- 0:00:48

      Average standard deviation of split frequencies: 0.014760

      340500 -- (-1366.186) (-1363.645) [-1366.207] (-1366.236) * [-1363.901] (-1362.585) (-1363.048) (-1366.007) -- 0:00:48
      341000 -- (-1367.095) (-1364.501) [-1364.492] (-1364.179) * (-1362.871) (-1365.902) (-1362.842) [-1364.115] -- 0:00:48
      341500 -- [-1363.683] (-1363.831) (-1366.532) (-1364.297) * [-1363.003] (-1364.549) (-1368.879) (-1362.389) -- 0:00:48
      342000 -- (-1362.710) (-1363.370) (-1363.685) [-1363.499] * [-1363.003] (-1364.156) (-1367.548) (-1363.106) -- 0:00:48
      342500 -- (-1362.629) (-1362.916) (-1362.978) [-1362.556] * (-1362.785) [-1367.605] (-1365.290) (-1362.422) -- 0:00:47
      343000 -- (-1363.029) [-1363.605] (-1366.873) (-1362.344) * (-1364.098) [-1364.575] (-1363.624) (-1368.224) -- 0:00:47
      343500 -- (-1363.112) (-1366.670) (-1367.039) [-1362.973] * (-1363.146) (-1363.835) (-1363.946) [-1365.182] -- 0:00:47
      344000 -- [-1364.612] (-1367.693) (-1364.184) (-1365.015) * [-1363.142] (-1368.441) (-1363.688) (-1366.400) -- 0:00:47
      344500 -- [-1364.457] (-1365.168) (-1364.148) (-1364.157) * (-1362.576) (-1366.723) (-1363.929) [-1367.439] -- 0:00:47
      345000 -- [-1364.031] (-1363.254) (-1364.353) (-1364.157) * (-1367.309) (-1365.437) [-1367.230] (-1366.153) -- 0:00:49

      Average standard deviation of split frequencies: 0.013840

      345500 -- (-1363.753) (-1362.509) [-1366.461] (-1364.392) * (-1363.187) [-1365.810] (-1365.686) (-1361.895) -- 0:00:49
      346000 -- (-1366.199) (-1363.422) (-1365.720) [-1363.151] * [-1363.259] (-1365.801) (-1362.260) (-1362.306) -- 0:00:49
      346500 -- (-1364.058) (-1364.917) [-1364.651] (-1362.701) * [-1363.161] (-1364.639) (-1362.695) (-1364.275) -- 0:00:49
      347000 -- (-1363.631) [-1365.506] (-1363.892) (-1362.701) * (-1363.548) (-1364.605) (-1364.153) [-1365.352] -- 0:00:48
      347500 -- (-1362.848) (-1365.056) [-1363.783] (-1364.944) * [-1362.454] (-1362.419) (-1364.407) (-1364.279) -- 0:00:48
      348000 -- (-1367.019) [-1362.932] (-1363.877) (-1365.776) * (-1363.740) [-1362.419] (-1362.569) (-1363.128) -- 0:00:48
      348500 -- (-1363.287) (-1362.772) [-1365.217] (-1362.976) * (-1363.700) (-1367.100) (-1362.700) [-1364.136] -- 0:00:48
      349000 -- (-1362.504) (-1362.881) [-1366.844] (-1366.546) * (-1364.300) (-1363.613) [-1362.774] (-1362.820) -- 0:00:48
      349500 -- (-1362.686) (-1363.232) [-1366.263] (-1363.249) * (-1362.663) (-1362.645) [-1364.886] (-1363.628) -- 0:00:48
      350000 -- [-1363.419] (-1362.596) (-1362.020) (-1363.685) * (-1363.167) (-1363.234) (-1363.055) [-1363.454] -- 0:00:48

      Average standard deviation of split frequencies: 0.014471

      350500 -- (-1364.064) (-1365.757) (-1362.917) [-1363.680] * (-1362.864) (-1364.774) [-1367.210] (-1363.433) -- 0:00:48
      351000 -- (-1365.464) (-1364.184) [-1363.258] (-1362.430) * [-1362.737] (-1363.796) (-1364.284) (-1364.227) -- 0:00:48
      351500 -- [-1363.680] (-1366.846) (-1367.991) (-1363.339) * (-1365.471) [-1362.800] (-1366.432) (-1365.095) -- 0:00:47
      352000 -- (-1363.531) (-1362.491) [-1362.817] (-1363.327) * [-1366.654] (-1365.320) (-1363.997) (-1370.902) -- 0:00:47
      352500 -- (-1364.006) [-1363.065] (-1363.616) (-1363.695) * (-1368.861) [-1363.801] (-1363.377) (-1371.469) -- 0:00:47
      353000 -- (-1365.150) [-1366.427] (-1363.367) (-1363.931) * (-1367.396) (-1363.966) [-1362.597] (-1367.727) -- 0:00:47
      353500 -- (-1372.469) (-1362.967) [-1363.318] (-1365.028) * (-1366.418) [-1364.891] (-1362.645) (-1362.495) -- 0:00:47
      354000 -- [-1363.456] (-1366.502) (-1362.762) (-1364.781) * [-1362.431] (-1362.805) (-1364.202) (-1363.149) -- 0:00:47
      354500 -- (-1363.057) (-1367.055) (-1365.691) [-1365.427] * (-1363.107) [-1362.425] (-1363.648) (-1365.431) -- 0:00:47
      355000 -- [-1363.250] (-1364.705) (-1367.264) (-1366.594) * (-1363.946) [-1365.321] (-1364.403) (-1364.579) -- 0:00:47

      Average standard deviation of split frequencies: 0.014198

      355500 -- (-1362.514) [-1363.447] (-1367.573) (-1371.895) * (-1363.945) (-1363.947) [-1364.152] (-1364.943) -- 0:00:47
      356000 -- (-1367.368) (-1365.030) [-1362.498] (-1368.707) * (-1363.587) (-1363.541) [-1363.639] (-1364.079) -- 0:00:47
      356500 -- (-1365.769) [-1364.354] (-1362.243) (-1363.635) * (-1362.721) [-1362.184] (-1365.710) (-1364.097) -- 0:00:46
      357000 -- (-1367.556) (-1366.155) (-1362.161) [-1362.730] * (-1362.481) (-1364.434) (-1361.990) [-1363.639] -- 0:00:46
      357500 -- (-1363.070) [-1364.294] (-1366.000) (-1362.753) * (-1363.256) (-1363.962) [-1366.944] (-1365.471) -- 0:00:46
      358000 -- (-1365.034) [-1367.888] (-1364.158) (-1362.967) * (-1363.946) (-1365.964) [-1365.148] (-1363.596) -- 0:00:48
      358500 -- (-1364.425) (-1365.839) [-1365.298] (-1364.714) * [-1363.154] (-1364.098) (-1364.151) (-1367.231) -- 0:00:48
      359000 -- [-1363.866] (-1366.405) (-1364.287) (-1362.550) * (-1363.003) [-1362.316] (-1362.890) (-1371.280) -- 0:00:48
      359500 -- (-1364.931) (-1365.982) [-1363.422] (-1365.537) * (-1362.534) [-1364.323] (-1364.200) (-1363.994) -- 0:00:48
      360000 -- (-1364.559) (-1366.558) [-1363.838] (-1364.643) * (-1363.105) (-1365.447) (-1365.217) [-1362.737] -- 0:00:47

      Average standard deviation of split frequencies: 0.013288

      360500 -- (-1364.072) (-1364.424) [-1362.885] (-1367.502) * (-1363.053) (-1365.704) [-1363.731] (-1363.585) -- 0:00:47
      361000 -- (-1367.880) (-1363.731) [-1367.270] (-1367.954) * (-1362.824) [-1364.685] (-1363.706) (-1366.295) -- 0:00:47
      361500 -- (-1365.997) (-1366.517) (-1366.272) [-1362.550] * [-1364.271] (-1365.443) (-1364.580) (-1364.323) -- 0:00:47
      362000 -- (-1365.991) (-1362.960) [-1362.710] (-1364.355) * (-1363.784) [-1365.137] (-1363.520) (-1363.121) -- 0:00:47
      362500 -- (-1365.504) (-1362.559) [-1365.226] (-1367.274) * [-1364.336] (-1368.540) (-1363.148) (-1363.344) -- 0:00:47
      363000 -- (-1369.671) (-1362.559) [-1366.741] (-1364.721) * (-1363.480) (-1367.189) [-1364.257] (-1362.856) -- 0:00:47
      363500 -- (-1364.089) (-1363.663) (-1367.170) [-1364.957] * [-1363.364] (-1363.610) (-1364.010) (-1365.257) -- 0:00:47
      364000 -- (-1364.448) (-1364.892) (-1371.202) [-1368.703] * (-1363.847) [-1363.154] (-1363.787) (-1365.428) -- 0:00:47
      364500 -- (-1364.041) [-1364.884] (-1362.810) (-1365.374) * (-1365.367) (-1365.731) [-1362.602] (-1366.469) -- 0:00:47
      365000 -- (-1364.733) (-1368.756) (-1363.280) [-1363.293] * (-1363.197) (-1366.507) [-1362.633] (-1366.862) -- 0:00:46

      Average standard deviation of split frequencies: 0.011520

      365500 -- (-1364.899) (-1368.418) [-1363.634] (-1363.769) * [-1362.962] (-1368.940) (-1362.605) (-1367.221) -- 0:00:46
      366000 -- (-1363.890) [-1363.812] (-1365.576) (-1363.827) * (-1362.250) (-1364.932) (-1362.078) [-1370.194] -- 0:00:46
      366500 -- (-1364.102) [-1364.121] (-1367.528) (-1363.252) * (-1364.126) (-1366.764) (-1362.709) [-1364.766] -- 0:00:46
      367000 -- (-1363.341) (-1366.124) [-1365.334] (-1365.503) * (-1364.345) (-1362.878) [-1362.517] (-1365.280) -- 0:00:46
      367500 -- (-1365.431) (-1367.557) [-1365.171] (-1362.683) * (-1362.511) [-1363.703] (-1364.133) (-1370.551) -- 0:00:46
      368000 -- (-1365.946) (-1365.197) [-1365.807] (-1362.701) * (-1363.956) (-1365.463) (-1364.697) [-1362.382] -- 0:00:46
      368500 -- (-1363.006) (-1364.834) [-1367.167] (-1362.717) * (-1364.580) (-1362.705) [-1363.924] (-1363.047) -- 0:00:46
      369000 -- (-1362.751) [-1364.955] (-1364.683) (-1362.515) * (-1365.077) (-1363.458) (-1365.251) [-1363.630] -- 0:00:46
      369500 -- (-1364.159) (-1363.991) [-1363.260] (-1362.835) * (-1364.811) (-1362.981) (-1365.274) [-1363.803] -- 0:00:46
      370000 -- (-1364.695) [-1363.820] (-1362.435) (-1365.378) * [-1364.494] (-1368.130) (-1364.239) (-1364.617) -- 0:00:45

      Average standard deviation of split frequencies: 0.010739

      370500 -- (-1363.070) (-1364.066) (-1362.424) [-1364.072] * (-1364.834) [-1362.299] (-1364.933) (-1362.337) -- 0:00:45
      371000 -- (-1363.357) (-1364.062) [-1364.249] (-1363.280) * (-1365.331) [-1362.835] (-1363.165) (-1362.784) -- 0:00:45
      371500 -- (-1365.258) (-1366.064) [-1363.028] (-1363.909) * (-1364.576) (-1362.162) [-1363.256] (-1362.483) -- 0:00:47
      372000 -- (-1365.721) (-1365.502) (-1365.955) [-1366.066] * (-1365.390) (-1363.268) [-1363.628] (-1362.713) -- 0:00:47
      372500 -- [-1365.128] (-1364.070) (-1364.117) (-1363.459) * [-1363.195] (-1362.987) (-1364.115) (-1367.821) -- 0:00:47
      373000 -- (-1363.063) [-1362.512] (-1363.363) (-1363.720) * (-1368.426) (-1364.951) (-1363.846) [-1368.321] -- 0:00:47
      373500 -- (-1362.938) (-1363.109) [-1365.531] (-1363.488) * [-1365.042] (-1367.980) (-1368.750) (-1364.165) -- 0:00:46
      374000 -- (-1364.697) (-1364.421) (-1362.509) [-1363.370] * [-1364.498] (-1364.067) (-1364.499) (-1363.541) -- 0:00:46
      374500 -- (-1365.206) (-1362.978) [-1366.300] (-1365.680) * (-1370.133) [-1367.356] (-1366.477) (-1363.102) -- 0:00:46
      375000 -- (-1363.917) [-1362.014] (-1366.747) (-1362.436) * (-1363.643) (-1365.340) [-1365.093] (-1362.530) -- 0:00:46

      Average standard deviation of split frequencies: 0.011423

      375500 -- [-1365.349] (-1363.312) (-1364.386) (-1364.887) * (-1364.252) (-1362.732) (-1365.890) [-1366.396] -- 0:00:46
      376000 -- (-1364.680) [-1363.061] (-1363.507) (-1363.507) * (-1363.680) (-1362.926) (-1363.097) [-1366.307] -- 0:00:46
      376500 -- (-1362.194) (-1363.063) (-1368.677) [-1363.282] * (-1366.261) [-1363.077] (-1366.441) (-1363.287) -- 0:00:46
      377000 -- [-1363.935] (-1362.138) (-1368.193) (-1365.796) * (-1365.825) (-1363.878) [-1365.877] (-1362.437) -- 0:00:46
      377500 -- (-1365.470) [-1363.730] (-1366.728) (-1365.037) * (-1364.776) [-1364.937] (-1366.999) (-1362.437) -- 0:00:46
      378000 -- (-1365.862) (-1364.805) (-1365.969) [-1364.110] * (-1363.561) (-1366.578) [-1362.589] (-1362.504) -- 0:00:46
      378500 -- (-1366.136) (-1364.695) (-1363.205) [-1363.311] * (-1364.524) [-1363.857] (-1363.206) (-1362.546) -- 0:00:45
      379000 -- [-1363.598] (-1365.170) (-1364.209) (-1364.023) * (-1363.026) (-1362.487) (-1363.728) [-1363.733] -- 0:00:45
      379500 -- (-1364.262) (-1363.383) (-1365.076) [-1366.242] * (-1364.245) (-1362.974) [-1362.884] (-1366.002) -- 0:00:45
      380000 -- [-1365.134] (-1364.146) (-1362.527) (-1363.695) * [-1363.194] (-1363.429) (-1369.451) (-1365.328) -- 0:00:45

      Average standard deviation of split frequencies: 0.013039

      380500 -- (-1366.585) (-1363.806) (-1363.387) [-1364.352] * (-1363.999) (-1365.490) (-1363.300) [-1363.573] -- 0:00:45
      381000 -- (-1363.645) (-1366.828) (-1364.632) [-1362.808] * (-1364.220) (-1364.616) [-1362.942] (-1368.795) -- 0:00:45
      381500 -- [-1365.411] (-1365.123) (-1364.327) (-1364.736) * (-1363.867) (-1366.944) [-1363.450] (-1362.681) -- 0:00:45
      382000 -- (-1361.995) (-1365.076) (-1365.414) [-1364.938] * (-1364.402) (-1368.156) (-1364.952) [-1365.681] -- 0:00:45
      382500 -- (-1362.331) [-1365.951] (-1363.730) (-1363.235) * (-1363.071) (-1367.267) (-1362.673) [-1366.013] -- 0:00:45
      383000 -- [-1363.748] (-1362.728) (-1362.331) (-1363.938) * (-1363.591) (-1363.822) [-1363.430] (-1366.050) -- 0:00:45
      383500 -- (-1363.819) (-1362.739) (-1364.504) [-1364.871] * (-1363.272) (-1363.322) (-1364.269) [-1365.278] -- 0:00:45
      384000 -- (-1366.963) (-1363.357) [-1364.072] (-1362.831) * (-1363.908) (-1363.102) (-1362.412) [-1363.973] -- 0:00:44
      384500 -- [-1363.419] (-1365.075) (-1365.328) (-1362.062) * (-1369.864) (-1363.920) (-1366.717) [-1364.004] -- 0:00:44
      385000 -- (-1368.489) (-1364.909) (-1365.405) [-1362.063] * (-1362.674) (-1362.512) (-1364.347) [-1366.720] -- 0:00:46

      Average standard deviation of split frequencies: 0.012500

      385500 -- (-1366.577) (-1366.768) [-1363.775] (-1363.240) * (-1363.683) (-1363.139) (-1365.966) [-1365.901] -- 0:00:46
      386000 -- (-1365.853) [-1368.411] (-1362.914) (-1363.855) * (-1362.156) (-1365.316) (-1366.266) [-1363.453] -- 0:00:46
      386500 -- (-1362.740) (-1364.358) [-1363.130] (-1364.070) * (-1369.089) (-1363.552) (-1369.616) [-1365.459] -- 0:00:46
      387000 -- (-1363.505) [-1364.347] (-1365.626) (-1364.019) * (-1366.503) (-1364.705) (-1366.793) [-1367.767] -- 0:00:45
      387500 -- (-1364.004) [-1364.027] (-1364.117) (-1363.491) * (-1366.657) [-1363.052] (-1363.559) (-1365.516) -- 0:00:45
      388000 -- [-1363.008] (-1363.631) (-1363.258) (-1365.029) * (-1363.691) (-1363.811) [-1364.183] (-1365.205) -- 0:00:45
      388500 -- (-1368.292) [-1364.285] (-1364.657) (-1362.523) * (-1363.691) [-1362.963] (-1362.896) (-1363.706) -- 0:00:45
      389000 -- [-1367.582] (-1363.717) (-1367.550) (-1367.003) * [-1362.985] (-1362.460) (-1362.984) (-1364.587) -- 0:00:45
      389500 -- [-1364.922] (-1364.603) (-1366.336) (-1364.682) * (-1363.604) (-1363.696) (-1363.833) [-1362.640] -- 0:00:45
      390000 -- (-1366.886) (-1364.124) (-1362.334) [-1363.041] * (-1363.373) (-1365.005) (-1363.027) [-1363.702] -- 0:00:45

      Average standard deviation of split frequencies: 0.012564

      390500 -- (-1363.907) (-1370.073) (-1362.732) [-1364.289] * (-1363.590) (-1363.775) [-1362.808] (-1362.117) -- 0:00:45
      391000 -- (-1363.329) (-1363.545) (-1365.933) [-1362.425] * (-1364.246) [-1363.429] (-1366.321) (-1362.865) -- 0:00:45
      391500 -- [-1362.412] (-1370.376) (-1363.785) (-1362.882) * (-1365.889) [-1362.103] (-1362.242) (-1365.895) -- 0:00:45
      392000 -- [-1364.031] (-1364.002) (-1363.795) (-1367.111) * (-1362.775) (-1362.110) [-1363.945] (-1367.897) -- 0:00:44
      392500 -- [-1362.913] (-1364.577) (-1365.003) (-1365.728) * (-1362.699) (-1367.066) [-1364.749] (-1365.801) -- 0:00:44
      393000 -- (-1365.724) (-1363.587) (-1364.706) [-1368.771] * [-1363.074] (-1367.113) (-1366.237) (-1367.112) -- 0:00:44
      393500 -- (-1365.294) [-1362.946] (-1363.436) (-1363.614) * (-1363.369) [-1364.675] (-1363.315) (-1363.436) -- 0:00:44
      394000 -- [-1364.412] (-1365.256) (-1364.858) (-1362.885) * (-1363.805) [-1363.600] (-1362.431) (-1362.870) -- 0:00:44
      394500 -- (-1363.749) (-1367.195) [-1362.351] (-1367.104) * [-1363.889] (-1367.539) (-1362.431) (-1363.633) -- 0:00:44
      395000 -- [-1366.664] (-1368.806) (-1362.987) (-1365.024) * (-1363.519) [-1367.142] (-1362.251) (-1364.574) -- 0:00:44

      Average standard deviation of split frequencies: 0.011904

      395500 -- (-1366.155) (-1368.215) (-1366.279) [-1366.671] * [-1365.111] (-1367.146) (-1362.841) (-1365.494) -- 0:00:44
      396000 -- [-1367.792] (-1365.916) (-1370.260) (-1363.472) * (-1364.140) (-1365.493) [-1362.560] (-1365.619) -- 0:00:44
      396500 -- (-1368.606) [-1364.973] (-1365.450) (-1363.441) * (-1365.670) (-1364.652) (-1364.698) [-1363.386] -- 0:00:44
      397000 -- (-1366.034) [-1363.088] (-1365.807) (-1366.129) * [-1364.561] (-1365.501) (-1368.653) (-1362.671) -- 0:00:44
      397500 -- (-1364.707) (-1362.787) (-1365.251) [-1363.781] * [-1363.358] (-1366.500) (-1367.431) (-1363.822) -- 0:00:43
      398000 -- (-1364.104) (-1369.501) [-1363.715] (-1363.382) * [-1363.511] (-1365.095) (-1364.510) (-1363.427) -- 0:00:43
      398500 -- (-1364.573) [-1367.676] (-1364.651) (-1365.392) * (-1365.234) [-1363.007] (-1367.142) (-1363.632) -- 0:00:45
      399000 -- (-1364.779) (-1365.915) (-1364.775) [-1365.779] * [-1363.185] (-1364.273) (-1366.553) (-1363.339) -- 0:00:45
      399500 -- (-1366.748) (-1366.881) [-1364.740] (-1365.037) * (-1364.141) (-1366.319) (-1365.307) [-1363.325] -- 0:00:45
      400000 -- [-1362.900] (-1365.771) (-1363.568) (-1365.253) * (-1364.113) (-1366.031) (-1366.611) [-1362.961] -- 0:00:44

      Average standard deviation of split frequencies: 0.013150

      400500 -- (-1364.201) (-1364.526) (-1368.855) [-1363.617] * (-1363.088) (-1368.323) [-1367.508] (-1363.640) -- 0:00:44
      401000 -- (-1363.129) [-1362.315] (-1363.079) (-1367.050) * (-1363.457) (-1367.341) [-1363.125] (-1362.707) -- 0:00:44
      401500 -- (-1363.463) (-1363.071) (-1363.182) [-1366.470] * (-1363.060) [-1363.056] (-1363.361) (-1363.503) -- 0:00:44
      402000 -- (-1363.297) (-1364.596) (-1363.085) [-1363.430] * (-1363.172) [-1363.636] (-1364.807) (-1363.299) -- 0:00:44
      402500 -- (-1362.698) [-1362.449] (-1366.469) (-1366.553) * (-1374.046) (-1363.385) [-1363.624] (-1363.220) -- 0:00:44
      403000 -- (-1367.851) (-1362.504) (-1368.081) [-1367.545] * (-1363.112) (-1366.967) (-1362.395) [-1364.284] -- 0:00:44
      403500 -- [-1363.177] (-1362.455) (-1365.129) (-1365.909) * (-1362.852) (-1362.519) (-1364.254) [-1363.798] -- 0:00:44
      404000 -- (-1363.267) [-1362.358] (-1364.727) (-1364.253) * (-1362.975) [-1363.155] (-1365.702) (-1362.443) -- 0:00:44
      404500 -- [-1364.037] (-1366.121) (-1364.367) (-1363.826) * (-1362.996) (-1363.909) [-1362.946] (-1365.287) -- 0:00:44
      405000 -- (-1364.556) (-1363.297) [-1363.694] (-1365.847) * (-1366.218) (-1362.689) (-1362.850) [-1364.638] -- 0:00:44

      Average standard deviation of split frequencies: 0.013804

      405500 -- (-1364.954) (-1364.264) (-1366.563) [-1363.164] * (-1363.785) (-1363.482) [-1363.429] (-1366.396) -- 0:00:43
      406000 -- (-1362.867) [-1363.202] (-1366.180) (-1366.328) * (-1366.778) [-1363.620] (-1362.380) (-1363.899) -- 0:00:43
      406500 -- (-1363.939) (-1364.034) [-1366.008] (-1365.405) * [-1363.635] (-1364.055) (-1366.298) (-1364.205) -- 0:00:43
      407000 -- (-1365.721) (-1363.062) [-1362.895] (-1363.110) * [-1366.188] (-1366.031) (-1367.574) (-1366.655) -- 0:00:43
      407500 -- (-1364.742) [-1366.875] (-1363.119) (-1362.180) * (-1364.270) [-1363.062] (-1365.859) (-1363.189) -- 0:00:43
      408000 -- (-1365.587) (-1363.747) (-1364.198) [-1362.685] * (-1365.074) (-1362.971) [-1370.754] (-1362.437) -- 0:00:43
      408500 -- (-1364.190) (-1364.049) [-1366.385] (-1364.895) * (-1366.763) (-1363.139) [-1364.194] (-1367.507) -- 0:00:43
      409000 -- [-1363.256] (-1364.141) (-1366.829) (-1366.229) * (-1364.083) (-1363.609) (-1364.865) [-1363.310] -- 0:00:43
      409500 -- [-1364.540] (-1365.472) (-1366.436) (-1365.919) * (-1365.814) [-1362.130] (-1363.732) (-1362.865) -- 0:00:43
      410000 -- (-1363.870) (-1363.226) [-1364.422] (-1363.821) * (-1364.158) (-1369.171) [-1363.724] (-1363.321) -- 0:00:43

      Average standard deviation of split frequencies: 0.014585

      410500 -- [-1363.041] (-1363.075) (-1363.785) (-1365.086) * (-1364.562) [-1363.073] (-1362.119) (-1363.594) -- 0:00:43
      411000 -- [-1362.552] (-1367.952) (-1368.620) (-1364.059) * (-1362.726) (-1364.738) (-1362.386) [-1364.820] -- 0:00:42
      411500 -- (-1361.988) [-1365.506] (-1367.603) (-1364.965) * (-1362.083) [-1365.336] (-1364.825) (-1365.060) -- 0:00:44
      412000 -- (-1366.006) [-1368.180] (-1367.606) (-1366.495) * (-1364.654) (-1365.903) [-1366.586] (-1364.549) -- 0:00:44
      412500 -- [-1362.514] (-1368.919) (-1364.507) (-1365.434) * (-1363.126) [-1362.548] (-1366.804) (-1362.449) -- 0:00:44
      413000 -- (-1372.054) (-1363.067) (-1365.641) [-1365.441] * [-1365.647] (-1362.779) (-1368.880) (-1364.661) -- 0:00:44
      413500 -- [-1365.143] (-1362.597) (-1361.978) (-1362.744) * [-1362.020] (-1366.629) (-1365.819) (-1364.066) -- 0:00:43
      414000 -- [-1363.904] (-1362.859) (-1361.994) (-1362.651) * (-1365.625) (-1366.629) [-1362.738] (-1366.114) -- 0:00:43
      414500 -- (-1363.635) [-1363.818] (-1363.986) (-1363.065) * [-1367.233] (-1366.633) (-1362.785) (-1367.017) -- 0:00:43
      415000 -- [-1365.227] (-1362.804) (-1365.077) (-1363.760) * [-1363.484] (-1363.133) (-1363.808) (-1368.476) -- 0:00:43

      Average standard deviation of split frequencies: 0.013998

      415500 -- [-1364.492] (-1364.627) (-1364.102) (-1368.723) * (-1363.380) (-1362.411) [-1366.393] (-1366.514) -- 0:00:43
      416000 -- (-1364.692) (-1364.873) (-1362.867) [-1362.526] * (-1363.371) (-1362.411) [-1364.120] (-1363.964) -- 0:00:43
      416500 -- (-1365.500) [-1365.726] (-1362.667) (-1362.746) * (-1367.351) (-1366.492) (-1364.514) [-1363.912] -- 0:00:43
      417000 -- (-1362.598) (-1367.288) [-1363.767] (-1366.095) * (-1365.945) (-1364.912) [-1366.621] (-1362.732) -- 0:00:43
      417500 -- (-1364.996) (-1363.412) [-1363.173] (-1362.332) * [-1365.112] (-1366.228) (-1366.464) (-1365.113) -- 0:00:43
      418000 -- (-1365.326) (-1364.018) (-1364.069) [-1364.448] * (-1364.986) [-1363.051] (-1366.198) (-1368.071) -- 0:00:43
      418500 -- [-1363.996] (-1364.763) (-1362.529) (-1364.346) * (-1363.144) (-1363.008) [-1362.930] (-1365.228) -- 0:00:43
      419000 -- (-1363.899) [-1366.312] (-1362.401) (-1364.301) * (-1364.470) (-1364.533) (-1365.239) [-1364.636] -- 0:00:42
      419500 -- (-1363.868) (-1364.624) [-1363.967] (-1362.719) * (-1362.620) (-1365.064) (-1365.200) [-1364.471] -- 0:00:42
      420000 -- (-1364.507) (-1364.558) (-1363.631) [-1365.115] * (-1362.987) (-1365.219) [-1364.720] (-1364.194) -- 0:00:42

      Average standard deviation of split frequencies: 0.014568

      420500 -- (-1367.837) [-1362.369] (-1364.008) (-1363.923) * (-1363.373) (-1367.001) (-1369.117) [-1363.498] -- 0:00:42
      421000 -- (-1362.788) (-1364.612) [-1364.393] (-1368.719) * (-1362.720) (-1365.366) [-1363.267] (-1363.225) -- 0:00:42
      421500 -- (-1364.956) (-1370.169) [-1364.701] (-1364.437) * (-1362.505) (-1366.186) [-1362.593] (-1363.395) -- 0:00:42
      422000 -- (-1367.798) (-1367.367) [-1365.312] (-1362.372) * (-1365.397) (-1365.774) (-1363.951) [-1363.587] -- 0:00:42
      422500 -- (-1367.136) [-1364.102] (-1364.173) (-1363.096) * (-1363.926) [-1364.145] (-1364.457) (-1362.833) -- 0:00:42
      423000 -- [-1366.147] (-1366.083) (-1363.949) (-1364.772) * (-1364.697) (-1365.125) (-1365.176) [-1363.472] -- 0:00:42
      423500 -- [-1362.429] (-1369.103) (-1363.892) (-1365.915) * [-1364.434] (-1366.971) (-1363.726) (-1365.602) -- 0:00:42
      424000 -- [-1365.696] (-1367.342) (-1363.679) (-1362.541) * (-1363.659) [-1367.697] (-1364.566) (-1367.692) -- 0:00:42
      424500 -- (-1364.640) (-1363.826) (-1364.231) [-1362.440] * (-1366.635) [-1363.292] (-1363.953) (-1364.930) -- 0:00:43
      425000 -- [-1364.805] (-1365.589) (-1364.442) (-1362.439) * (-1368.390) (-1365.811) [-1362.900] (-1365.496) -- 0:00:43

      Average standard deviation of split frequencies: 0.014631

      425500 -- [-1362.269] (-1363.440) (-1365.205) (-1362.793) * (-1364.781) [-1366.377] (-1364.108) (-1363.476) -- 0:00:43
      426000 -- [-1364.280] (-1366.359) (-1366.285) (-1362.933) * (-1364.285) (-1365.952) (-1363.775) [-1363.809] -- 0:00:43
      426500 -- [-1363.330] (-1362.625) (-1364.614) (-1365.637) * (-1363.691) (-1366.425) [-1363.144] (-1363.919) -- 0:00:43
      427000 -- (-1362.381) (-1364.190) (-1363.300) [-1367.590] * (-1363.968) (-1365.074) (-1363.258) [-1365.142] -- 0:00:42
      427500 -- (-1364.062) (-1362.937) [-1366.746] (-1365.140) * [-1364.107] (-1364.156) (-1364.022) (-1372.225) -- 0:00:42
      428000 -- (-1363.126) (-1362.573) (-1363.843) [-1367.637] * (-1366.888) [-1361.960] (-1366.810) (-1366.372) -- 0:00:42
      428500 -- (-1362.833) (-1363.864) [-1362.226] (-1365.668) * (-1373.095) (-1364.069) [-1362.474] (-1365.062) -- 0:00:42
      429000 -- (-1365.752) (-1366.614) (-1364.218) [-1363.343] * (-1363.681) [-1362.165] (-1363.092) (-1366.079) -- 0:00:42
      429500 -- (-1365.171) (-1363.882) [-1366.168] (-1365.011) * (-1363.725) [-1363.133] (-1364.498) (-1366.442) -- 0:00:42
      430000 -- [-1362.872] (-1363.975) (-1365.269) (-1366.804) * (-1363.197) (-1363.904) [-1364.630] (-1363.649) -- 0:00:42

      Average standard deviation of split frequencies: 0.015260

      430500 -- [-1364.199] (-1363.887) (-1363.264) (-1369.086) * (-1365.844) [-1365.610] (-1365.855) (-1364.310) -- 0:00:42
      431000 -- (-1366.282) (-1362.934) (-1364.728) [-1362.610] * (-1365.534) (-1365.256) [-1362.269] (-1366.743) -- 0:00:42
      431500 -- [-1365.152] (-1363.914) (-1365.398) (-1364.501) * (-1364.087) (-1363.734) (-1363.277) [-1364.028] -- 0:00:42
      432000 -- (-1365.041) (-1365.179) [-1366.606] (-1362.748) * (-1362.213) (-1365.379) [-1363.861] (-1363.692) -- 0:00:42
      432500 -- (-1363.259) (-1368.494) [-1366.349] (-1364.795) * (-1365.958) (-1365.385) [-1365.796] (-1365.008) -- 0:00:41
      433000 -- (-1361.902) [-1364.555] (-1364.003) (-1363.790) * (-1367.024) (-1362.609) [-1367.206] (-1365.455) -- 0:00:41
      433500 -- (-1362.856) (-1363.503) (-1365.252) [-1364.396] * (-1366.936) [-1362.578] (-1363.847) (-1366.539) -- 0:00:41
      434000 -- (-1362.280) [-1366.006] (-1364.056) (-1363.310) * (-1364.964) (-1362.571) (-1368.889) [-1364.002] -- 0:00:41
      434500 -- [-1362.449] (-1363.265) (-1364.008) (-1362.826) * (-1364.861) (-1362.709) [-1363.646] (-1363.968) -- 0:00:41
      435000 -- (-1367.380) [-1365.054] (-1363.916) (-1364.491) * (-1364.249) [-1362.871] (-1363.297) (-1362.713) -- 0:00:41

      Average standard deviation of split frequencies: 0.014692

      435500 -- [-1364.984] (-1363.348) (-1362.993) (-1365.166) * [-1364.055] (-1362.484) (-1363.546) (-1363.516) -- 0:00:41
      436000 -- (-1365.251) [-1363.479] (-1363.815) (-1365.259) * [-1370.931] (-1362.651) (-1365.364) (-1363.135) -- 0:00:41
      436500 -- [-1367.335] (-1362.257) (-1366.838) (-1362.844) * (-1368.176) [-1364.186] (-1363.942) (-1363.628) -- 0:00:41
      437000 -- [-1365.568] (-1363.561) (-1366.990) (-1364.782) * (-1367.502) [-1363.265] (-1366.121) (-1362.669) -- 0:00:41
      437500 -- [-1366.174] (-1363.936) (-1369.409) (-1367.482) * (-1365.480) (-1363.858) (-1368.412) [-1365.553] -- 0:00:42
      438000 -- (-1363.529) (-1364.460) [-1367.169] (-1367.492) * (-1364.904) (-1365.052) [-1362.865] (-1365.677) -- 0:00:42
      438500 -- (-1363.471) [-1362.601] (-1364.895) (-1363.356) * (-1363.882) (-1365.453) [-1362.812] (-1368.298) -- 0:00:42
      439000 -- (-1363.127) (-1364.000) (-1366.147) [-1362.742] * (-1365.980) (-1364.568) (-1365.318) [-1364.367] -- 0:00:42
      439500 -- (-1365.496) [-1363.424] (-1364.877) (-1365.187) * (-1365.666) (-1364.321) [-1362.618] (-1367.620) -- 0:00:42
      440000 -- [-1362.073] (-1363.418) (-1367.335) (-1369.545) * (-1364.311) (-1363.403) [-1363.539] (-1366.773) -- 0:00:41

      Average standard deviation of split frequencies: 0.014599

      440500 -- (-1364.214) (-1364.442) [-1365.883] (-1368.066) * [-1363.903] (-1365.740) (-1364.409) (-1366.296) -- 0:00:41
      441000 -- [-1364.393] (-1365.374) (-1362.801) (-1367.327) * (-1364.336) [-1364.006] (-1364.061) (-1364.373) -- 0:00:41
      441500 -- (-1364.709) (-1365.611) (-1364.901) [-1366.179] * [-1365.450] (-1362.922) (-1364.427) (-1362.684) -- 0:00:41
      442000 -- (-1363.873) [-1362.093] (-1365.974) (-1368.509) * (-1365.314) (-1364.397) (-1365.755) [-1364.124] -- 0:00:41
      442500 -- [-1364.971] (-1365.505) (-1362.754) (-1366.535) * (-1363.231) (-1365.637) [-1364.520] (-1364.184) -- 0:00:41
      443000 -- [-1363.052] (-1368.404) (-1364.017) (-1366.170) * (-1363.194) [-1365.186] (-1366.324) (-1366.693) -- 0:00:41
      443500 -- [-1362.584] (-1362.645) (-1365.506) (-1365.577) * (-1364.050) [-1363.501] (-1363.967) (-1362.894) -- 0:00:41
      444000 -- (-1363.633) [-1362.731] (-1364.827) (-1365.355) * (-1368.989) (-1366.315) (-1363.611) [-1367.852] -- 0:00:41
      444500 -- [-1363.707] (-1366.190) (-1362.990) (-1365.516) * [-1362.708] (-1365.035) (-1366.402) (-1368.871) -- 0:00:41
      445000 -- (-1365.730) (-1364.655) [-1363.495] (-1365.448) * [-1363.786] (-1363.360) (-1363.680) (-1367.766) -- 0:00:41

      Average standard deviation of split frequencies: 0.013865

      445500 -- (-1364.416) (-1367.163) [-1364.013] (-1363.124) * (-1363.809) (-1363.733) [-1363.056] (-1365.209) -- 0:00:41
      446000 -- (-1364.987) [-1364.080] (-1362.801) (-1363.416) * [-1363.213] (-1365.553) (-1363.706) (-1362.823) -- 0:00:40
      446500 -- (-1369.700) [-1362.501] (-1367.456) (-1362.503) * [-1363.117] (-1364.945) (-1363.291) (-1362.078) -- 0:00:40
      447000 -- [-1365.003] (-1363.520) (-1369.109) (-1365.800) * (-1365.084) [-1366.936] (-1364.368) (-1362.223) -- 0:00:40
      447500 -- [-1364.759] (-1363.685) (-1364.211) (-1364.489) * (-1364.458) [-1365.309] (-1363.379) (-1366.704) -- 0:00:40
      448000 -- (-1366.352) (-1366.113) (-1363.991) [-1364.828] * (-1366.303) (-1372.572) [-1364.039] (-1365.030) -- 0:00:40
      448500 -- (-1363.338) (-1363.244) [-1363.986] (-1364.244) * [-1365.428] (-1371.127) (-1363.794) (-1364.248) -- 0:00:40
      449000 -- (-1363.194) (-1367.812) [-1364.674] (-1364.179) * (-1365.376) (-1365.437) (-1365.274) [-1363.339] -- 0:00:40
      449500 -- [-1363.503] (-1364.233) (-1363.175) (-1366.201) * (-1365.327) [-1367.435] (-1363.880) (-1362.664) -- 0:00:40
      450000 -- (-1364.338) (-1366.612) (-1365.697) [-1364.009] * (-1366.404) [-1363.041] (-1362.547) (-1365.816) -- 0:00:40

      Average standard deviation of split frequencies: 0.014152

      450500 -- [-1364.122] (-1364.836) (-1364.703) (-1364.317) * (-1364.233) (-1364.241) [-1363.580] (-1364.958) -- 0:00:40
      451000 -- [-1368.101] (-1362.682) (-1365.636) (-1363.732) * (-1364.277) (-1367.880) (-1363.529) [-1363.570] -- 0:00:41
      451500 -- (-1364.335) (-1362.042) (-1364.122) [-1362.584] * (-1365.165) (-1364.655) [-1364.534] (-1364.544) -- 0:00:41
      452000 -- (-1366.224) (-1364.709) (-1364.481) [-1363.468] * (-1364.888) [-1367.516] (-1362.907) (-1366.747) -- 0:00:41
      452500 -- (-1366.414) (-1365.119) [-1367.816] (-1370.418) * [-1367.200] (-1367.407) (-1364.920) (-1363.198) -- 0:00:41
      453000 -- [-1364.587] (-1362.906) (-1365.703) (-1363.360) * (-1363.739) (-1367.496) (-1364.021) [-1363.202] -- 0:00:41
      453500 -- [-1364.021] (-1362.700) (-1365.185) (-1363.715) * (-1364.159) (-1366.139) (-1364.067) [-1365.349] -- 0:00:40
      454000 -- (-1362.954) (-1365.743) (-1371.323) [-1363.132] * (-1364.962) [-1364.446] (-1362.374) (-1366.031) -- 0:00:40
      454500 -- [-1362.574] (-1362.952) (-1368.288) (-1366.924) * (-1365.419) (-1366.087) [-1364.523] (-1365.221) -- 0:00:40
      455000 -- [-1362.397] (-1363.105) (-1364.327) (-1368.158) * (-1365.027) (-1364.570) (-1363.205) [-1363.715] -- 0:00:40

      Average standard deviation of split frequencies: 0.012649

      455500 -- (-1363.388) (-1363.255) (-1364.367) [-1364.621] * (-1364.265) [-1366.023] (-1363.434) (-1364.315) -- 0:00:40
      456000 -- (-1363.686) (-1364.700) [-1362.660] (-1363.223) * (-1362.355) (-1363.834) (-1363.220) [-1364.120] -- 0:00:40
      456500 -- (-1367.525) (-1365.137) (-1366.739) [-1363.160] * (-1369.944) (-1362.948) (-1363.450) [-1363.754] -- 0:00:40
      457000 -- (-1364.679) [-1363.556] (-1368.067) (-1362.923) * (-1367.874) (-1363.838) [-1365.689] (-1364.849) -- 0:00:40
      457500 -- (-1364.572) (-1365.066) [-1365.129] (-1363.482) * [-1368.072] (-1364.444) (-1363.531) (-1364.146) -- 0:00:40
      458000 -- (-1365.231) (-1364.447) [-1363.286] (-1365.575) * (-1368.302) [-1362.817] (-1362.410) (-1365.952) -- 0:00:40
      458500 -- (-1363.774) (-1371.686) (-1365.745) [-1364.294] * (-1365.313) (-1363.651) [-1362.984] (-1362.879) -- 0:00:40
      459000 -- (-1367.235) (-1362.793) [-1364.194] (-1362.199) * (-1366.955) [-1366.850] (-1363.019) (-1364.364) -- 0:00:40
      459500 -- [-1363.271] (-1365.668) (-1363.826) (-1362.262) * (-1363.784) (-1367.915) (-1363.684) [-1364.052] -- 0:00:39
      460000 -- (-1364.278) (-1363.348) [-1363.229] (-1362.255) * (-1365.695) (-1366.311) [-1362.858] (-1364.217) -- 0:00:39

      Average standard deviation of split frequencies: 0.012821

      460500 -- (-1363.151) (-1362.123) (-1364.776) [-1363.948] * (-1365.645) (-1368.043) (-1364.077) [-1363.641] -- 0:00:39
      461000 -- (-1366.835) (-1362.123) (-1366.692) [-1362.761] * (-1366.685) (-1370.177) (-1365.467) [-1363.727] -- 0:00:39
      461500 -- (-1365.274) [-1362.162] (-1367.265) (-1365.951) * (-1367.490) (-1367.662) [-1363.334] (-1364.362) -- 0:00:39
      462000 -- [-1363.027] (-1363.226) (-1367.874) (-1363.031) * [-1363.881] (-1369.291) (-1363.995) (-1365.572) -- 0:00:39
      462500 -- (-1363.149) (-1367.484) (-1365.751) [-1362.401] * (-1363.265) (-1366.329) [-1363.568] (-1365.729) -- 0:00:39
      463000 -- (-1365.390) (-1365.351) (-1364.948) [-1362.911] * (-1362.665) (-1363.353) (-1363.293) [-1365.370] -- 0:00:39
      463500 -- [-1363.043] (-1362.980) (-1362.715) (-1366.184) * (-1362.989) (-1363.847) (-1363.081) [-1365.083] -- 0:00:39
      464000 -- (-1366.680) (-1362.396) (-1363.202) [-1366.569] * (-1362.665) (-1369.577) (-1362.652) [-1364.089] -- 0:00:40
      464500 -- (-1364.672) [-1363.162] (-1362.615) (-1365.843) * (-1364.356) [-1362.757] (-1362.674) (-1364.812) -- 0:00:40
      465000 -- (-1365.329) [-1364.321] (-1365.751) (-1365.532) * [-1364.114] (-1362.545) (-1364.317) (-1366.455) -- 0:00:40

      Average standard deviation of split frequencies: 0.012496

      465500 -- (-1365.834) (-1364.123) [-1362.484] (-1364.997) * (-1363.825) [-1363.093] (-1363.811) (-1361.932) -- 0:00:40
      466000 -- (-1365.382) (-1362.684) (-1363.445) [-1364.479] * (-1363.179) (-1364.740) [-1363.913] (-1362.087) -- 0:00:40
      466500 -- (-1364.309) (-1365.242) [-1366.507] (-1370.564) * (-1364.975) (-1365.426) (-1363.949) [-1363.700] -- 0:00:40
      467000 -- (-1368.288) [-1363.975] (-1362.838) (-1368.596) * (-1364.570) (-1363.421) (-1362.419) [-1363.776] -- 0:00:39
      467500 -- (-1364.633) [-1364.487] (-1364.451) (-1366.860) * (-1362.328) (-1362.997) [-1364.998] (-1365.170) -- 0:00:39
      468000 -- (-1363.698) (-1364.574) (-1365.535) [-1364.809] * (-1363.122) [-1362.362] (-1367.406) (-1363.846) -- 0:00:39
      468500 -- [-1365.059] (-1365.026) (-1362.838) (-1363.862) * (-1363.370) (-1362.713) (-1368.327) [-1362.856] -- 0:00:39
      469000 -- (-1365.598) (-1364.665) (-1364.797) [-1363.866] * (-1364.720) (-1365.059) (-1367.184) [-1363.227] -- 0:00:39
      469500 -- [-1366.359] (-1364.548) (-1364.612) (-1366.743) * (-1362.476) (-1371.541) (-1364.249) [-1363.836] -- 0:00:39
      470000 -- (-1365.521) [-1364.119] (-1364.082) (-1364.619) * (-1362.417) (-1364.125) (-1364.620) [-1362.836] -- 0:00:39

      Average standard deviation of split frequencies: 0.012313

      470500 -- [-1370.949] (-1366.325) (-1362.944) (-1364.201) * (-1362.556) (-1366.466) (-1366.682) [-1363.286] -- 0:00:39
      471000 -- (-1365.871) [-1368.163] (-1362.185) (-1367.274) * [-1364.427] (-1364.561) (-1366.628) (-1362.840) -- 0:00:39
      471500 -- (-1366.732) (-1363.980) (-1366.432) [-1366.325] * (-1369.741) [-1363.630] (-1364.369) (-1363.501) -- 0:00:39
      472000 -- (-1365.609) (-1364.950) [-1362.782] (-1363.337) * [-1363.660] (-1364.583) (-1368.556) (-1363.613) -- 0:00:39
      472500 -- [-1362.416] (-1363.150) (-1363.819) (-1364.526) * (-1363.078) (-1365.734) (-1370.480) [-1363.975] -- 0:00:39
      473000 -- [-1364.966] (-1362.969) (-1364.305) (-1363.055) * (-1364.344) [-1363.383] (-1362.735) (-1363.212) -- 0:00:38
      473500 -- (-1365.348) (-1364.653) (-1364.840) [-1362.264] * [-1362.413] (-1363.561) (-1364.282) (-1362.176) -- 0:00:38
      474000 -- (-1365.629) (-1365.118) (-1363.924) [-1367.556] * (-1362.763) (-1363.419) (-1366.181) [-1362.136] -- 0:00:38
      474500 -- (-1365.214) (-1365.590) (-1363.562) [-1363.353] * (-1364.596) [-1362.743] (-1364.624) (-1365.728) -- 0:00:38
      475000 -- (-1363.460) (-1367.125) (-1364.659) [-1365.181] * (-1367.367) [-1363.475] (-1363.001) (-1367.142) -- 0:00:38

      Average standard deviation of split frequencies: 0.012175

      475500 -- [-1364.438] (-1363.851) (-1365.403) (-1362.325) * (-1364.851) (-1367.252) [-1367.450] (-1369.569) -- 0:00:38
      476000 -- (-1364.490) (-1364.526) (-1362.159) [-1364.244] * (-1363.036) (-1365.211) (-1363.824) [-1367.084] -- 0:00:38
      476500 -- (-1365.587) [-1364.616] (-1363.508) (-1364.712) * (-1363.013) [-1366.494] (-1362.145) (-1366.464) -- 0:00:38
      477000 -- (-1365.101) (-1370.456) (-1364.268) [-1363.203] * [-1363.406] (-1367.558) (-1364.274) (-1364.226) -- 0:00:39
      477500 -- (-1364.882) [-1363.001] (-1362.894) (-1363.844) * (-1366.093) (-1368.956) [-1364.873] (-1364.496) -- 0:00:39
      478000 -- [-1364.949] (-1367.378) (-1363.474) (-1364.065) * (-1365.563) (-1365.322) (-1366.433) [-1365.385] -- 0:00:39
      478500 -- [-1364.046] (-1366.583) (-1365.797) (-1364.678) * [-1363.397] (-1363.013) (-1363.930) (-1365.353) -- 0:00:39
      479000 -- (-1365.855) [-1364.305] (-1365.085) (-1365.542) * (-1364.402) [-1364.125] (-1363.039) (-1363.641) -- 0:00:39
      479500 -- (-1362.998) (-1364.495) (-1365.294) [-1364.233] * (-1365.889) (-1365.160) (-1362.803) [-1363.215] -- 0:00:39
      480000 -- (-1362.823) (-1365.280) [-1363.565] (-1368.087) * (-1364.431) [-1364.621] (-1363.772) (-1363.094) -- 0:00:39

      Average standard deviation of split frequencies: 0.013153

      480500 -- [-1362.439] (-1365.618) (-1364.479) (-1362.822) * (-1362.646) (-1364.340) (-1366.081) [-1366.495] -- 0:00:38
      481000 -- [-1364.602] (-1364.444) (-1366.308) (-1363.076) * (-1364.112) (-1362.775) [-1365.133] (-1365.711) -- 0:00:38
      481500 -- (-1365.460) [-1363.740] (-1362.910) (-1362.929) * (-1364.273) (-1371.904) (-1364.999) [-1368.662] -- 0:00:38
      482000 -- (-1365.391) (-1365.351) (-1362.955) [-1366.293] * [-1370.883] (-1375.995) (-1363.256) (-1363.946) -- 0:00:38
      482500 -- [-1364.696] (-1363.217) (-1365.179) (-1362.722) * (-1373.050) [-1364.894] (-1365.747) (-1365.872) -- 0:00:38
      483000 -- (-1363.057) (-1362.959) (-1365.043) [-1363.287] * (-1373.590) (-1364.110) (-1364.467) [-1365.207] -- 0:00:38
      483500 -- (-1362.713) (-1364.759) (-1365.796) [-1364.030] * (-1362.494) [-1363.585] (-1365.170) (-1365.056) -- 0:00:38
      484000 -- (-1362.877) (-1363.897) [-1366.083] (-1363.241) * (-1362.607) [-1365.640] (-1363.483) (-1365.328) -- 0:00:38
      484500 -- (-1363.240) (-1365.749) [-1363.466] (-1362.933) * [-1363.547] (-1366.253) (-1366.443) (-1363.190) -- 0:00:38
      485000 -- [-1364.203] (-1365.203) (-1367.315) (-1362.833) * (-1363.216) (-1365.496) [-1363.502] (-1366.134) -- 0:00:38

      Average standard deviation of split frequencies: 0.012724

      485500 -- (-1363.775) (-1363.256) (-1362.462) [-1363.533] * (-1363.307) (-1364.043) [-1364.600] (-1362.282) -- 0:00:38
      486000 -- (-1367.544) (-1363.499) [-1363.495] (-1366.585) * [-1364.065] (-1363.756) (-1368.843) (-1362.966) -- 0:00:38
      486500 -- (-1363.969) [-1362.830] (-1364.086) (-1364.212) * (-1367.588) [-1365.256] (-1366.565) (-1366.099) -- 0:00:37
      487000 -- [-1363.941] (-1364.031) (-1366.819) (-1365.370) * (-1364.739) [-1363.117] (-1365.271) (-1365.861) -- 0:00:37
      487500 -- [-1365.564] (-1365.164) (-1368.961) (-1364.145) * (-1364.352) (-1364.740) (-1365.491) [-1364.998] -- 0:00:37
      488000 -- (-1365.727) (-1365.555) [-1363.975] (-1364.801) * (-1366.379) [-1363.594] (-1363.678) (-1368.374) -- 0:00:37
      488500 -- (-1362.964) (-1364.812) (-1364.431) [-1364.000] * [-1364.593] (-1365.287) (-1365.077) (-1364.959) -- 0:00:37
      489000 -- (-1362.993) [-1363.453] (-1367.794) (-1363.158) * (-1364.091) [-1362.695] (-1362.245) (-1366.980) -- 0:00:37
      489500 -- (-1363.984) [-1362.822] (-1365.255) (-1365.187) * (-1366.253) (-1365.524) (-1366.622) [-1363.223] -- 0:00:37
      490000 -- (-1367.954) (-1364.745) [-1362.142] (-1365.445) * (-1365.420) [-1372.252] (-1368.940) (-1365.656) -- 0:00:37

      Average standard deviation of split frequencies: 0.012998

      490500 -- (-1370.055) (-1362.706) [-1362.458] (-1362.520) * (-1365.451) (-1368.132) (-1367.006) [-1366.933] -- 0:00:38
      491000 -- (-1365.473) (-1362.153) [-1364.998] (-1362.523) * (-1365.622) (-1366.795) (-1362.356) [-1364.700] -- 0:00:38
      491500 -- (-1363.973) (-1363.509) [-1364.441] (-1362.475) * (-1363.690) (-1364.216) (-1363.660) [-1363.287] -- 0:00:38
      492000 -- [-1366.768] (-1367.360) (-1368.623) (-1362.493) * [-1365.149] (-1364.853) (-1364.763) (-1366.480) -- 0:00:38
      492500 -- (-1364.562) [-1363.576] (-1365.193) (-1363.142) * (-1367.859) (-1364.559) (-1363.919) [-1364.552] -- 0:00:38
      493000 -- (-1363.508) (-1363.245) [-1366.127] (-1371.931) * (-1365.533) [-1362.990] (-1367.034) (-1364.128) -- 0:00:38
      493500 -- [-1364.069] (-1365.175) (-1364.074) (-1366.320) * (-1364.704) (-1363.750) [-1363.525] (-1372.520) -- 0:00:37
      494000 -- (-1368.072) (-1362.568) (-1366.139) [-1366.062] * (-1365.472) (-1362.960) [-1363.371] (-1365.070) -- 0:00:37
      494500 -- [-1368.258] (-1363.581) (-1365.601) (-1364.869) * [-1362.680] (-1365.048) (-1363.080) (-1364.782) -- 0:00:37
      495000 -- [-1364.215] (-1365.035) (-1363.872) (-1363.139) * (-1362.205) [-1362.224] (-1362.800) (-1364.447) -- 0:00:37

      Average standard deviation of split frequencies: 0.012747

      495500 -- (-1362.516) (-1364.725) (-1363.625) [-1366.042] * (-1362.245) (-1362.685) (-1362.330) [-1369.535] -- 0:00:37
      496000 -- (-1366.589) [-1364.067] (-1365.261) (-1366.295) * (-1362.841) [-1363.559] (-1368.279) (-1371.108) -- 0:00:37
      496500 -- (-1364.337) [-1362.782] (-1363.352) (-1363.357) * (-1363.960) (-1367.752) [-1366.357] (-1365.733) -- 0:00:37
      497000 -- (-1365.961) [-1364.112] (-1363.662) (-1363.799) * (-1363.890) (-1364.915) [-1362.510] (-1364.274) -- 0:00:37
      497500 -- (-1364.849) (-1363.710) [-1363.560] (-1363.890) * [-1364.215] (-1362.104) (-1363.145) (-1367.092) -- 0:00:37
      498000 -- [-1370.207] (-1364.393) (-1363.463) (-1363.783) * (-1362.598) [-1362.409] (-1363.433) (-1363.658) -- 0:00:37
      498500 -- (-1366.846) (-1364.862) [-1362.553] (-1363.589) * (-1363.073) (-1363.409) (-1363.425) [-1362.652] -- 0:00:37
      499000 -- (-1366.818) (-1365.054) (-1362.756) [-1363.968] * [-1363.372] (-1367.526) (-1371.427) (-1363.788) -- 0:00:37
      499500 -- (-1364.250) (-1364.038) (-1362.308) [-1363.639] * (-1364.359) [-1364.801] (-1366.336) (-1363.248) -- 0:00:37
      500000 -- (-1363.941) (-1362.879) (-1362.404) [-1364.025] * (-1364.332) (-1365.570) (-1364.230) [-1363.450] -- 0:00:37

      Average standard deviation of split frequencies: 0.012794

      500500 -- (-1364.550) [-1362.703] (-1366.043) (-1365.401) * [-1363.502] (-1370.049) (-1363.156) (-1363.450) -- 0:00:36
      501000 -- (-1363.970) (-1363.568) (-1365.662) [-1363.975] * (-1363.241) (-1365.218) [-1362.834] (-1363.057) -- 0:00:36
      501500 -- (-1362.710) [-1363.079] (-1364.251) (-1362.367) * (-1363.273) (-1363.123) [-1362.425] (-1365.633) -- 0:00:36
      502000 -- (-1363.282) [-1363.234] (-1363.774) (-1367.813) * [-1362.923] (-1362.766) (-1363.592) (-1365.777) -- 0:00:36
      502500 -- (-1363.697) (-1366.485) [-1365.117] (-1367.172) * (-1365.568) (-1362.951) (-1365.100) [-1365.957] -- 0:00:36
      503000 -- (-1363.970) [-1363.468] (-1364.641) (-1364.917) * (-1366.928) (-1367.375) (-1363.886) [-1365.020] -- 0:00:36
      503500 -- [-1362.611] (-1362.540) (-1366.165) (-1364.453) * (-1366.684) [-1363.968] (-1364.789) (-1363.172) -- 0:00:37
      504000 -- (-1366.280) [-1365.697] (-1365.032) (-1364.665) * (-1364.264) [-1363.954] (-1365.382) (-1363.579) -- 0:00:37
      504500 -- (-1365.341) [-1364.252] (-1364.868) (-1364.408) * (-1366.638) (-1364.158) [-1363.171] (-1364.335) -- 0:00:37
      505000 -- [-1367.081] (-1364.366) (-1370.411) (-1362.720) * (-1365.676) [-1363.695] (-1365.763) (-1374.337) -- 0:00:37

      Average standard deviation of split frequencies: 0.012933

      505500 -- (-1364.294) [-1365.345] (-1365.453) (-1363.309) * (-1366.276) [-1364.231] (-1363.133) (-1369.584) -- 0:00:37
      506000 -- (-1365.830) [-1363.052] (-1364.916) (-1363.441) * [-1364.959] (-1362.743) (-1363.567) (-1366.725) -- 0:00:37
      506500 -- [-1364.406] (-1365.971) (-1363.558) (-1364.172) * (-1363.277) (-1362.759) (-1364.198) [-1363.876] -- 0:00:37
      507000 -- [-1363.082] (-1368.307) (-1363.132) (-1366.306) * (-1362.604) (-1362.741) (-1363.765) [-1364.371] -- 0:00:36
      507500 -- (-1363.467) (-1367.009) [-1364.344] (-1365.929) * (-1362.917) [-1364.807] (-1363.315) (-1363.188) -- 0:00:36
      508000 -- (-1364.377) (-1364.992) [-1363.135] (-1364.701) * (-1364.222) (-1364.950) (-1364.042) [-1364.550] -- 0:00:36
      508500 -- [-1364.922] (-1363.710) (-1362.599) (-1363.588) * (-1368.029) (-1363.254) (-1365.100) [-1366.598] -- 0:00:36
      509000 -- (-1362.990) (-1363.753) (-