--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1212.27 -1218.77
2 -1212.12 -1216.37
--------------------------------------
TOTAL -1212.20 -1218.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 6.475232 78.548632 0.000010 25.627120 2.927722 40.88 66.29 1.002
r(A<->C){all} 0.164363 0.018219 0.000174 0.427855 0.131176 101.22 127.53 1.002
r(A<->G){all} 0.146867 0.016004 0.000045 0.404462 0.114653 69.08 133.82 1.000
r(A<->T){all} 0.147184 0.015947 0.000057 0.397870 0.112353 161.78 164.79 1.001
r(C<->G){all} 0.165770 0.019431 0.000034 0.450929 0.129907 132.72 155.82 1.000
r(C<->T){all} 0.166034 0.019519 0.000076 0.436496 0.129687 35.25 106.76 1.009
r(G<->T){all} 0.209783 0.025295 0.000048 0.520336 0.172740 76.55 79.56 1.004
pi(A){all} 0.291395 0.000230 0.260810 0.319845 0.291325 663.93 916.33 1.000
pi(C){all} 0.146830 0.000141 0.124085 0.170177 0.146535 1033.01 1056.76 1.000
pi(G){all} 0.206520 0.000175 0.179966 0.230575 0.206547 1089.49 1150.86 1.001
pi(T){all} 0.355255 0.000244 0.323334 0.384207 0.355431 1071.27 1156.70 1.000
alpha{1,2} 0.902051 0.920939 0.000659 2.780874 0.588855 699.35 917.23 1.001
alpha{3} 0.913965 0.973764 0.000068 2.900909 0.586969 926.56 1074.92 1.002
pinvar{all} 0.871093 0.055449 0.319857 0.999893 0.996366 10.58 14.43 1.011
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -1155.948637
Model 2: PositiveSelection -1155.851655
Model 7: beta -1155.948637
Model 8: beta&w>1 -1155.850930
Model 2 vs 1 .193964
Model 8 vs 7 .195414
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=300
C1 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C3 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C4 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
C1 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C3 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C4 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
C1 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
C2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C3 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C4 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
C1 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C3 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C4 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
C1 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C3 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C4 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
C1 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C3 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C4 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
-- Starting log on Fri Oct 21 22:39:04 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.06 sec, SCORE=1000, Nseq=4, Len=300
C1 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C3 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C4 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
C1 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C3 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C4 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
C1 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
C2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C3 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C4 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
C1 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C3 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C4 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
C1 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C3 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C4 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
C1 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C3 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C4 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
-- Starting log on Fri Oct 21 22:51:36 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/gapped_alignment/codeml,HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 900 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666392698
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 255988915
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8647129146
Seed = 1635906739
Swapseed = 1666392698
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.00 % Dirichlet(Revmat{all})
1.00 % Slider(Revmat{all})
1.00 % Dirichlet(Pi{all})
1.00 % Slider(Pi{all})
2.00 % Multiplier(Alpha{1,2})
2.00 % Multiplier(Alpha{3})
2.00 % Slider(Pinvar{all})
10.00 % ExtSPR(Tau{all},V{all})
10.00 % NNI(Tau{all},V{all})
10.00 % ParsSPR(Tau{all},V{all})
40.00 % Multiplier(V{all})
14.00 % Nodeslider(V{all})
6.00 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1339.015684 -- 13.556448
Chain 2 -- -1339.015684 -- 13.556448
Chain 3 -- -1339.015684 -- 13.556448
Chain 4 -- -1339.015684 -- 13.556448
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1339.015684 -- 13.556448
Chain 2 -- -1339.015684 -- 13.556448
Chain 3 -- -1339.015684 -- 13.556448
Chain 4 -- -1339.015684 -- 13.556448
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1339.016] (-1339.016) (-1339.016) (-1339.016) * [-1339.016] (-1339.016) (-1339.016) (-1339.016)
1000 -- (-1228.034) (-1213.139) (-1227.618) [-1218.724] * (-1221.060) [-1213.318] (-1215.128) (-1223.262) -- 0:00:00
2000 -- (-1214.486) (-1213.676) [-1211.332] (-1211.791) * (-1212.464) [-1209.897] (-1213.070) (-1215.346) -- 0:00:00
3000 -- (-1213.924) [-1211.498] (-1213.509) (-1211.934) * (-1217.752) [-1215.622] (-1212.506) (-1211.440) -- 0:05:32
4000 -- (-1212.732) [-1211.961] (-1214.210) (-1211.139) * (-1211.934) (-1213.183) (-1222.657) [-1211.069] -- 0:04:09
5000 -- [-1213.185] (-1212.349) (-1211.709) (-1211.622) * (-1214.089) (-1213.745) (-1210.710) [-1211.134] -- 0:03:19
Average standard deviation of split frequencies: 0.157135
6000 -- (-1212.509) (-1211.099) [-1215.930] (-1214.167) * [-1212.007] (-1213.473) (-1220.027) (-1212.726) -- 0:02:45
7000 -- (-1214.454) [-1211.952] (-1212.873) (-1209.978) * (-1213.045) (-1211.811) [-1212.082] (-1213.855) -- 0:02:21
8000 -- (-1211.958) [-1212.686] (-1210.635) (-1212.846) * (-1211.043) (-1211.154) [-1211.759] (-1216.950) -- 0:02:04
9000 -- [-1210.667] (-1216.284) (-1212.675) (-1211.231) * (-1211.525) (-1213.416) [-1213.607] (-1213.348) -- 0:01:50
10000 -- [-1213.428] (-1214.386) (-1219.362) (-1209.999) * (-1210.867) [-1213.768] (-1213.552) (-1213.627) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
11000 -- (-1213.118) (-1212.984) [-1211.142] (-1213.967) * (-1210.945) [-1211.565] (-1212.846) (-1212.871) -- 0:01:29
12000 -- [-1211.190] (-1212.750) (-1214.743) (-1210.546) * (-1213.587) (-1211.871) (-1214.551) [-1210.852] -- 0:01:22
13000 -- (-1212.183) (-1211.387) (-1214.165) [-1209.849] * (-1215.928) [-1212.303] (-1214.139) (-1211.870) -- 0:02:31
14000 -- [-1213.270] (-1211.765) (-1212.165) (-1210.418) * (-1211.536) (-1213.598) [-1211.465] (-1213.222) -- 0:02:20
15000 -- (-1215.606) [-1210.706] (-1210.851) (-1211.011) * (-1212.999) [-1210.235] (-1212.269) (-1217.776) -- 0:02:11
Average standard deviation of split frequencies: 0.058926
16000 -- (-1214.587) (-1210.443) [-1210.967] (-1211.786) * [-1214.095] (-1212.197) (-1210.413) (-1210.775) -- 0:02:03
17000 -- (-1213.828) [-1211.513] (-1211.579) (-1214.013) * (-1213.174) (-1211.331) [-1213.540] (-1211.732) -- 0:01:55
18000 -- (-1214.159) (-1210.527) (-1214.464) [-1211.722] * (-1211.553) (-1211.176) [-1210.250] (-1217.794) -- 0:01:49
19000 -- [-1215.002] (-1211.714) (-1212.509) (-1213.366) * (-1210.955) (-1213.761) [-1211.956] (-1214.472) -- 0:01:43
20000 -- (-1213.478) (-1213.234) [-1211.786] (-1211.846) * [-1215.184] (-1214.118) (-1210.804) (-1214.937) -- 0:01:38
Average standard deviation of split frequencies: 0.076033
21000 -- (-1211.967) (-1215.204) [-1213.111] (-1211.030) * (-1214.595) (-1210.233) [-1211.077] (-1214.472) -- 0:01:33
22000 -- (-1212.435) (-1215.050) (-1212.404) [-1212.042] * (-1214.541) [-1210.059] (-1211.710) (-1211.441) -- 0:01:28
23000 -- [-1209.517] (-1213.930) (-1210.422) (-1210.264) * [-1212.132] (-1212.514) (-1210.897) (-1216.031) -- 0:01:24
24000 -- (-1210.027) (-1213.896) (-1216.107) [-1213.253] * (-1212.383) (-1212.145) (-1211.506) [-1215.595] -- 0:02:02
25000 -- (-1212.217) (-1216.510) [-1215.307] (-1212.194) * (-1213.060) [-1212.401] (-1213.515) (-1212.872) -- 0:01:57
Average standard deviation of split frequencies: 0.060436
26000 -- (-1217.070) (-1218.037) (-1223.888) [-1211.091] * (-1212.182) (-1212.648) [-1210.300] (-1214.370) -- 0:01:52
27000 -- (-1213.522) (-1213.207) [-1211.830] (-1213.384) * [-1210.198] (-1212.100) (-1214.462) (-1212.355) -- 0:01:48
28000 -- (-1211.977) (-1216.559) [-1212.046] (-1216.633) * (-1212.677) (-1213.602) [-1215.305] (-1217.489) -- 0:01:44
29000 -- [-1214.113] (-1215.969) (-1216.627) (-1211.517) * (-1212.013) [-1212.433] (-1213.015) (-1212.810) -- 0:01:40
30000 -- (-1212.493) (-1219.225) (-1213.097) [-1214.548] * (-1215.507) (-1213.840) [-1210.770] (-1213.966) -- 0:01:37
Average standard deviation of split frequencies: 0.040992
31000 -- (-1220.201) (-1212.751) [-1212.497] (-1211.818) * [-1211.047] (-1215.217) (-1212.281) (-1215.607) -- 0:01:33
32000 -- [-1211.269] (-1215.557) (-1214.644) (-1215.679) * (-1212.356) [-1212.416] (-1211.552) (-1211.852) -- 0:01:30
33000 -- (-1213.099) (-1214.931) [-1212.279] (-1212.462) * (-1211.155) (-1212.627) (-1210.161) [-1214.236] -- 0:01:27
34000 -- [-1210.632] (-1221.357) (-1212.436) (-1212.223) * (-1214.314) (-1211.776) [-1211.407] (-1213.197) -- 0:01:25
35000 -- [-1210.745] (-1216.781) (-1221.596) (-1213.517) * (-1213.234) (-1211.738) [-1211.804] (-1212.216) -- 0:01:50
Average standard deviation of split frequencies: 0.061108
36000 -- (-1209.678) (-1215.680) (-1216.828) [-1212.787] * (-1214.240) (-1212.347) [-1210.718] (-1214.100) -- 0:01:47
37000 -- [-1211.108] (-1213.834) (-1219.619) (-1216.380) * (-1210.502) [-1213.020] (-1209.761) (-1214.336) -- 0:01:44
38000 -- (-1211.343) (-1212.577) (-1213.901) [-1211.449] * (-1213.176) (-1213.421) [-1212.084] (-1214.217) -- 0:01:41
39000 -- [-1210.282] (-1217.638) (-1214.279) (-1212.599) * [-1214.470] (-1211.824) (-1215.478) (-1216.871) -- 0:01:38
40000 -- (-1211.109) (-1216.322) (-1212.649) [-1215.339] * [-1211.860] (-1211.863) (-1212.326) (-1216.753) -- 0:01:36
Average standard deviation of split frequencies: 0.054096
41000 -- [-1210.635] (-1215.254) (-1218.802) (-1213.355) * (-1211.019) [-1210.630] (-1215.263) (-1216.299) -- 0:01:33
42000 -- [-1214.031] (-1217.055) (-1218.137) (-1213.800) * (-1214.554) (-1213.797) (-1217.506) [-1211.029] -- 0:01:31
43000 -- (-1213.501) (-1216.499) (-1218.262) [-1212.953] * (-1217.643) [-1211.990] (-1214.500) (-1210.581) -- 0:01:29
44000 -- [-1213.124] (-1214.179) (-1219.108) (-1213.117) * (-1211.442) (-1211.607) (-1213.394) [-1211.488] -- 0:01:26
45000 -- (-1214.126) (-1215.051) (-1216.523) [-1210.908] * (-1211.949) (-1210.854) (-1214.027) [-1212.352] -- 0:01:24
Average standard deviation of split frequencies: 0.047824
46000 -- (-1213.282) (-1214.109) (-1219.699) [-1211.281] * [-1215.512] (-1212.439) (-1213.113) (-1212.305) -- 0:01:43
47000 -- (-1212.506) (-1216.972) (-1220.014) [-1212.194] * [-1212.114] (-1212.140) (-1215.761) (-1215.938) -- 0:01:41
48000 -- [-1211.835] (-1216.239) (-1213.754) (-1212.026) * (-1210.883) (-1213.961) (-1214.878) [-1213.828] -- 0:01:39
49000 -- (-1215.131) (-1215.235) (-1215.499) [-1214.316] * (-1210.212) (-1211.075) (-1219.209) [-1214.619] -- 0:01:37
50000 -- (-1211.901) (-1214.148) (-1213.821) [-1211.622] * (-1211.079) [-1213.156] (-1214.505) (-1210.921) -- 0:01:35
Average standard deviation of split frequencies: 0.031013
51000 -- (-1215.169) (-1213.766) (-1213.027) [-1216.690] * [-1210.897] (-1212.859) (-1220.327) (-1214.177) -- 0:01:33
52000 -- (-1211.736) (-1214.708) (-1217.711) [-1214.424] * (-1211.514) (-1211.723) (-1214.098) [-1211.334] -- 0:01:31
53000 -- [-1212.325] (-1215.329) (-1215.016) (-1212.063) * [-1210.543] (-1212.096) (-1214.933) (-1215.406) -- 0:01:29
54000 -- [-1211.670] (-1214.617) (-1215.513) (-1212.479) * [-1210.903] (-1218.400) (-1215.193) (-1212.441) -- 0:01:27
55000 -- [-1212.232] (-1215.411) (-1215.355) (-1211.287) * (-1212.239) (-1212.208) (-1221.191) [-1211.848] -- 0:01:25
Average standard deviation of split frequencies: 0.033672
56000 -- [-1210.772] (-1215.278) (-1213.522) (-1210.630) * [-1210.328] (-1210.741) (-1213.740) (-1217.010) -- 0:01:24
57000 -- (-1214.908) (-1217.596) (-1216.019) [-1214.960] * [-1209.520] (-1214.699) (-1213.580) (-1215.487) -- 0:01:39
58000 -- (-1212.531) (-1213.715) (-1215.643) [-1214.410] * (-1215.434) (-1213.692) (-1216.698) [-1213.894] -- 0:01:37
59000 -- (-1214.331) (-1215.889) (-1213.284) [-1212.491] * (-1211.845) (-1215.096) (-1215.077) [-1211.345] -- 0:01:35
60000 -- (-1214.890) (-1218.250) (-1214.141) [-1211.123] * (-1212.782) [-1212.536] (-1214.676) (-1214.027) -- 0:01:34
Average standard deviation of split frequencies: 0.036262
61000 -- [-1211.626] (-1213.964) (-1215.434) (-1210.308) * (-1213.635) (-1217.446) (-1215.372) [-1210.921] -- 0:01:32
62000 -- (-1210.613) (-1213.878) (-1214.985) [-1212.798] * [-1211.420] (-1213.948) (-1216.767) (-1213.172) -- 0:01:30
63000 -- [-1212.414] (-1214.742) (-1213.137) (-1213.656) * [-1213.819] (-1215.051) (-1219.778) (-1212.103) -- 0:01:29
64000 -- [-1212.265] (-1212.782) (-1217.108) (-1217.724) * [-1213.374] (-1215.840) (-1214.797) (-1211.427) -- 0:01:27
65000 -- [-1215.308] (-1213.491) (-1217.450) (-1215.473) * (-1211.865) [-1210.827] (-1212.918) (-1215.110) -- 0:01:26
Average standard deviation of split frequencies: 0.023808
66000 -- [-1212.019] (-1216.411) (-1216.734) (-1213.486) * [-1213.233] (-1214.141) (-1214.969) (-1216.362) -- 0:01:24
67000 -- (-1213.550) (-1213.887) (-1216.809) [-1213.896] * (-1211.822) [-1210.837] (-1213.591) (-1217.573) -- 0:01:23
68000 -- (-1215.084) (-1214.785) (-1214.721) [-1212.720] * (-1214.826) [-1212.855] (-1213.686) (-1213.306) -- 0:01:35
69000 -- (-1218.655) (-1216.284) (-1216.555) [-1211.686] * [-1211.226] (-1216.041) (-1214.058) (-1215.649) -- 0:01:34
70000 -- (-1215.047) (-1213.867) (-1216.361) [-1209.870] * (-1212.197) [-1211.249] (-1215.817) (-1217.008) -- 0:01:33
Average standard deviation of split frequencies: 0.026683
71000 -- (-1214.423) (-1215.895) (-1213.866) [-1212.928] * [-1212.160] (-1210.652) (-1214.798) (-1212.575) -- 0:01:31
72000 -- (-1212.766) (-1215.176) (-1216.505) [-1211.203] * [-1210.198] (-1213.048) (-1212.775) (-1214.083) -- 0:01:30
73000 -- (-1214.703) (-1215.329) (-1215.916) [-1212.575] * (-1211.935) [-1210.514] (-1218.280) (-1216.083) -- 0:01:28
74000 -- (-1215.302) (-1215.406) (-1215.417) [-1213.183] * [-1212.406] (-1215.474) (-1214.111) (-1212.290) -- 0:01:27
75000 -- (-1216.304) (-1218.085) (-1216.506) [-1213.975] * [-1212.319] (-1213.134) (-1213.914) (-1212.799) -- 0:01:26
Average standard deviation of split frequencies: 0.024811
76000 -- (-1215.531) (-1218.237) [-1217.048] (-1209.218) * (-1212.639) [-1212.761] (-1212.556) (-1214.336) -- 0:01:25
77000 -- (-1214.609) (-1214.965) (-1213.240) [-1215.916] * (-1211.892) [-1213.487] (-1212.976) (-1214.977) -- 0:01:23
78000 -- (-1215.273) (-1212.976) (-1213.260) [-1212.068] * [-1213.411] (-1211.837) (-1213.687) (-1217.305) -- 0:01:22
79000 -- (-1212.716) (-1216.203) (-1213.195) [-1210.432] * [-1212.334] (-1213.713) (-1214.128) (-1213.547) -- 0:01:21
80000 -- (-1212.571) (-1213.387) (-1214.655) [-1211.369] * [-1213.065] (-1213.520) (-1212.661) (-1213.266) -- 0:01:32
Average standard deviation of split frequencies: 0.038959
81000 -- (-1212.698) (-1214.058) (-1215.477) [-1212.864] * (-1215.465) (-1213.436) [-1213.458] (-1212.227) -- 0:01:30
82000 -- (-1214.153) (-1215.751) (-1214.023) [-1215.115] * [-1210.835] (-1215.005) (-1214.803) (-1218.596) -- 0:01:29
83000 -- (-1215.470) (-1214.164) (-1213.986) [-1212.944] * [-1212.464] (-1216.593) (-1216.313) (-1218.040) -- 0:01:28
84000 -- (-1215.293) (-1214.104) (-1214.907) [-1210.080] * [-1210.321] (-1214.718) (-1212.618) (-1213.224) -- 0:01:27
85000 -- (-1214.237) (-1213.803) (-1214.932) [-1211.785] * [-1210.350] (-1213.923) (-1218.216) (-1213.955) -- 0:01:26
Average standard deviation of split frequencies: 0.036543
86000 -- (-1213.431) (-1213.315) (-1215.299) [-1211.754] * [-1218.028] (-1213.567) (-1214.468) (-1215.278) -- 0:01:25
87000 -- (-1214.169) (-1212.959) (-1214.002) [-1210.972] * [-1215.292] (-1214.219) (-1214.417) (-1212.925) -- 0:01:23
88000 -- (-1214.596) (-1218.041) (-1219.053) [-1210.373] * [-1210.536] (-1215.489) (-1213.778) (-1214.510) -- 0:01:22
89000 -- (-1214.705) (-1220.366) (-1213.590) [-1212.378] * [-1212.053] (-1215.206) (-1214.354) (-1217.501) -- 0:01:21
90000 -- (-1215.130) (-1214.454) (-1217.410) [-1215.846] * [-1212.962] (-1213.367) (-1216.268) (-1214.151) -- 0:01:20
Average standard deviation of split frequencies: 0.034662
91000 -- (-1215.040) (-1215.781) (-1213.583) [-1211.309] * [-1210.932] (-1214.024) (-1213.974) (-1215.226) -- 0:01:19
92000 -- (-1216.064) (-1216.006) (-1215.005) [-1211.779] * [-1209.595] (-1215.486) (-1215.329) (-1212.936) -- 0:01:28
93000 -- (-1214.435) (-1214.129) (-1213.291) [-1210.542] * [-1212.535] (-1213.780) (-1213.551) (-1216.394) -- 0:01:27
94000 -- (-1213.197) (-1214.893) (-1213.706) [-1209.970] * [-1212.318] (-1214.342) (-1217.119) (-1215.140) -- 0:01:26
95000 -- [-1214.907] (-1214.792) (-1213.541) (-1212.776) * [-1210.402] (-1215.385) (-1217.096) (-1214.806) -- 0:01:25
Average standard deviation of split frequencies: 0.026189
96000 -- (-1213.424) (-1216.843) (-1214.103) [-1212.137] * [-1211.772] (-1213.808) (-1214.466) (-1214.067) -- 0:01:24
97000 -- (-1216.603) (-1217.475) (-1216.917) [-1209.292] * [-1211.265] (-1215.711) (-1220.578) (-1212.514) -- 0:01:23
98000 -- (-1213.587) (-1217.453) (-1214.978) [-1212.613] * [-1210.371] (-1215.228) (-1213.624) (-1217.604) -- 0:01:22
99000 -- (-1213.602) (-1214.373) (-1217.259) [-1210.928] * [-1210.748] (-1215.923) (-1215.134) (-1215.931) -- 0:01:21
100000 -- (-1217.693) (-1215.010) (-1217.392) [-1211.872] * [-1210.787] (-1214.557) (-1214.727) (-1214.470) -- 0:01:21
Average standard deviation of split frequencies: 0.018731
101000 -- (-1213.811) (-1213.629) (-1217.469) [-1210.078] * [-1213.112] (-1217.169) (-1213.788) (-1216.137) -- 0:01:20
102000 -- (-1215.828) (-1222.028) (-1215.446) [-1211.039] * [-1211.590] (-1213.329) (-1214.730) (-1216.534) -- 0:01:19
103000 -- (-1218.849) (-1215.538) (-1213.406) [-1210.106] * [-1215.224] (-1216.865) (-1213.912) (-1213.747) -- 0:01:18
104000 -- (-1212.803) (-1215.874) (-1214.169) [-1212.339] * [-1211.504] (-1213.508) (-1213.450) (-1214.606) -- 0:01:26
105000 -- (-1213.588) (-1214.119) (-1213.297) [-1209.830] * [-1210.508] (-1218.852) (-1219.222) (-1215.607) -- 0:01:25
Average standard deviation of split frequencies: 0.029648
106000 -- (-1213.540) (-1214.647) (-1214.065) [-1209.182] * [-1214.298] (-1213.653) (-1214.330) (-1212.779) -- 0:01:24
107000 -- (-1213.787) (-1214.189) (-1217.405) [-1211.194] * (-1212.382) (-1213.805) (-1212.800) [-1213.130] -- 0:01:23
108000 -- (-1213.059) (-1214.525) (-1215.795) [-1210.206] * [-1209.991] (-1216.580) (-1216.716) (-1213.912) -- 0:01:22
109000 -- (-1213.497) (-1213.428) (-1216.094) [-1209.820] * [-1212.785] (-1215.250) (-1213.801) (-1213.743) -- 0:01:21
110000 -- (-1214.542) (-1212.943) (-1217.004) [-1210.158] * [-1212.446] (-1214.321) (-1212.956) (-1213.021) -- 0:01:20
Average standard deviation of split frequencies: 0.042597
111000 -- (-1215.525) (-1216.617) (-1213.355) [-1210.407] * [-1212.020] (-1213.757) (-1212.865) (-1213.280) -- 0:01:20
112000 -- (-1216.005) (-1213.711) (-1215.391) [-1210.063] * [-1212.283] (-1213.861) (-1212.953) (-1214.080) -- 0:01:19
113000 -- (-1214.323) (-1212.640) (-1213.225) [-1216.158] * [-1210.979] (-1214.270) (-1217.395) (-1213.193) -- 0:01:18
114000 -- (-1213.263) [-1214.523] (-1214.274) (-1214.578) * [-1212.244] (-1214.116) (-1216.663) (-1214.363) -- 0:01:17
115000 -- (-1213.570) (-1216.781) (-1213.329) [-1214.117] * [-1211.361] (-1212.723) (-1213.919) (-1213.286) -- 0:01:16
Average standard deviation of split frequencies: 0.029801
116000 -- (-1215.027) (-1218.868) (-1213.724) [-1211.024] * [-1210.016] (-1218.693) (-1215.897) (-1215.279) -- 0:01:23
117000 -- (-1214.015) (-1213.741) (-1214.680) [-1210.752] * [-1210.809] (-1217.243) (-1215.227) (-1213.736) -- 0:01:23
118000 -- (-1213.131) (-1219.438) (-1216.767) [-1212.909] * [-1211.747] (-1212.356) (-1214.696) (-1215.202) -- 0:01:22
119000 -- (-1214.521) (-1214.821) (-1215.103) [-1210.413] * [-1210.316] (-1214.620) (-1214.020) (-1213.306) -- 0:01:21
120000 -- (-1212.931) (-1214.256) (-1213.344) [-1210.123] * [-1209.486] (-1212.913) (-1216.074) (-1214.637) -- 0:01:20
Average standard deviation of split frequencies: 0.026044
121000 -- (-1214.384) (-1216.220) (-1215.700) [-1210.013] * [-1210.228] (-1212.551) (-1219.682) (-1212.717) -- 0:01:19
122000 -- (-1213.727) (-1213.570) (-1214.023) [-1209.742] * [-1210.025] (-1215.764) (-1215.527) (-1215.249) -- 0:01:19
123000 -- (-1218.263) (-1215.778) (-1214.562) [-1210.990] * [-1209.257] (-1213.635) (-1213.797) (-1214.585) -- 0:01:18
124000 -- (-1216.438) (-1216.353) (-1215.486) [-1209.950] * [-1212.228] (-1213.428) (-1217.582) (-1213.835) -- 0:01:17
125000 -- (-1213.991) [-1213.026] (-1213.424) (-1212.204) * [-1215.314] (-1213.965) (-1213.515) (-1213.085) -- 0:01:17
Average standard deviation of split frequencies: 0.027436
126000 -- (-1214.376) (-1216.496) (-1214.397) [-1210.903] * [-1210.873] (-1218.124) (-1213.738) (-1213.407) -- 0:01:16
127000 -- (-1213.076) (-1213.716) (-1218.031) [-1211.374] * [-1210.253] (-1216.192) (-1213.623) (-1222.152) -- 0:01:15
128000 -- (-1214.847) (-1215.161) (-1214.384) [-1211.867] * (-1211.577) [-1214.822] (-1213.740) (-1213.495) -- 0:01:14
129000 -- (-1212.851) (-1214.313) (-1212.781) [-1208.944] * [-1211.366] (-1213.146) (-1215.096) (-1215.660) -- 0:01:21
130000 -- (-1217.266) (-1213.369) (-1214.074) [-1212.553] * [-1212.685] (-1214.993) (-1215.192) (-1215.289) -- 0:01:20
Average standard deviation of split frequencies: 0.026456
131000 -- (-1212.690) (-1214.750) (-1214.262) [-1211.454] * [-1211.518] (-1214.101) (-1213.151) (-1214.579) -- 0:01:19
132000 -- (-1217.377) (-1215.162) (-1213.514) [-1208.293] * [-1212.762] (-1215.029) (-1219.065) (-1216.059) -- 0:01:18
133000 -- (-1214.595) (-1217.133) (-1216.183) [-1212.228] * (-1217.769) (-1215.601) (-1214.387) [-1216.032] -- 0:01:18
134000 -- (-1213.142) (-1213.775) (-1219.635) [-1209.864] * (-1219.625) [-1217.953] (-1213.175) (-1215.596) -- 0:01:17
135000 -- (-1214.165) (-1213.225) (-1217.165) [-1210.362] * [-1215.583] (-1213.913) (-1213.793) (-1213.678) -- 0:01:16
Average standard deviation of split frequencies: 0.027730
136000 -- (-1217.759) (-1213.387) (-1215.259) [-1213.560] * [-1215.887] (-1214.117) (-1214.992) (-1214.523) -- 0:01:16
137000 -- (-1214.226) (-1214.541) (-1213.708) [-1211.088] * [-1214.161] (-1214.468) (-1216.920) (-1214.277) -- 0:01:15
138000 -- (-1213.647) [-1214.571] (-1214.383) (-1217.179) * (-1218.999) (-1214.811) [-1214.608] (-1217.321) -- 0:01:14
139000 -- (-1213.931) [-1215.523] (-1218.513) (-1213.746) * [-1213.950] (-1213.359) (-1213.551) (-1212.841) -- 0:01:14
140000 -- (-1217.046) [-1216.397] (-1218.301) (-1214.742) * (-1215.076) [-1212.887] (-1215.577) (-1215.216) -- 0:01:13
Average standard deviation of split frequencies: 0.026810
141000 -- (-1215.481) (-1213.871) (-1213.945) [-1213.585] * (-1213.787) (-1212.689) (-1217.707) [-1212.517] -- 0:01:19
142000 -- [-1214.551] (-1214.490) (-1216.328) (-1213.081) * (-1213.717) (-1214.298) (-1216.120) [-1213.759] -- 0:01:18
143000 -- [-1215.459] (-1213.573) (-1215.060) (-1214.799) * (-1215.620) (-1213.904) (-1216.311) [-1218.409] -- 0:01:17
144000 -- (-1213.670) (-1213.017) [-1215.014] (-1213.289) * (-1221.636) [-1213.903] (-1214.008) (-1213.186) -- 0:01:17
145000 -- (-1218.434) (-1213.043) (-1215.420) [-1212.808] * (-1214.614) (-1213.516) (-1215.573) [-1214.043] -- 0:01:16
Average standard deviation of split frequencies: 0.032288
146000 -- (-1216.452) (-1213.661) (-1217.391) [-1213.581] * (-1213.380) [-1214.431] (-1214.288) (-1218.803) -- 0:01:16
147000 -- (-1215.800) (-1213.317) [-1212.057] (-1212.595) * (-1219.538) (-1216.431) [-1214.562] (-1213.578) -- 0:01:15
148000 -- (-1215.923) [-1218.547] (-1213.321) (-1218.400) * [-1214.624] (-1215.245) (-1213.729) (-1219.183) -- 0:01:14
149000 -- (-1214.796) [-1214.317] (-1215.227) (-1213.421) * (-1214.262) (-1214.420) (-1213.317) [-1213.906] -- 0:01:14
150000 -- [-1216.109] (-1212.662) (-1213.857) (-1215.792) * (-1214.521) (-1214.889) [-1213.317] (-1214.609) -- 0:01:13
Average standard deviation of split frequencies: 0.022944
151000 -- (-1213.603) (-1212.941) [-1214.760] (-1213.457) * (-1214.043) (-1215.436) [-1215.440] (-1215.516) -- 0:01:13
152000 -- (-1215.442) (-1216.334) [-1214.711] (-1213.601) * (-1216.001) (-1217.171) (-1218.127) [-1214.065] -- 0:01:12
153000 -- (-1218.952) [-1214.979] (-1214.695) (-1213.542) * [-1214.114] (-1213.912) (-1214.965) (-1215.297) -- 0:01:11
154000 -- [-1214.639] (-1216.217) (-1212.975) (-1216.758) * (-1217.621) (-1215.691) (-1216.896) [-1213.609] -- 0:01:16
155000 -- (-1215.607) [-1216.251] (-1213.810) (-1213.232) * (-1216.539) (-1221.885) (-1214.487) [-1214.346] -- 0:01:16
Average standard deviation of split frequencies: 0.026189
156000 -- (-1215.907) (-1214.631) [-1215.689] (-1215.990) * (-1218.595) [-1216.460] (-1213.708) (-1215.963) -- 0:01:15
157000 -- (-1214.367) [-1213.102] (-1215.360) (-1214.274) * (-1214.043) [-1212.755] (-1213.909) (-1213.645) -- 0:01:15
158000 -- [-1213.928] (-1212.738) (-1215.128) (-1214.174) * [-1213.610] (-1212.679) (-1218.399) (-1215.909) -- 0:01:14
159000 -- (-1213.473) (-1214.679) [-1214.167] (-1213.601) * [-1215.748] (-1213.182) (-1213.707) (-1219.965) -- 0:01:14
160000 -- (-1214.345) (-1213.379) (-1214.201) [-1212.336] * (-1213.318) [-1213.754] (-1220.449) (-1216.646) -- 0:01:13
Average standard deviation of split frequencies: 0.025428
161000 -- [-1213.141] (-1217.307) (-1213.571) (-1214.210) * (-1213.153) (-1215.092) [-1213.502] (-1216.091) -- 0:01:12
162000 -- [-1216.355] (-1211.835) (-1217.259) (-1215.820) * [-1215.081] (-1213.285) (-1217.997) (-1216.333) -- 0:01:12
163000 -- [-1214.043] (-1212.688) (-1213.699) (-1213.225) * (-1215.048) [-1214.728] (-1214.785) (-1214.425) -- 0:01:11
164000 -- (-1213.612) (-1213.925) [-1213.038] (-1213.208) * [-1215.755] (-1214.942) (-1216.154) (-1214.250) -- 0:01:11
165000 -- (-1214.396) [-1214.607] (-1220.074) (-1214.039) * [-1214.298] (-1213.465) (-1221.146) (-1212.956) -- 0:01:10
Average standard deviation of split frequencies: 0.028398
166000 -- (-1213.984) [-1216.594] (-1216.193) (-1215.292) * (-1212.729) (-1217.615) (-1213.977) [-1216.905] -- 0:01:10
167000 -- (-1214.393) (-1214.018) (-1214.602) [-1214.783] * (-1215.557) [-1218.172] (-1212.974) (-1213.598) -- 0:01:14
168000 -- [-1216.536] (-1214.450) (-1215.418) (-1214.116) * [-1213.631] (-1214.820) (-1214.687) (-1217.689) -- 0:01:14
169000 -- (-1213.161) [-1214.888] (-1212.300) (-1214.524) * (-1215.597) (-1219.516) [-1217.194] (-1216.398) -- 0:01:13
170000 -- [-1214.865] (-1214.343) (-1215.078) (-1218.902) * (-1212.588) [-1214.469] (-1216.481) (-1217.023) -- 0:01:13
Average standard deviation of split frequencies: 0.033146
171000 -- (-1213.032) (-1214.493) (-1215.126) [-1213.303] * (-1218.355) [-1218.195] (-1213.160) (-1216.011) -- 0:01:12
172000 -- [-1212.775] (-1213.887) (-1215.282) (-1215.067) * (-1213.910) (-1215.011) [-1213.031] (-1213.275) -- 0:01:12
173000 -- (-1213.230) (-1217.673) (-1215.856) [-1215.081] * (-1215.308) (-1213.084) [-1216.948] (-1212.948) -- 0:01:11
174000 -- (-1213.997) (-1217.618) [-1213.800] (-1215.004) * (-1215.050) [-1212.852] (-1214.352) (-1213.524) -- 0:01:11
175000 -- [-1215.054] (-1214.061) (-1217.425) (-1217.780) * (-1215.876) (-1214.336) [-1214.337] (-1215.488) -- 0:01:10
Average standard deviation of split frequencies: 0.026784
176000 -- (-1212.762) [-1213.955] (-1215.356) (-1216.454) * (-1214.663) (-1213.676) (-1215.214) [-1212.884] -- 0:01:10
177000 -- [-1214.262] (-1214.571) (-1214.817) (-1216.982) * (-1214.193) (-1215.499) (-1213.276) [-1212.708] -- 0:01:14
178000 -- (-1215.164) [-1213.834] (-1214.615) (-1215.927) * [-1213.212] (-1215.725) (-1213.132) (-1214.255) -- 0:01:13
179000 -- (-1219.817) (-1212.918) (-1213.431) [-1213.116] * [-1213.778] (-1215.815) (-1213.880) (-1217.494) -- 0:01:13
180000 -- [-1215.777] (-1214.043) (-1213.891) (-1213.478) * (-1212.437) (-1214.903) (-1216.188) [-1221.481] -- 0:01:12
Average standard deviation of split frequencies: 0.027832
181000 -- [-1215.882] (-1213.443) (-1213.649) (-1214.951) * (-1218.854) [-1214.159] (-1213.804) (-1213.974) -- 0:01:12
182000 -- (-1214.863) (-1215.019) [-1213.132] (-1215.915) * [-1216.219] (-1217.250) (-1214.245) (-1213.474) -- 0:01:11
183000 -- (-1216.341) (-1216.490) (-1212.711) [-1213.903] * (-1214.231) (-1215.692) [-1214.353] (-1214.443) -- 0:01:11
184000 -- [-1214.556] (-1213.366) (-1215.353) (-1214.128) * (-1214.645) [-1215.247] (-1214.297) (-1214.815) -- 0:01:10
185000 -- [-1214.086] (-1217.055) (-1213.935) (-1214.745) * (-1219.481) (-1213.068) [-1212.910] (-1213.356) -- 0:01:10
Average standard deviation of split frequencies: 0.033792
186000 -- (-1214.500) (-1215.521) [-1214.967] (-1215.009) * [-1215.681] (-1213.339) (-1215.570) (-1213.960) -- 0:01:10
187000 -- (-1214.096) (-1219.987) [-1215.152] (-1214.754) * [-1214.709] (-1218.913) (-1214.991) (-1217.890) -- 0:01:09
188000 -- (-1213.235) [-1217.032] (-1213.638) (-1216.856) * (-1213.923) (-1213.148) [-1212.949] (-1215.810) -- 0:01:09
189000 -- [-1214.130] (-1214.065) (-1214.926) (-1219.984) * [-1213.734] (-1212.642) (-1213.199) (-1213.402) -- 0:01:12
190000 -- [-1211.049] (-1214.976) (-1219.749) (-1213.486) * [-1213.010] (-1212.753) (-1214.020) (-1214.273) -- 0:01:12
Average standard deviation of split frequencies: 0.034614
191000 -- [-1214.572] (-1215.326) (-1214.777) (-1214.824) * [-1215.965] (-1215.070) (-1213.998) (-1214.181) -- 0:01:12
192000 -- (-1214.027) (-1215.063) (-1214.071) [-1216.431] * (-1214.610) (-1214.057) [-1212.666] (-1213.885) -- 0:01:11
193000 -- (-1214.872) [-1214.196] (-1213.129) (-1216.116) * (-1215.447) [-1215.397] (-1216.255) (-1212.909) -- 0:01:11
194000 -- [-1214.321] (-1214.599) (-1214.361) (-1216.004) * (-1214.302) (-1216.294) (-1215.400) [-1213.284] -- 0:01:10
195000 -- (-1214.723) [-1215.839] (-1212.673) (-1216.608) * (-1214.338) (-1217.163) (-1214.714) [-1213.252] -- 0:01:10
Average standard deviation of split frequencies: 0.033672
196000 -- (-1215.115) (-1213.451) (-1212.924) [-1213.655] * (-1214.127) [-1213.707] (-1216.449) (-1213.413) -- 0:01:09
197000 -- (-1215.709) (-1215.711) [-1215.557] (-1214.053) * [-1212.927] (-1217.015) (-1216.872) (-1215.145) -- 0:01:09
198000 -- (-1212.903) (-1214.963) (-1216.502) [-1217.103] * (-1213.238) [-1215.518] (-1214.177) (-1212.827) -- 0:01:08
199000 -- (-1214.049) (-1214.948) (-1214.259) [-1214.365] * [-1214.239] (-1217.182) (-1219.268) (-1215.607) -- 0:01:08
200000 -- (-1213.340) (-1218.757) [-1214.572] (-1216.072) * (-1212.602) (-1213.800) (-1215.248) [-1214.164] -- 0:01:08
Average standard deviation of split frequencies: 0.034455
201000 -- (-1213.902) (-1214.286) [-1213.852] (-1212.629) * (-1216.081) (-1213.047) [-1214.093] (-1216.322) -- 0:01:07
202000 -- (-1217.804) (-1215.753) (-1213.889) [-1215.937] * [-1215.466] (-1214.792) (-1215.627) (-1215.523) -- 0:01:11
203000 -- (-1217.806) (-1215.161) (-1216.977) [-1213.094] * (-1213.211) (-1218.234) [-1214.534] (-1215.442) -- 0:01:10
204000 -- (-1214.052) (-1218.387) [-1213.758] (-1212.678) * (-1214.225) (-1216.137) [-1216.696] (-1214.061) -- 0:01:10
205000 -- (-1216.202) (-1217.230) (-1216.672) [-1215.393] * [-1213.285] (-1219.391) (-1216.128) (-1213.540) -- 0:01:09
Average standard deviation of split frequencies: 0.033563
206000 -- (-1217.034) (-1216.769) [-1213.659] (-1215.175) * (-1214.746) [-1215.491] (-1214.007) (-1214.202) -- 0:01:09
207000 -- (-1214.778) [-1213.490] (-1217.149) (-1213.165) * (-1214.022) (-1214.647) [-1215.387] (-1213.398) -- 0:01:08
208000 -- (-1216.956) [-1214.049] (-1214.249) (-1215.361) * (-1213.293) [-1214.155] (-1215.879) (-1216.755) -- 0:01:08
209000 -- (-1214.337) (-1219.625) [-1215.299] (-1228.007) * (-1213.725) (-1216.314) (-1215.164) [-1216.078] -- 0:01:08
210000 -- (-1218.497) (-1216.179) (-1217.737) [-1216.031] * (-1214.882) (-1213.242) (-1213.803) [-1213.100] -- 0:01:07
Average standard deviation of split frequencies: 0.032819
211000 -- [-1213.923] (-1212.655) (-1214.344) (-1213.498) * (-1214.097) (-1212.888) [-1214.598] (-1213.562) -- 0:01:07
212000 -- (-1215.499) [-1212.623] (-1212.669) (-1213.827) * (-1214.821) (-1214.310) [-1214.654] (-1212.628) -- 0:01:06
213000 -- (-1214.137) (-1214.419) (-1213.119) [-1212.828] * [-1213.186] (-1214.553) (-1219.138) (-1213.752) -- 0:01:06
214000 -- (-1213.227) [-1213.393] (-1212.952) (-1213.142) * (-1216.709) (-1214.816) (-1214.890) [-1212.890] -- 0:01:09
215000 -- [-1213.478] (-1214.376) (-1212.760) (-1214.623) * (-1215.633) [-1213.792] (-1214.345) (-1215.061) -- 0:01:09
Average standard deviation of split frequencies: 0.037829
216000 -- [-1214.534] (-1216.905) (-1214.824) (-1214.527) * [-1216.398] (-1214.656) (-1213.061) (-1216.868) -- 0:01:08
217000 -- (-1216.239) (-1215.418) (-1213.090) [-1213.322] * [-1212.688] (-1213.332) (-1214.560) (-1221.306) -- 0:01:08
218000 -- (-1214.614) (-1213.897) [-1214.472] (-1216.649) * [-1216.673] (-1215.301) (-1213.403) (-1218.793) -- 0:01:08
219000 -- (-1216.941) (-1214.430) (-1212.780) [-1217.555] * (-1215.116) (-1213.579) (-1212.886) [-1214.366] -- 0:01:07
220000 -- (-1212.931) (-1213.337) [-1214.885] (-1214.903) * (-1217.918) (-1213.865) [-1213.717] (-1215.010) -- 0:01:07
Average standard deviation of split frequencies: 0.035605
221000 -- [-1213.602] (-1213.580) (-1217.281) (-1214.432) * (-1217.929) (-1213.427) [-1219.192] (-1215.709) -- 0:01:06
222000 -- (-1215.588) [-1216.837] (-1215.382) (-1215.468) * (-1213.542) (-1215.357) [-1213.088] (-1215.264) -- 0:01:06
223000 -- (-1214.614) [-1213.718] (-1214.404) (-1214.192) * (-1216.729) (-1218.101) [-1212.888] (-1212.872) -- 0:01:06
224000 -- [-1212.855] (-1214.776) (-1216.511) (-1216.566) * [-1214.265] (-1214.612) (-1213.947) (-1213.627) -- 0:01:09
225000 -- (-1216.370) [-1216.188] (-1213.312) (-1214.955) * (-1213.011) (-1214.461) [-1213.463] (-1215.731) -- 0:01:08
Average standard deviation of split frequencies: 0.037545
226000 -- (-1214.480) [-1213.385] (-1212.827) (-1217.554) * (-1215.825) (-1214.285) (-1214.940) [-1214.317] -- 0:01:08
227000 -- [-1214.642] (-1215.523) (-1215.163) (-1213.528) * (-1218.641) (-1213.894) [-1212.519] (-1213.587) -- 0:01:08
228000 -- [-1214.918] (-1218.771) (-1213.573) (-1215.148) * (-1218.696) (-1219.266) (-1215.038) [-1213.566] -- 0:01:07
229000 -- (-1214.075) (-1214.439) [-1215.432] (-1213.975) * (-1215.985) (-1221.190) (-1212.941) [-1213.919] -- 0:01:07
230000 -- (-1213.640) (-1215.015) (-1214.099) [-1213.703] * [-1214.146] (-1214.169) (-1214.335) (-1213.222) -- 0:01:06
Average standard deviation of split frequencies: 0.038148
231000 -- (-1213.228) [-1214.635] (-1213.641) (-1213.075) * (-1212.548) (-1213.097) (-1214.948) [-1214.484] -- 0:01:06
232000 -- [-1215.952] (-1213.426) (-1217.956) (-1213.309) * (-1215.808) (-1213.201) (-1214.345) [-1216.956] -- 0:01:06
233000 -- (-1214.578) [-1213.063] (-1213.859) (-1213.854) * (-1216.577) [-1213.072] (-1216.018) (-1213.236) -- 0:01:05
234000 -- (-1214.391) [-1213.584] (-1213.265) (-1215.997) * (-1213.370) (-1216.848) (-1218.973) [-1215.925] -- 0:01:05
235000 -- (-1216.077) (-1213.958) (-1213.904) [-1215.247] * (-1218.762) [-1214.352] (-1219.810) (-1213.569) -- 0:01:05
Average standard deviation of split frequencies: 0.037286
236000 -- (-1214.432) (-1213.593) [-1212.526] (-1214.641) * (-1214.180) (-1216.268) (-1213.101) [-1212.833] -- 0:01:04
237000 -- (-1214.418) (-1214.261) [-1212.042] (-1217.712) * (-1221.575) (-1213.119) [-1217.898] (-1213.390) -- 0:01:07
238000 -- (-1213.426) (-1214.895) [-1215.047] (-1220.026) * (-1216.998) (-1213.112) (-1213.060) [-1212.604] -- 0:01:07
239000 -- (-1213.705) (-1214.404) (-1214.720) [-1215.700] * [-1213.059] (-1213.398) (-1213.251) (-1213.180) -- 0:01:06
240000 -- (-1213.757) (-1216.127) (-1215.204) [-1213.063] * [-1215.608] (-1213.116) (-1213.449) (-1214.197) -- 0:01:06
Average standard deviation of split frequencies: 0.035257
241000 -- (-1213.411) [-1213.909] (-1215.082) (-1214.322) * (-1215.143) [-1214.642] (-1213.880) (-1215.805) -- 0:01:06
242000 -- (-1214.339) (-1217.084) [-1214.529] (-1215.037) * (-1215.421) [-1213.004] (-1217.997) (-1212.624) -- 0:01:05
243000 -- (-1212.979) (-1216.919) (-1212.897) [-1217.264] * [-1215.741] (-1213.522) (-1214.931) (-1216.642) -- 0:01:05
244000 -- [-1214.007] (-1216.468) (-1213.772) (-1214.505) * (-1218.838) [-1215.046] (-1216.027) (-1213.273) -- 0:01:05
245000 -- (-1213.758) [-1214.935] (-1213.725) (-1213.194) * (-1216.943) [-1213.506] (-1217.075) (-1217.555) -- 0:01:04
Average standard deviation of split frequencies: 0.030660
246000 -- (-1213.255) (-1214.643) [-1215.728] (-1215.550) * (-1213.028) (-1215.959) (-1215.317) [-1213.583] -- 0:01:04
247000 -- (-1215.853) (-1214.073) (-1213.452) [-1215.595] * [-1214.683] (-1214.438) (-1217.246) (-1214.511) -- 0:01:04
248000 -- (-1214.900) (-1215.879) [-1214.065] (-1219.893) * (-1213.453) [-1213.638] (-1215.455) (-1217.395) -- 0:01:03
249000 -- (-1213.823) (-1213.571) [-1214.818] (-1214.479) * (-1214.751) (-1214.760) [-1218.183] (-1215.181) -- 0:01:03
250000 -- [-1214.048] (-1213.344) (-1215.690) (-1213.798) * (-1214.301) (-1213.450) (-1213.403) [-1215.446] -- 0:01:06
Average standard deviation of split frequencies: 0.028836
251000 -- (-1216.256) [-1215.171] (-1213.675) (-1214.086) * (-1212.843) (-1214.860) [-1214.406] (-1215.226) -- 0:01:05
252000 -- (-1214.913) (-1215.325) [-1214.427] (-1216.040) * (-1213.875) (-1214.584) (-1218.155) [-1214.297] -- 0:01:05
253000 -- (-1215.184) (-1212.504) (-1215.999) [-1217.643] * [-1214.978] (-1215.782) (-1221.135) (-1216.160) -- 0:01:04
254000 -- (-1213.421) (-1213.902) (-1216.126) [-1215.639] * [-1214.981] (-1212.744) (-1214.976) (-1213.851) -- 0:01:04
255000 -- (-1212.880) [-1212.633] (-1212.542) (-1214.503) * [-1214.139] (-1216.273) (-1215.886) (-1213.121) -- 0:01:04
Average standard deviation of split frequencies: 0.024552
256000 -- [-1211.250] (-1214.388) (-1216.389) (-1214.455) * [-1214.628] (-1212.973) (-1218.492) (-1215.007) -- 0:01:03
257000 -- [-1215.231] (-1212.928) (-1214.923) (-1216.952) * (-1214.775) (-1214.879) (-1214.829) [-1213.032] -- 0:01:03
258000 -- [-1211.440] (-1213.545) (-1217.258) (-1216.660) * (-1214.314) (-1212.555) (-1215.176) [-1213.849] -- 0:01:03
259000 -- (-1220.550) (-1215.886) (-1213.979) [-1213.996] * [-1214.954] (-1214.468) (-1214.696) (-1215.914) -- 0:01:02
260000 -- (-1215.924) [-1213.158] (-1219.205) (-1213.054) * [-1213.542] (-1214.096) (-1216.350) (-1215.385) -- 0:01:02
Average standard deviation of split frequencies: 0.025318
261000 -- (-1213.200) (-1217.549) (-1216.404) [-1213.963] * (-1214.054) (-1218.301) [-1214.664] (-1216.298) -- 0:01:02
262000 -- [-1216.503] (-1215.235) (-1215.026) (-1213.511) * [-1214.726] (-1216.043) (-1216.542) (-1213.218) -- 0:01:04
263000 -- (-1217.335) (-1214.353) (-1217.792) [-1214.347] * [-1216.494] (-1213.246) (-1213.923) (-1218.008) -- 0:01:04
264000 -- (-1214.913) [-1214.098] (-1213.441) (-1214.222) * [-1213.683] (-1214.240) (-1212.708) (-1213.739) -- 0:01:04
265000 -- (-1224.586) (-1213.111) (-1212.773) [-1213.065] * (-1214.270) (-1214.723) (-1213.849) [-1217.028] -- 0:01:03
Average standard deviation of split frequencies: 0.020085
266000 -- [-1215.124] (-1211.963) (-1213.780) (-1213.681) * (-1213.795) (-1214.855) (-1218.692) [-1214.519] -- 0:01:03
267000 -- (-1217.318) (-1221.051) [-1214.120] (-1216.672) * (-1221.142) (-1213.854) (-1213.467) [-1213.131] -- 0:01:03
268000 -- [-1212.661] (-1213.587) (-1219.064) (-1215.748) * (-1215.662) (-1214.977) (-1215.098) [-1212.910] -- 0:01:02
269000 -- (-1212.920) (-1217.307) [-1213.820] (-1213.775) * (-1217.518) (-1215.510) [-1213.979] (-1213.189) -- 0:01:02
270000 -- [-1213.379] (-1215.297) (-1213.926) (-1215.726) * (-1219.945) (-1214.366) (-1215.753) [-1212.185] -- 0:01:02
Average standard deviation of split frequencies: 0.016255
271000 -- (-1212.919) (-1213.376) (-1215.670) [-1213.636] * (-1215.592) [-1218.101] (-1212.959) (-1213.734) -- 0:01:01
272000 -- [-1213.074] (-1214.117) (-1217.519) (-1212.972) * (-1213.597) (-1214.947) (-1213.695) [-1213.217] -- 0:01:01
273000 -- (-1214.072) [-1212.978] (-1212.775) (-1214.148) * (-1220.340) [-1213.988] (-1212.925) (-1213.512) -- 0:01:01
274000 -- [-1216.874] (-1213.210) (-1214.242) (-1216.247) * (-1215.393) (-1217.269) [-1213.514] (-1213.165) -- 0:01:00
275000 -- (-1212.921) (-1213.565) (-1213.288) [-1213.774] * (-1213.306) [-1212.870] (-1213.052) (-1213.802) -- 0:01:03
Average standard deviation of split frequencies: 0.019357
276000 -- (-1213.280) (-1213.080) [-1213.908] (-1213.594) * [-1212.865] (-1212.945) (-1212.904) (-1212.759) -- 0:01:02
277000 -- [-1218.818] (-1214.397) (-1213.637) (-1216.532) * (-1216.194) (-1213.647) (-1214.525) [-1219.978] -- 0:01:02
278000 -- (-1215.555) (-1215.228) (-1213.356) [-1215.713] * (-1215.496) (-1221.871) (-1213.321) [-1215.087] -- 0:01:02
279000 -- [-1215.142] (-1214.214) (-1215.043) (-1215.586) * (-1215.720) [-1214.088] (-1212.856) (-1213.532) -- 0:01:02
280000 -- [-1214.015] (-1217.456) (-1215.380) (-1213.531) * [-1215.182] (-1217.827) (-1214.000) (-1216.533) -- 0:01:01
Average standard deviation of split frequencies: 0.015676
281000 -- (-1213.336) (-1217.268) (-1213.542) [-1212.808] * (-1214.580) (-1214.936) [-1214.277] (-1214.678) -- 0:01:01
282000 -- (-1216.882) (-1212.936) [-1214.687] (-1214.282) * (-1214.532) (-1216.337) [-1213.187] (-1212.616) -- 0:01:01
283000 -- [-1217.440] (-1215.462) (-1217.646) (-1213.053) * [-1214.080] (-1215.343) (-1214.255) (-1213.710) -- 0:01:00
284000 -- (-1215.960) (-1213.035) (-1216.275) [-1213.997] * [-1215.022] (-1215.492) (-1216.195) (-1213.600) -- 0:01:00
285000 -- [-1216.021] (-1213.817) (-1214.104) (-1211.950) * (-1215.825) (-1216.995) [-1214.654] (-1216.144) -- 0:01:00
Average standard deviation of split frequencies: 0.015384
286000 -- (-1212.699) (-1214.361) (-1213.255) [-1214.322] * [-1214.712] (-1216.617) (-1214.513) (-1212.891) -- 0:00:59
287000 -- (-1214.009) (-1214.371) (-1216.879) [-1212.462] * [-1213.992] (-1215.359) (-1214.210) (-1213.687) -- 0:01:02
288000 -- (-1215.105) (-1214.483) (-1215.764) [-1212.578] * (-1215.213) (-1215.601) [-1213.764] (-1216.611) -- 0:01:01
289000 -- (-1216.920) [-1217.165] (-1214.193) (-1215.633) * (-1214.853) (-1216.023) [-1213.319] (-1213.188) -- 0:01:01
290000 -- (-1214.684) (-1220.973) [-1212.533] (-1213.504) * [-1214.485] (-1213.434) (-1214.658) (-1213.219) -- 0:01:01
Average standard deviation of split frequencies: 0.018380
291000 -- (-1212.896) (-1216.759) [-1213.390] (-1214.749) * (-1217.409) [-1212.907] (-1212.829) (-1214.499) -- 0:01:00
292000 -- [-1212.770] (-1214.778) (-1213.684) (-1214.654) * [-1214.014] (-1211.768) (-1215.232) (-1213.054) -- 0:01:00
293000 -- [-1215.418] (-1213.158) (-1212.932) (-1213.594) * [-1213.967] (-1214.323) (-1216.575) (-1217.527) -- 0:01:00
294000 -- (-1213.346) (-1212.723) (-1213.159) [-1213.954] * (-1218.429) [-1214.856] (-1215.512) (-1214.276) -- 0:01:00
295000 -- (-1214.546) [-1212.789] (-1219.996) (-1212.943) * (-1216.780) [-1214.190] (-1213.532) (-1214.366) -- 0:00:59
Average standard deviation of split frequencies: 0.020173
296000 -- (-1214.199) [-1212.594] (-1218.037) (-1215.757) * (-1216.613) (-1217.634) [-1214.933] (-1212.974) -- 0:00:59
297000 -- [-1213.509] (-1214.616) (-1215.061) (-1214.502) * [-1218.729] (-1215.327) (-1213.823) (-1213.247) -- 0:00:59
298000 -- (-1214.826) (-1214.895) [-1213.285] (-1217.060) * (-1215.107) (-1212.123) (-1214.423) [-1215.920] -- 0:00:58
299000 -- [-1216.378] (-1216.493) (-1213.335) (-1215.050) * [-1212.727] (-1214.408) (-1215.461) (-1213.182) -- 0:00:58
300000 -- (-1213.060) (-1212.312) [-1213.272] (-1214.821) * (-1215.064) (-1213.587) (-1213.403) [-1212.783] -- 0:01:00
Average standard deviation of split frequencies: 0.016724
301000 -- (-1213.565) [-1212.510] (-1212.829) (-1214.644) * (-1214.391) (-1217.041) (-1214.523) [-1212.963] -- 0:01:00
302000 -- (-1215.155) (-1214.278) [-1217.860] (-1212.197) * (-1217.663) (-1213.667) [-1215.456] (-1215.536) -- 0:01:00
303000 -- (-1216.356) (-1215.377) (-1214.237) [-1212.837] * (-1217.507) (-1212.778) [-1212.974] (-1214.790) -- 0:00:59
304000 -- (-1216.275) (-1218.356) (-1213.268) [-1213.026] * (-1214.125) (-1212.095) [-1214.253] (-1214.946) -- 0:00:59
305000 -- (-1213.981) [-1213.662] (-1213.558) (-1217.173) * (-1213.452) [-1214.069] (-1214.580) (-1212.695) -- 0:00:59
Average standard deviation of split frequencies: 0.014378
306000 -- (-1214.541) [-1214.925] (-1215.192) (-1218.128) * [-1212.738] (-1213.434) (-1213.487) (-1213.770) -- 0:00:58
307000 -- (-1215.245) (-1213.224) [-1216.781] (-1213.924) * (-1214.202) [-1214.116] (-1216.363) (-1217.743) -- 0:00:58
308000 -- (-1213.660) (-1216.347) [-1214.885] (-1217.009) * (-1216.224) [-1216.296] (-1213.443) (-1221.415) -- 0:00:58
309000 -- (-1215.907) (-1213.499) [-1216.457] (-1213.810) * (-1215.266) (-1214.368) [-1216.880] (-1217.225) -- 0:00:58
310000 -- (-1213.535) [-1214.691] (-1213.429) (-1215.448) * (-1219.023) (-1215.687) [-1212.888] (-1214.967) -- 0:00:57
Average standard deviation of split frequencies: 0.010116
311000 -- (-1217.194) (-1216.096) (-1214.851) [-1216.522] * [-1212.300] (-1218.105) (-1213.977) (-1213.872) -- 0:00:57
312000 -- [-1214.504] (-1214.340) (-1216.821) (-1213.936) * [-1215.097] (-1214.315) (-1216.676) (-1216.207) -- 0:00:57
313000 -- [-1213.498] (-1216.457) (-1220.743) (-1213.410) * (-1212.763) (-1213.858) (-1214.964) [-1216.096] -- 0:00:59
314000 -- (-1213.304) [-1216.885] (-1214.119) (-1219.940) * [-1213.090] (-1216.182) (-1212.985) (-1215.249) -- 0:00:58
315000 -- (-1213.542) (-1213.751) [-1213.970] (-1212.758) * (-1212.684) (-1214.888) (-1217.509) [-1213.106] -- 0:00:58
Average standard deviation of split frequencies: 0.006962
316000 -- [-1214.957] (-1212.828) (-1212.977) (-1213.696) * (-1212.798) (-1214.543) [-1214.096] (-1213.911) -- 0:00:58
317000 -- (-1213.071) (-1213.071) [-1214.886] (-1214.659) * [-1215.877] (-1214.134) (-1212.631) (-1213.513) -- 0:00:58
318000 -- (-1214.672) (-1214.963) (-1217.104) [-1214.138] * [-1212.682] (-1214.357) (-1215.367) (-1216.385) -- 0:00:57
319000 -- (-1214.173) (-1213.428) (-1213.550) [-1215.583] * [-1214.647] (-1215.913) (-1214.669) (-1217.072) -- 0:00:57
320000 -- [-1214.978] (-1215.260) (-1214.059) (-1218.322) * [-1210.190] (-1213.485) (-1214.566) (-1214.820) -- 0:00:57
Average standard deviation of split frequencies: 0.007840
321000 -- [-1212.716] (-1215.243) (-1218.009) (-1212.927) * [-1209.465] (-1216.149) (-1213.314) (-1215.467) -- 0:00:57
322000 -- [-1213.510] (-1214.313) (-1212.793) (-1215.039) * [-1210.364] (-1212.650) (-1217.308) (-1215.697) -- 0:00:56
323000 -- (-1217.743) (-1213.269) (-1216.195) [-1215.058] * [-1212.144] (-1215.019) (-1219.929) (-1215.044) -- 0:00:56
324000 -- (-1222.224) (-1212.884) (-1216.219) [-1213.350] * (-1215.488) (-1214.447) [-1214.558] (-1217.399) -- 0:00:56
325000 -- (-1213.104) (-1214.703) [-1216.190] (-1214.393) * (-1213.806) [-1218.768] (-1219.385) (-1215.522) -- 0:00:58
Average standard deviation of split frequencies: 0.008676
326000 -- [-1213.653] (-1214.310) (-1214.481) (-1213.111) * [-1214.049] (-1216.592) (-1214.059) (-1218.009) -- 0:00:57
327000 -- (-1217.151) [-1214.560] (-1212.781) (-1213.257) * (-1220.828) (-1214.372) (-1214.267) [-1213.881] -- 0:00:57
328000 -- (-1214.755) [-1212.839] (-1214.425) (-1215.349) * (-1213.645) (-1215.128) (-1215.958) [-1212.742] -- 0:00:57
329000 -- [-1214.992] (-1215.627) (-1215.131) (-1215.333) * (-1212.869) (-1213.969) (-1213.649) [-1214.832] -- 0:00:57
330000 -- (-1215.515) (-1217.284) [-1213.008] (-1216.006) * (-1213.421) (-1213.797) (-1218.287) [-1213.684] -- 0:00:56
Average standard deviation of split frequencies: 0.006653
331000 -- (-1214.495) (-1214.696) (-1214.770) [-1219.072] * (-1213.259) (-1214.815) (-1215.541) [-1215.275] -- 0:00:56
332000 -- (-1217.878) (-1217.027) (-1213.560) [-1214.928] * (-1216.113) (-1214.179) (-1213.652) [-1217.414] -- 0:00:56
333000 -- (-1214.875) [-1213.814] (-1216.395) (-1216.381) * (-1214.488) [-1213.960] (-1213.942) (-1215.177) -- 0:00:56
334000 -- (-1213.311) (-1214.132) [-1214.882] (-1213.345) * (-1216.895) (-1214.230) [-1217.287] (-1213.816) -- 0:00:55
335000 -- (-1213.119) (-1213.404) [-1214.097] (-1215.382) * (-1216.992) [-1213.616] (-1214.855) (-1214.550) -- 0:00:55
Average standard deviation of split frequencies: 0.005612
336000 -- (-1213.651) [-1216.457] (-1214.441) (-1213.230) * (-1213.125) (-1217.939) [-1213.176] (-1213.681) -- 0:00:55
337000 -- (-1216.171) (-1214.031) (-1213.422) [-1215.344] * (-1216.307) (-1213.158) (-1213.683) [-1213.655] -- 0:00:55
338000 -- (-1214.589) [-1214.246] (-1213.329) (-1214.302) * (-1220.110) [-1213.832] (-1214.436) (-1214.724) -- 0:00:56
339000 -- (-1213.551) (-1214.876) [-1218.565] (-1214.254) * (-1213.367) (-1213.367) (-1213.273) [-1215.314] -- 0:00:56
340000 -- (-1212.769) [-1213.396] (-1212.676) (-1213.248) * [-1214.440] (-1216.175) (-1214.948) (-1214.731) -- 0:00:56
Average standard deviation of split frequencies: 0.003690
341000 -- (-1216.293) [-1217.724] (-1214.107) (-1213.273) * (-1212.919) (-1217.400) [-1213.607] (-1213.114) -- 0:00:56
342000 -- (-1217.796) [-1212.928] (-1214.559) (-1215.375) * (-1213.979) (-1214.329) (-1217.374) [-1213.943] -- 0:00:55
343000 -- (-1215.581) (-1213.896) [-1214.359] (-1213.654) * (-1213.710) (-1215.350) (-1214.355) [-1211.765] -- 0:00:55
344000 -- (-1215.929) (-1214.839) (-1217.060) [-1213.823] * (-1213.193) (-1212.977) (-1215.452) [-1209.103] -- 0:00:55
345000 -- [-1216.301] (-1213.059) (-1213.420) (-1215.480) * (-1213.807) (-1217.279) (-1215.287) [-1210.175] -- 0:00:55
Average standard deviation of split frequencies: 0.005450
346000 -- (-1212.780) (-1215.988) (-1214.865) [-1214.033] * (-1214.248) (-1214.921) (-1213.101) [-1214.057] -- 0:00:54
347000 -- (-1214.638) (-1212.273) [-1214.546] (-1219.467) * [-1214.812] (-1215.698) (-1213.624) (-1210.457) -- 0:00:54
348000 -- (-1215.224) [-1213.875] (-1214.984) (-1213.370) * (-1213.799) (-1216.261) (-1213.466) [-1210.202] -- 0:00:54
349000 -- (-1220.011) (-1212.784) (-1214.294) [-1214.027] * (-1218.372) (-1214.706) (-1223.635) [-1210.155] -- 0:00:54
350000 -- (-1215.014) [-1213.927] (-1212.799) (-1214.560) * (-1216.703) (-1213.797) (-1217.473) [-1212.839] -- 0:00:53
Average standard deviation of split frequencies: 0.007170
351000 -- (-1214.117) (-1213.808) [-1214.501] (-1217.439) * (-1213.659) (-1214.586) (-1219.037) [-1211.513] -- 0:00:55
352000 -- [-1212.969] (-1214.777) (-1214.124) (-1216.373) * (-1212.769) (-1214.228) (-1218.174) [-1211.424] -- 0:00:55
353000 -- (-1214.208) (-1217.784) [-1213.167] (-1213.570) * (-1212.049) (-1213.086) (-1216.079) [-1213.379] -- 0:00:54
354000 -- (-1213.559) (-1213.597) [-1214.463] (-1214.103) * (-1214.626) (-1213.606) (-1217.345) [-1211.177] -- 0:00:54
355000 -- (-1213.655) (-1214.792) (-1213.299) [-1214.905] * (-1213.871) (-1214.823) (-1217.014) [-1212.263] -- 0:00:54
Average standard deviation of split frequencies: 0.008828
356000 -- (-1216.508) [-1214.086] (-1213.526) (-1213.531) * (-1212.978) (-1217.008) (-1214.302) [-1214.675] -- 0:00:54
357000 -- (-1213.621) (-1218.175) [-1214.212] (-1212.728) * (-1212.954) (-1216.013) (-1213.310) [-1211.416] -- 0:00:54
358000 -- (-1214.295) (-1214.198) [-1214.507] (-1214.638) * [-1213.221] (-1218.666) (-1216.534) (-1213.050) -- 0:00:53
359000 -- (-1214.514) (-1215.391) [-1214.951] (-1219.008) * [-1215.032] (-1212.729) (-1213.518) (-1214.558) -- 0:00:53
360000 -- [-1213.273] (-1216.211) (-1213.845) (-1214.061) * [-1213.342] (-1213.846) (-1213.074) (-1215.660) -- 0:00:53
Average standard deviation of split frequencies: 0.007842
361000 -- (-1214.285) (-1213.468) [-1214.216] (-1215.607) * (-1214.473) (-1213.183) (-1214.168) [-1212.673] -- 0:00:53
362000 -- (-1213.446) [-1213.512] (-1213.688) (-1214.212) * (-1213.460) (-1217.379) (-1214.528) [-1212.998] -- 0:00:52
363000 -- (-1213.552) [-1215.637] (-1215.494) (-1213.381) * (-1218.486) (-1216.042) (-1213.805) [-1214.648] -- 0:00:54
364000 -- (-1217.540) (-1213.233) [-1214.045] (-1214.427) * (-1214.776) (-1215.143) [-1214.013] (-1216.967) -- 0:00:54
365000 -- (-1215.734) (-1217.226) (-1217.227) [-1213.634] * (-1213.729) (-1213.405) (-1213.354) [-1217.513] -- 0:00:53
Average standard deviation of split frequencies: 0.006869
366000 -- (-1214.056) (-1214.329) (-1214.432) [-1213.357] * [-1215.023] (-1215.743) (-1219.153) (-1217.517) -- 0:00:53
367000 -- (-1213.804) (-1220.105) (-1214.085) [-1215.459] * [-1213.129] (-1216.028) (-1215.758) (-1214.219) -- 0:00:53
368000 -- (-1216.208) (-1218.186) (-1213.790) [-1214.800] * [-1211.768] (-1214.692) (-1216.322) (-1219.807) -- 0:00:53
369000 -- [-1214.538] (-1214.168) (-1213.012) (-1212.772) * (-1214.069) (-1215.617) [-1214.469] (-1217.198) -- 0:00:53
370000 -- [-1214.663] (-1214.037) (-1213.688) (-1213.912) * (-1218.336) [-1215.388] (-1214.412) (-1213.380) -- 0:00:52
Average standard deviation of split frequencies: 0.009326
371000 -- [-1215.227] (-1218.210) (-1213.167) (-1219.073) * (-1217.511) (-1218.825) [-1215.363] (-1214.100) -- 0:00:52
372000 -- (-1215.773) (-1214.376) [-1213.142] (-1217.780) * (-1215.252) (-1215.472) [-1213.053] (-1214.585) -- 0:00:52
373000 -- (-1217.961) (-1217.378) (-1218.245) [-1213.654] * (-1214.498) (-1215.272) (-1215.382) [-1215.018] -- 0:00:52
374000 -- (-1217.103) [-1213.500] (-1213.235) (-1213.434) * (-1212.252) (-1215.319) (-1215.476) [-1212.422] -- 0:00:51
375000 -- [-1215.004] (-1213.084) (-1213.466) (-1213.891) * (-1213.684) (-1215.728) (-1216.584) [-1216.015] -- 0:00:51
Average standard deviation of split frequencies: 0.010030
376000 -- (-1213.970) (-1214.073) (-1213.164) [-1212.963] * (-1214.030) (-1217.944) [-1214.665] (-1213.627) -- 0:00:53
377000 -- (-1212.672) (-1213.076) (-1215.766) [-1214.626] * (-1214.485) [-1217.680] (-1216.862) (-1215.121) -- 0:00:52
378000 -- (-1213.743) (-1214.572) (-1214.370) [-1215.141] * (-1217.446) (-1214.786) [-1218.082] (-1213.327) -- 0:00:52
379000 -- (-1214.202) (-1214.838) [-1213.144] (-1214.139) * [-1214.225] (-1213.830) (-1217.511) (-1214.063) -- 0:00:52
380000 -- [-1214.048] (-1213.766) (-1213.500) (-1214.863) * (-1217.275) (-1214.242) (-1214.057) [-1212.924] -- 0:00:52
Average standard deviation of split frequencies: 0.008256
381000 -- (-1216.419) (-1213.648) (-1215.117) [-1210.654] * (-1214.771) (-1214.910) [-1212.591] (-1213.910) -- 0:00:51
382000 -- (-1214.950) (-1217.556) (-1213.484) [-1213.413] * (-1212.737) [-1214.102] (-1212.811) (-1214.813) -- 0:00:51
383000 -- (-1213.348) (-1212.717) (-1218.395) [-1212.768] * (-1214.141) (-1212.473) [-1213.390] (-1215.638) -- 0:00:51
384000 -- (-1215.907) [-1213.449] (-1220.832) (-1213.151) * (-1214.561) (-1213.475) [-1213.275] (-1213.014) -- 0:00:51
385000 -- [-1214.718] (-1213.607) (-1214.035) (-1214.081) * [-1212.059] (-1214.627) (-1216.283) (-1214.367) -- 0:00:51
Average standard deviation of split frequencies: 0.008956
386000 -- (-1213.963) [-1214.943] (-1214.897) (-1214.017) * (-1213.218) [-1216.222] (-1212.767) (-1212.748) -- 0:00:50
387000 -- (-1214.355) (-1213.908) [-1214.307] (-1214.931) * (-1213.735) [-1213.922] (-1215.868) (-1213.159) -- 0:00:50
388000 -- [-1217.559] (-1213.100) (-1215.283) (-1215.662) * (-1213.357) (-1214.210) [-1213.438] (-1213.905) -- 0:00:52
389000 -- (-1216.589) (-1213.984) (-1213.509) [-1217.040] * (-1215.283) (-1213.069) [-1215.061] (-1214.367) -- 0:00:51
390000 -- (-1214.206) (-1213.471) [-1212.535] (-1215.341) * (-1213.281) (-1214.431) (-1215.568) [-1213.838] -- 0:00:51
Average standard deviation of split frequencies: 0.006436
391000 -- (-1214.055) (-1212.754) (-1216.576) [-1213.874] * (-1213.910) (-1212.929) (-1215.330) [-1213.843] -- 0:00:51
392000 -- [-1214.641] (-1213.718) (-1213.777) (-1212.878) * (-1213.460) (-1212.800) (-1215.159) [-1213.175] -- 0:00:51
393000 -- (-1213.880) (-1215.897) [-1214.844] (-1216.265) * [-1213.245] (-1214.804) (-1214.109) (-1215.684) -- 0:00:50
394000 -- (-1213.902) (-1215.670) [-1213.564] (-1214.408) * [-1214.223] (-1213.213) (-1214.993) (-1213.197) -- 0:00:50
395000 -- [-1212.091] (-1213.498) (-1213.523) (-1214.752) * (-1213.751) (-1212.883) (-1215.449) [-1213.869] -- 0:00:50
Average standard deviation of split frequencies: 0.007936
396000 -- (-1215.711) [-1214.968] (-1218.016) (-1212.066) * (-1213.031) (-1212.762) (-1214.503) [-1211.764] -- 0:00:50
397000 -- (-1219.617) (-1214.305) [-1213.953] (-1213.125) * (-1213.026) (-1212.888) [-1216.989] (-1214.943) -- 0:00:50
398000 -- (-1212.359) (-1214.659) [-1215.051] (-1213.632) * [-1213.196] (-1213.095) (-1214.649) (-1212.672) -- 0:00:49
399000 -- [-1215.197] (-1214.222) (-1214.342) (-1213.266) * (-1217.353) [-1214.907] (-1212.909) (-1213.030) -- 0:00:49
400000 -- (-1213.154) (-1216.298) (-1216.956) [-1214.113] * (-1214.114) (-1213.094) [-1213.395] (-1213.717) -- 0:00:49
Average standard deviation of split frequencies: 0.006275
401000 -- (-1213.837) (-1218.367) (-1214.666) [-1213.903] * (-1212.978) (-1215.260) [-1215.956] (-1216.167) -- 0:00:50
402000 -- (-1216.342) (-1218.291) (-1215.010) [-1213.069] * (-1213.133) (-1213.408) [-1213.041] (-1212.898) -- 0:00:50
403000 -- (-1214.005) (-1217.241) (-1213.133) [-1213.343] * (-1215.323) [-1212.828] (-1217.703) (-1213.766) -- 0:00:50
404000 -- [-1213.677] (-1214.912) (-1213.053) (-1214.270) * (-1213.366) (-1212.812) [-1213.979] (-1213.791) -- 0:00:50
405000 -- (-1213.088) (-1220.507) [-1217.375] (-1216.719) * (-1213.014) [-1214.078] (-1214.108) (-1212.526) -- 0:00:49
Average standard deviation of split frequencies: 0.006193
406000 -- [-1210.134] (-1215.886) (-1213.963) (-1216.180) * (-1213.078) [-1217.818] (-1212.642) (-1212.605) -- 0:00:49
407000 -- (-1214.493) (-1215.007) [-1214.759] (-1212.549) * [-1216.298] (-1215.976) (-1215.194) (-1214.176) -- 0:00:49
408000 -- (-1215.896) [-1213.359] (-1213.649) (-1214.385) * [-1215.892] (-1213.379) (-1212.937) (-1215.494) -- 0:00:49
409000 -- (-1212.759) [-1213.799] (-1213.533) (-1215.523) * (-1214.190) (-1214.600) [-1214.206] (-1217.295) -- 0:00:49
410000 -- (-1214.776) [-1213.160] (-1213.960) (-1214.393) * (-1213.561) (-1216.516) [-1214.739] (-1217.492) -- 0:00:48
Average standard deviation of split frequencies: 0.006122
411000 -- [-1216.001] (-1215.442) (-1217.023) (-1213.535) * (-1216.213) [-1213.215] (-1218.559) (-1214.849) -- 0:00:48
412000 -- (-1213.562) (-1213.321) (-1217.263) [-1214.147] * [-1213.254] (-1218.834) (-1217.509) (-1213.183) -- 0:00:48
413000 -- [-1214.419] (-1215.439) (-1212.952) (-1213.135) * [-1214.953] (-1213.713) (-1214.459) (-1216.694) -- 0:00:48
414000 -- (-1215.866) [-1213.266] (-1217.440) (-1212.876) * (-1213.241) (-1215.409) (-1213.573) [-1212.915] -- 0:00:49
415000 -- (-1215.907) (-1214.610) (-1216.752) [-1213.490] * [-1215.739] (-1214.759) (-1213.801) (-1214.396) -- 0:00:49
Average standard deviation of split frequencies: 0.005288
416000 -- (-1214.246) (-1216.633) (-1213.983) [-1212.144] * (-1215.232) [-1215.141] (-1216.458) (-1213.174) -- 0:00:49
417000 -- (-1217.661) (-1217.635) (-1215.583) [-1215.485] * (-1216.515) [-1214.246] (-1214.236) (-1214.083) -- 0:00:48
418000 -- (-1213.321) (-1215.116) (-1216.713) [-1212.890] * (-1215.362) (-1213.774) (-1214.446) [-1213.915] -- 0:00:48
419000 -- [-1215.822] (-1214.599) (-1214.361) (-1215.681) * (-1215.024) (-1214.664) [-1212.651] (-1213.932) -- 0:00:48
420000 -- (-1216.049) [-1213.497] (-1215.581) (-1214.474) * (-1214.507) (-1214.841) (-1214.091) [-1213.351] -- 0:00:48
Average standard deviation of split frequencies: 0.002988
421000 -- (-1215.099) (-1214.496) [-1216.057] (-1221.149) * (-1215.500) (-1213.240) (-1214.561) [-1214.505] -- 0:00:48
422000 -- [-1214.807] (-1213.649) (-1215.863) (-1214.549) * [-1213.749] (-1214.058) (-1218.754) (-1213.484) -- 0:00:47
423000 -- (-1219.058) [-1216.243] (-1215.055) (-1214.463) * (-1221.329) (-1217.983) (-1214.680) [-1214.247] -- 0:00:47
424000 -- (-1214.568) [-1214.443] (-1215.268) (-1219.285) * (-1214.008) (-1215.957) (-1214.114) [-1215.023] -- 0:00:47
425000 -- (-1216.937) (-1213.522) (-1213.357) [-1212.872] * (-1215.318) [-1214.600] (-1212.706) (-1213.998) -- 0:00:47
Average standard deviation of split frequencies: 0.000738
426000 -- (-1214.451) (-1213.616) (-1218.874) [-1213.014] * (-1216.434) [-1213.408] (-1214.278) (-1215.433) -- 0:00:47
427000 -- (-1213.575) (-1215.277) (-1213.030) [-1214.491] * (-1214.959) (-1214.832) [-1212.789] (-1215.033) -- 0:00:48
428000 -- [-1214.766] (-1213.790) (-1213.257) (-1214.977) * [-1216.268] (-1216.280) (-1218.629) (-1215.924) -- 0:00:48
429000 -- [-1215.698] (-1213.390) (-1216.341) (-1213.638) * (-1214.973) [-1214.982] (-1213.753) (-1214.640) -- 0:00:47
430000 -- [-1216.310] (-1215.104) (-1213.419) (-1214.664) * (-1214.264) (-1214.890) [-1213.255] (-1215.285) -- 0:00:47
Average standard deviation of split frequencies: 0.004378
431000 -- (-1214.822) (-1218.983) [-1218.658] (-1213.616) * (-1214.410) (-1215.447) (-1217.355) [-1213.243] -- 0:00:47
432000 -- (-1213.114) (-1220.098) [-1215.364] (-1212.435) * (-1213.304) (-1214.677) (-1213.439) [-1214.551] -- 0:00:47
433000 -- [-1218.755] (-1215.910) (-1214.348) (-1215.059) * (-1216.339) (-1213.444) (-1214.472) [-1216.087] -- 0:00:47
434000 -- [-1214.568] (-1213.947) (-1214.696) (-1214.358) * (-1214.921) (-1213.697) (-1215.177) [-1213.194] -- 0:00:46
435000 -- (-1218.711) [-1214.870] (-1213.336) (-1212.653) * (-1217.249) (-1213.813) [-1215.759] (-1213.685) -- 0:00:46
Average standard deviation of split frequencies: 0.005046
436000 -- (-1215.346) [-1213.127] (-1217.568) (-1214.302) * (-1216.845) (-1214.188) [-1213.822] (-1218.973) -- 0:00:46
437000 -- (-1215.190) (-1213.468) (-1213.588) [-1213.209] * (-1213.813) (-1217.709) (-1216.198) [-1214.718] -- 0:00:46
438000 -- [-1213.031] (-1217.277) (-1214.390) (-1214.456) * (-1212.618) (-1213.970) [-1216.691] (-1212.806) -- 0:00:46
439000 -- [-1213.627] (-1213.699) (-1217.190) (-1215.879) * [-1215.643] (-1215.631) (-1213.428) (-1214.718) -- 0:00:46
440000 -- (-1215.244) (-1215.387) [-1214.097] (-1214.987) * (-1216.161) [-1212.744] (-1214.215) (-1220.014) -- 0:00:47
Average standard deviation of split frequencies: 0.007845
441000 -- (-1214.713) (-1213.299) [-1213.461] (-1215.344) * (-1213.900) [-1216.387] (-1213.262) (-1215.018) -- 0:00:46
442000 -- (-1213.483) (-1215.030) [-1213.243] (-1212.938) * [-1215.223] (-1216.881) (-1214.735) (-1213.390) -- 0:00:46
443000 -- (-1214.334) [-1214.879] (-1214.058) (-1212.456) * [-1214.063] (-1213.184) (-1216.943) (-1213.935) -- 0:00:46
444000 -- (-1213.747) (-1215.936) [-1214.972] (-1214.486) * (-1215.049) [-1213.237] (-1218.799) (-1212.662) -- 0:00:46
445000 -- (-1217.946) (-1214.545) (-1215.010) [-1213.161] * [-1214.421] (-1212.891) (-1216.206) (-1215.826) -- 0:00:46
Average standard deviation of split frequencies: 0.008456
446000 -- (-1212.777) [-1215.466] (-1215.078) (-1214.765) * (-1212.754) [-1215.564] (-1213.369) (-1213.959) -- 0:00:45
447000 -- (-1214.943) [-1213.404] (-1215.039) (-1213.347) * (-1212.447) [-1212.293] (-1215.443) (-1215.657) -- 0:00:45
448000 -- [-1215.984] (-1217.567) (-1217.422) (-1214.365) * (-1215.943) (-1216.245) (-1214.503) [-1214.450] -- 0:00:45
449000 -- [-1215.460] (-1215.996) (-1214.624) (-1215.103) * (-1216.816) (-1213.459) [-1214.164] (-1214.893) -- 0:00:45
450000 -- (-1215.056) (-1216.301) [-1213.861] (-1213.244) * [-1213.626] (-1213.264) (-1216.047) (-1215.994) -- 0:00:45
Average standard deviation of split frequencies: 0.006973
451000 -- (-1216.182) (-1215.257) (-1214.615) [-1216.255] * (-1212.700) (-1213.068) (-1215.532) [-1213.253] -- 0:00:45
452000 -- [-1218.833] (-1215.581) (-1214.556) (-1214.876) * [-1213.835] (-1212.629) (-1213.768) (-1215.624) -- 0:00:44
453000 -- (-1213.892) (-1214.524) [-1212.875] (-1215.101) * (-1215.029) (-1213.950) (-1216.683) [-1212.998] -- 0:00:45
454000 -- (-1215.283) [-1214.202] (-1214.696) (-1214.267) * (-1215.256) (-1213.229) (-1215.436) [-1214.935] -- 0:00:45
455000 -- [-1214.086] (-1214.800) (-1213.292) (-1213.225) * (-1215.028) [-1214.634] (-1213.274) (-1215.794) -- 0:00:45
Average standard deviation of split frequencies: 0.007581
456000 -- [-1212.200] (-1215.022) (-1214.929) (-1216.346) * [-1214.240] (-1213.156) (-1215.088) (-1213.614) -- 0:00:45
457000 -- [-1213.503] (-1212.609) (-1215.673) (-1213.033) * (-1212.723) [-1214.839] (-1214.190) (-1216.220) -- 0:00:45
458000 -- [-1213.034] (-1215.306) (-1214.953) (-1214.897) * [-1212.982] (-1215.578) (-1216.280) (-1214.268) -- 0:00:44
459000 -- (-1218.509) [-1214.845] (-1216.379) (-1214.564) * (-1215.132) [-1212.532] (-1215.257) (-1214.945) -- 0:00:44
460000 -- (-1215.715) (-1214.542) [-1213.226] (-1216.895) * (-1212.554) [-1210.080] (-1213.971) (-1216.871) -- 0:00:44
Average standard deviation of split frequencies: 0.007504
461000 -- (-1213.617) (-1214.962) (-1215.036) [-1214.662] * (-1215.419) [-1209.765] (-1214.964) (-1213.705) -- 0:00:44
462000 -- (-1212.325) (-1217.414) (-1216.048) [-1212.877] * (-1213.014) [-1210.070] (-1214.994) (-1218.379) -- 0:00:44
463000 -- (-1215.130) (-1213.508) (-1213.740) [-1213.250] * [-1216.476] (-1213.372) (-1213.374) (-1215.450) -- 0:00:44
464000 -- [-1213.432] (-1212.746) (-1216.896) (-1218.844) * (-1214.366) [-1213.468] (-1214.683) (-1215.086) -- 0:00:43
465000 -- [-1214.053] (-1217.383) (-1215.610) (-1214.671) * (-1213.920) [-1213.053] (-1213.266) (-1214.913) -- 0:00:44
Average standard deviation of split frequencies: 0.008767
466000 -- (-1216.692) [-1213.068] (-1213.569) (-1214.999) * (-1214.092) [-1214.545] (-1214.084) (-1216.107) -- 0:00:44
467000 -- (-1214.001) [-1212.839] (-1216.750) (-1216.997) * (-1213.976) [-1215.578] (-1218.262) (-1217.086) -- 0:00:44
468000 -- [-1213.827] (-1217.037) (-1213.175) (-1213.587) * (-1212.935) [-1215.738] (-1213.968) (-1215.475) -- 0:00:44
469000 -- (-1217.313) (-1216.916) [-1215.027] (-1219.712) * (-1219.598) [-1212.730] (-1213.387) (-1214.692) -- 0:00:44
470000 -- [-1214.356] (-1213.913) (-1213.765) (-1216.886) * [-1213.634] (-1215.365) (-1216.148) (-1213.250) -- 0:00:43
Average standard deviation of split frequencies: 0.009348
471000 -- (-1213.749) (-1211.699) [-1212.072] (-1214.176) * (-1214.700) (-1213.422) [-1213.266] (-1213.114) -- 0:00:43
472000 -- (-1215.594) (-1214.894) [-1213.434] (-1213.804) * (-1218.740) [-1213.894] (-1214.563) (-1213.533) -- 0:00:43
473000 -- [-1214.381] (-1214.421) (-1213.369) (-1218.052) * [-1213.198] (-1217.519) (-1215.114) (-1215.357) -- 0:00:43
474000 -- (-1212.447) (-1216.587) [-1215.074] (-1215.514) * (-1214.607) (-1215.596) [-1212.286] (-1217.796) -- 0:00:43
475000 -- (-1213.348) [-1213.160] (-1216.302) (-1218.523) * (-1214.363) [-1215.303] (-1212.878) (-1214.055) -- 0:00:43
Average standard deviation of split frequencies: 0.010564
476000 -- (-1213.059) [-1216.680] (-1217.188) (-1217.456) * (-1213.793) (-1213.428) (-1212.815) [-1212.870] -- 0:00:42
477000 -- (-1215.152) (-1213.793) (-1217.398) [-1213.459] * (-1216.802) [-1212.657] (-1213.722) (-1213.950) -- 0:00:42
478000 -- [-1213.645] (-1213.175) (-1214.661) (-1215.685) * (-1214.842) (-1213.107) [-1213.542] (-1214.596) -- 0:00:43
479000 -- (-1214.173) (-1213.117) [-1214.986] (-1215.430) * [-1212.982] (-1213.620) (-1214.945) (-1215.030) -- 0:00:43
480000 -- (-1217.498) (-1214.255) [-1214.162] (-1213.944) * [-1212.273] (-1213.784) (-1214.417) (-1217.447) -- 0:00:43
Average standard deviation of split frequencies: 0.009807
481000 -- (-1214.717) (-1215.785) (-1213.037) [-1212.816] * (-1213.954) (-1215.718) [-1211.503] (-1214.275) -- 0:00:43
482000 -- [-1213.156] (-1215.326) (-1213.040) (-1215.685) * (-1214.913) (-1214.502) [-1212.731] (-1215.507) -- 0:00:42
483000 -- (-1218.837) (-1214.522) [-1213.352] (-1214.056) * (-1215.099) (-1214.514) [-1210.389] (-1214.167) -- 0:00:42
484000 -- (-1215.265) (-1213.044) [-1214.110] (-1215.982) * (-1215.779) (-1214.622) [-1211.657] (-1214.267) -- 0:00:42
485000 -- (-1214.706) [-1212.708] (-1214.582) (-1213.984) * (-1214.400) (-1215.464) [-1211.935] (-1214.660) -- 0:00:42
Average standard deviation of split frequencies: 0.010346
486000 -- (-1214.998) (-1216.294) [-1213.200] (-1213.782) * (-1216.024) (-1213.989) [-1211.911] (-1214.103) -- 0:00:42
487000 -- [-1212.481] (-1213.261) (-1212.931) (-1213.375) * (-1214.987) (-1213.769) [-1211.124] (-1213.122) -- 0:00:42
488000 -- (-1218.609) [-1213.784] (-1215.855) (-1213.219) * (-1212.957) (-1214.690) [-1212.375] (-1215.508) -- 0:00:41
489000 -- (-1214.589) (-1213.319) [-1214.468] (-1212.996) * (-1214.266) (-1215.376) [-1212.496] (-1217.304) -- 0:00:41
490000 -- [-1214.048] (-1214.236) (-1215.284) (-1212.589) * (-1215.117) (-1212.655) [-1213.595] (-1214.566) -- 0:00:42
Average standard deviation of split frequencies: 0.008967
491000 -- (-1214.326) (-1212.547) (-1219.699) [-1213.189] * (-1218.725) (-1213.308) (-1211.740) [-1214.153] -- 0:00:42
492000 -- [-1216.101] (-1219.675) (-1214.187) (-1214.594) * (-1213.644) (-1215.666) [-1216.039] (-1214.248) -- 0:00:42
493000 -- (-1214.859) (-1216.062) (-1212.358) [-1216.171] * (-1212.670) (-1217.429) [-1210.792] (-1215.741) -- 0:00:42
494000 -- (-1214.891) [-1213.408] (-1217.576) (-1215.353) * (-1213.317) (-1215.267) (-1212.694) [-1213.221] -- 0:00:41
495000 -- [-1212.912] (-1215.568) (-1218.041) (-1216.664) * (-1213.442) (-1214.015) [-1212.387] (-1216.037) -- 0:00:41
Average standard deviation of split frequencies: 0.010771
496000 -- (-1216.329) (-1213.925) [-1213.333] (-1213.040) * (-1212.971) (-1214.989) [-1216.283] (-1213.041) -- 0:00:41
497000 -- (-1214.662) (-1214.719) (-1212.862) [-1216.087] * (-1213.655) (-1213.283) [-1211.503] (-1213.066) -- 0:00:41
498000 -- [-1212.625] (-1214.221) (-1212.981) (-1213.250) * (-1217.836) (-1213.436) [-1212.247] (-1215.627) -- 0:00:41
499000 -- (-1214.884) (-1213.602) (-1213.545) [-1213.480] * (-1214.279) (-1216.282) [-1215.466] (-1213.923) -- 0:00:41
500000 -- (-1213.300) (-1213.675) (-1218.057) [-1215.511] * (-1216.913) (-1216.360) [-1214.089] (-1212.712) -- 0:00:41
Average standard deviation of split frequencies: 0.009416
501000 -- (-1213.159) [-1213.161] (-1213.973) (-1213.750) * (-1215.616) (-1214.081) [-1212.599] (-1215.403) -- 0:00:40
502000 -- (-1212.488) [-1213.261] (-1214.610) (-1214.619) * (-1214.489) (-1215.212) [-1213.372] (-1214.003) -- 0:00:41
503000 -- [-1212.900] (-1212.883) (-1214.506) (-1215.342) * (-1213.548) (-1214.762) [-1211.681] (-1212.809) -- 0:00:41
504000 -- (-1212.940) (-1212.895) [-1213.916] (-1214.287) * (-1214.331) (-1213.015) [-1212.713] (-1212.728) -- 0:00:41
505000 -- [-1214.220] (-1213.338) (-1212.745) (-1214.990) * (-1213.132) (-1213.462) [-1215.730] (-1214.139) -- 0:00:41
Average standard deviation of split frequencies: 0.010558
506000 -- (-1215.921) (-1212.971) [-1216.327] (-1219.576) * (-1217.839) (-1221.203) [-1210.455] (-1214.225) -- 0:00:41
507000 -- (-1215.240) (-1214.130) [-1213.436] (-1213.757) * (-1214.194) (-1214.752) [-1210.662] (-1216.613) -- 0:00:40
508000 -- (-1213.624) (-1214.786) [-1212.651] (-1213.695) * (-1213.630) (-1214.362) [-1210.078] (-1214.750) -- 0:00:40
509000 -- (-1213.662) (-1214.942) [-1216.637] (-1213.926) * (-1215.495) (-1213.346) [-1210.543] (-1212.761) -- 0:00:40
510000 -- (-1214.703) (-1215.809) (-1214.371) [-1213.757] * (-1215.346) (-1215.734) [-1213.001] (-1214.143) -- 0:00:40
Average standard deviation of split frequencies: 0.012308
511000 -- (-1216.105) (-1214.108) (-1214.107) [-1213.066] * (-1216.576) (-1220.120) [-1211.543] (-1212.431) -- 0:00:40
512000 -- (-1213.389) [-1213.772] (-1216.153) (-1215.514) * (-1214.580) (-1215.321) [-1211.424] (-1214.115) -- 0:00:40
513000 -- (-1212.781) (-1216.068) (-1213.473) [-1218.471] * (-1214.300) (-1213.728) [-1210.662] (-1213.191) -- 0:00:39
514000 -- (-1215.872) (-1214.215) (-1215.360) [-1214.777] * (-1214.791) (-1218.576) [-1214.276] (-1213.574) -- 0:00:40
515000 -- (-1220.658) (-1214.451) [-1214.510] (-1215.159) * (-1215.701) [-1218.583] (-1213.637) (-1214.653) -- 0:00:40
Average standard deviation of split frequencies: 0.014008
516000 -- (-1214.452) [-1213.819] (-1216.238) (-1217.318) * (-1213.547) (-1216.477) (-1208.961) [-1213.693] -- 0:00:40
517000 -- [-1213.389] (-1216.819) (-1213.147) (-1215.045) * (-1215.904) (-1215.618) [-1210.105] (-1213.257) -- 0:00:40
518000 -- (-1217.101) [-1214.817] (-1224.132) (-1213.362) * (-1212.890) (-1217.939) [-1213.422] (-1214.911) -- 0:00:40
519000 -- (-1214.739) (-1214.306) (-1213.898) [-1215.469] * (-1218.393) [-1216.735] (-1213.373) (-1214.034) -- 0:00:39
520000 -- [-1213.458] (-1213.383) (-1219.787) (-1214.189) * [-1215.007] (-1213.832) (-1212.652) (-1217.904) -- 0:00:39
Average standard deviation of split frequencies: 0.011468
521000 -- (-1214.652) (-1213.417) [-1215.160] (-1216.953) * (-1218.425) [-1214.503] (-1214.122) (-1213.050) -- 0:00:39
522000 -- (-1214.523) [-1215.871] (-1215.601) (-1217.543) * (-1215.629) (-1212.969) [-1213.609] (-1216.558) -- 0:00:39
523000 -- (-1213.626) [-1214.869] (-1215.056) (-1217.427) * [-1213.477] (-1216.646) (-1217.393) (-1216.081) -- 0:00:39
524000 -- [-1212.978] (-1215.787) (-1213.396) (-1214.655) * (-1213.321) (-1214.565) [-1210.470] (-1215.293) -- 0:00:39
525000 -- [-1213.118] (-1215.959) (-1215.190) (-1218.338) * [-1214.160] (-1213.503) (-1217.365) (-1212.892) -- 0:00:38
Average standard deviation of split frequencies: 0.013144
526000 -- [-1215.422] (-1212.891) (-1219.301) (-1214.237) * (-1214.410) (-1216.021) [-1213.868] (-1215.657) -- 0:00:38
527000 -- [-1215.585] (-1213.674) (-1213.015) (-1214.421) * (-1213.888) [-1213.483] (-1215.373) (-1216.434) -- 0:00:39
528000 -- (-1220.050) (-1215.746) (-1213.443) [-1213.953] * (-1213.687) [-1215.593] (-1214.404) (-1214.123) -- 0:00:39
529000 -- (-1224.672) (-1214.371) [-1213.535] (-1213.457) * [-1216.333] (-1214.322) (-1216.436) (-1213.605) -- 0:00:39
530000 -- (-1215.213) (-1215.101) [-1214.448] (-1222.858) * (-1217.237) (-1212.804) [-1214.524] (-1212.962) -- 0:00:39
Average standard deviation of split frequencies: 0.012437
531000 -- (-1218.834) (-1213.967) (-1213.138) [-1215.323] * (-1215.451) (-1217.146) (-1213.894) [-1212.870] -- 0:00:38
532000 -- [-1213.741] (-1213.903) (-1214.540) (-1213.625) * (-1214.618) (-1214.947) (-1214.857) [-1212.364] -- 0:00:38
533000 -- (-1213.735) (-1213.812) (-1217.358) [-1213.204] * [-1216.245] (-1215.820) (-1213.361) (-1218.151) -- 0:00:38
534000 -- (-1213.183) (-1216.157) (-1214.080) [-1214.814] * (-1214.607) (-1213.398) (-1215.115) [-1213.307] -- 0:00:38
535000 -- (-1214.054) [-1213.220] (-1212.746) (-1217.294) * [-1214.152] (-1213.320) (-1214.053) (-1214.953) -- 0:00:38
Average standard deviation of split frequencies: 0.012899
536000 -- (-1213.795) (-1213.697) (-1214.966) [-1213.005] * (-1216.380) (-1213.348) (-1215.744) [-1217.117] -- 0:00:38
537000 -- (-1212.495) (-1218.793) (-1214.603) [-1213.813] * (-1214.148) [-1213.378] (-1215.626) (-1215.294) -- 0:00:37
538000 -- (-1216.487) [-1212.999] (-1213.624) (-1216.599) * (-1214.698) (-1213.992) [-1210.259] (-1216.096) -- 0:00:37
539000 -- (-1212.668) (-1215.034) (-1213.313) [-1213.524] * (-1212.767) (-1215.054) [-1212.400] (-1213.710) -- 0:00:38
540000 -- [-1213.481] (-1214.794) (-1214.639) (-1213.737) * (-1213.973) (-1217.099) [-1210.351] (-1215.710) -- 0:00:38
Average standard deviation of split frequencies: 0.012207
541000 -- (-1215.259) (-1217.449) [-1213.553] (-1213.228) * (-1216.652) (-1213.540) [-1213.289] (-1213.332) -- 0:00:38
542000 -- (-1218.022) [-1216.175] (-1217.177) (-1221.819) * (-1214.081) (-1214.954) [-1210.944] (-1215.312) -- 0:00:38
543000 -- (-1214.601) (-1213.086) [-1216.039] (-1217.189) * (-1214.317) (-1213.903) [-1211.724] (-1215.559) -- 0:00:37
544000 -- [-1221.410] (-1215.513) (-1217.235) (-1212.093) * (-1215.115) (-1214.367) [-1209.522] (-1216.475) -- 0:00:37
545000 -- (-1219.151) [-1214.300] (-1218.065) (-1220.365) * (-1213.200) (-1215.356) [-1211.695] (-1213.631) -- 0:00:37
Average standard deviation of split frequencies: 0.012087
546000 -- [-1214.068] (-1212.859) (-1213.793) (-1214.487) * (-1212.984) (-1218.617) [-1210.010] (-1215.534) -- 0:00:37
547000 -- (-1214.448) [-1213.377] (-1215.285) (-1214.565) * (-1214.892) (-1214.208) [-1216.000] (-1215.783) -- 0:00:37
548000 -- (-1213.525) [-1213.341] (-1214.112) (-1213.966) * (-1215.726) (-1214.341) [-1212.942] (-1213.428) -- 0:00:37
549000 -- (-1215.352) (-1214.353) (-1213.959) [-1212.583] * (-1213.265) (-1215.711) [-1213.988] (-1213.626) -- 0:00:36
550000 -- (-1213.878) [-1215.484] (-1213.737) (-1213.396) * (-1213.266) (-1218.291) [-1212.855] (-1213.322) -- 0:00:36
Average standard deviation of split frequencies: 0.011414
551000 -- (-1213.224) (-1215.051) [-1213.083] (-1215.245) * (-1216.605) (-1213.155) [-1213.684] (-1220.211) -- 0:00:36
552000 -- [-1212.805] (-1217.116) (-1213.428) (-1216.102) * (-1219.851) (-1213.525) [-1211.608] (-1213.293) -- 0:00:37
553000 -- (-1215.537) (-1214.453) (-1214.556) [-1215.069] * (-1213.728) (-1215.626) [-1214.968] (-1213.776) -- 0:00:37
554000 -- [-1214.401] (-1216.034) (-1213.294) (-1213.808) * (-1214.756) (-1214.401) [-1209.674] (-1215.501) -- 0:00:37
555000 -- [-1213.978] (-1215.038) (-1213.348) (-1216.743) * (-1215.338) (-1218.572) [-1211.336] (-1212.982) -- 0:00:36
Average standard deviation of split frequencies: 0.013566
556000 -- (-1215.917) (-1214.635) [-1212.790] (-1215.084) * (-1214.464) (-1213.171) [-1210.733] (-1213.454) -- 0:00:36
557000 -- (-1215.978) (-1214.430) [-1213.497] (-1214.088) * (-1212.720) (-1215.912) [-1210.530] (-1212.922) -- 0:00:36
558000 -- (-1214.499) (-1215.531) [-1212.225] (-1215.614) * (-1218.712) (-1214.233) [-1210.665] (-1213.936) -- 0:00:36
559000 -- (-1214.319) (-1214.076) (-1215.508) [-1215.800] * (-1216.516) (-1216.058) [-1213.464] (-1215.201) -- 0:00:36
560000 -- (-1224.364) (-1218.231) [-1213.304] (-1214.805) * (-1215.817) (-1217.517) [-1210.993] (-1213.184) -- 0:00:36
Average standard deviation of split frequencies: 0.011771
561000 -- (-1214.919) (-1215.139) [-1213.434] (-1213.655) * (-1214.342) (-1218.031) [-1210.154] (-1213.509) -- 0:00:35
562000 -- (-1215.256) [-1215.022] (-1212.119) (-1212.686) * (-1216.691) (-1220.233) [-1211.591] (-1214.358) -- 0:00:35
563000 -- (-1217.492) (-1214.750) [-1213.624] (-1213.685) * (-1213.449) (-1215.299) [-1213.518] (-1213.234) -- 0:00:35
564000 -- [-1213.147] (-1214.493) (-1214.644) (-1213.900) * (-1214.967) (-1214.357) [-1213.018] (-1214.473) -- 0:00:36
565000 -- (-1213.686) [-1217.706] (-1217.386) (-1216.468) * (-1214.175) (-1217.297) [-1209.736] (-1214.919) -- 0:00:36
Average standard deviation of split frequencies: 0.011660
566000 -- [-1215.612] (-1213.511) (-1213.109) (-1217.083) * (-1213.890) (-1221.129) [-1210.908] (-1215.247) -- 0:00:36
567000 -- (-1215.072) (-1212.997) (-1213.629) [-1214.394] * (-1214.064) (-1220.401) [-1210.596] (-1216.769) -- 0:00:35
568000 -- (-1214.998) (-1214.732) (-1214.084) [-1212.856] * (-1214.632) (-1213.357) [-1212.631] (-1214.477) -- 0:00:35
569000 -- [-1214.579] (-1214.499) (-1217.837) (-1214.120) * (-1213.744) (-1216.551) [-1217.520] (-1215.901) -- 0:00:35
570000 -- (-1214.060) (-1215.307) (-1213.226) [-1214.901] * (-1216.024) (-1215.840) [-1210.958] (-1215.499) -- 0:00:35
Average standard deviation of split frequencies: 0.012116
571000 -- (-1214.012) [-1215.578] (-1214.932) (-1214.153) * (-1217.397) (-1214.816) [-1210.849] (-1214.827) -- 0:00:35
572000 -- (-1213.679) (-1213.371) [-1214.577] (-1216.609) * (-1216.762) (-1213.996) [-1214.808] (-1215.483) -- 0:00:35
573000 -- [-1212.881] (-1212.229) (-1215.183) (-1212.989) * (-1213.959) (-1217.248) [-1211.088] (-1218.653) -- 0:00:35
574000 -- (-1213.804) [-1215.076] (-1215.350) (-1218.506) * (-1215.111) (-1216.205) [-1210.278] (-1216.964) -- 0:00:34
575000 -- (-1215.810) [-1214.973] (-1216.936) (-1216.007) * (-1213.150) (-1215.236) [-1210.783] (-1219.506) -- 0:00:34
Average standard deviation of split frequencies: 0.012003
576000 -- (-1214.063) (-1213.486) [-1212.091] (-1216.177) * (-1215.316) (-1213.185) [-1210.263] (-1217.473) -- 0:00:34
577000 -- (-1214.125) (-1216.747) (-1220.631) [-1215.648] * (-1213.255) (-1213.219) [-1209.773] (-1213.457) -- 0:00:35
578000 -- (-1213.603) (-1213.600) (-1219.737) [-1213.273] * (-1213.799) (-1216.463) [-1209.861] (-1215.420) -- 0:00:35
579000 -- (-1213.640) (-1214.842) [-1217.359] (-1214.972) * (-1212.381) (-1216.586) [-1211.384] (-1214.675) -- 0:00:34
580000 -- [-1213.435] (-1216.542) (-1213.081) (-1215.066) * (-1215.327) (-1216.399) [-1211.623] (-1215.169) -- 0:00:34
Average standard deviation of split frequencies: 0.012989
581000 -- (-1213.697) (-1217.188) [-1213.096] (-1215.124) * (-1215.330) (-1212.810) [-1210.170] (-1214.849) -- 0:00:34
582000 -- [-1215.971] (-1213.223) (-1217.022) (-1212.655) * (-1213.396) (-1214.260) [-1211.308] (-1213.387) -- 0:00:34
583000 -- (-1215.812) (-1217.563) (-1212.964) [-1215.188] * (-1218.177) (-1217.096) [-1210.335] (-1212.747) -- 0:00:34
584000 -- (-1214.625) (-1215.830) (-1212.785) [-1214.513] * (-1215.094) (-1213.725) [-1212.320] (-1214.791) -- 0:00:34
585000 -- (-1214.316) (-1213.751) (-1215.970) [-1215.196] * (-1216.267) (-1214.569) [-1211.179] (-1214.248) -- 0:00:34
Average standard deviation of split frequencies: 0.012335
586000 -- [-1216.350] (-1217.221) (-1214.777) (-1214.392) * (-1214.925) (-1214.784) (-1212.273) [-1219.390] -- 0:00:33
587000 -- [-1214.059] (-1218.334) (-1213.168) (-1216.687) * (-1215.284) (-1217.076) [-1210.628] (-1214.812) -- 0:00:33
588000 -- (-1214.680) [-1215.115] (-1214.872) (-1214.154) * (-1213.367) (-1215.437) [-1213.927] (-1215.323) -- 0:00:33
589000 -- [-1218.373] (-1213.136) (-1215.308) (-1213.667) * (-1213.505) (-1214.265) [-1209.401] (-1218.222) -- 0:00:34
590000 -- (-1216.152) (-1214.704) (-1216.142) [-1212.540] * (-1216.982) (-1214.322) [-1209.606] (-1215.878) -- 0:00:34
Average standard deviation of split frequencies: 0.014898
591000 -- (-1215.894) (-1213.846) (-1220.216) [-1213.899] * [-1213.897] (-1220.081) (-1214.002) (-1213.231) -- 0:00:33
592000 -- (-1214.838) [-1214.322] (-1213.834) (-1214.453) * (-1219.967) (-1219.715) [-1213.387] (-1213.863) -- 0:00:33
593000 -- [-1214.628] (-1218.159) (-1213.722) (-1212.582) * [-1213.471] (-1217.451) (-1214.920) (-1214.338) -- 0:00:33
594000 -- (-1215.111) (-1214.064) (-1217.517) [-1214.633] * (-1214.973) (-1216.835) [-1213.306] (-1217.676) -- 0:00:33
595000 -- (-1215.638) (-1219.162) (-1213.186) [-1210.797] * (-1214.855) (-1213.666) (-1214.305) [-1215.171] -- 0:00:33
Average standard deviation of split frequencies: 0.015292
596000 -- (-1215.466) (-1219.968) (-1213.597) [-1212.186] * (-1215.067) [-1215.510] (-1212.888) (-1218.579) -- 0:00:33
597000 -- (-1213.715) (-1215.265) (-1213.143) [-1212.961] * (-1214.780) [-1213.340] (-1214.902) (-1217.718) -- 0:00:33
598000 -- (-1216.997) (-1219.212) (-1215.220) [-1211.112] * (-1215.965) [-1217.431] (-1214.845) (-1213.688) -- 0:00:32
599000 -- (-1215.957) (-1214.627) (-1214.783) [-1217.038] * (-1214.559) (-1212.735) (-1213.336) [-1216.166] -- 0:00:32
600000 -- (-1213.553) (-1213.714) (-1216.071) [-1211.556] * (-1214.046) (-1213.474) (-1212.690) [-1214.848] -- 0:00:32
Average standard deviation of split frequencies: 0.015173
601000 -- (-1213.855) (-1217.152) [-1215.055] (-1214.528) * (-1214.032) (-1214.232) (-1213.306) [-1213.274] -- 0:00:32
602000 -- (-1214.886) (-1212.998) [-1215.430] (-1212.364) * (-1216.955) [-1215.133] (-1219.062) (-1212.768) -- 0:00:33
603000 -- (-1213.724) (-1215.569) [-1213.295] (-1213.970) * (-1216.555) (-1213.107) [-1213.833] (-1215.112) -- 0:00:32
604000 -- (-1214.523) (-1212.863) [-1215.138] (-1213.811) * (-1215.322) (-1213.780) [-1217.107] (-1214.337) -- 0:00:32
605000 -- [-1212.686] (-1213.634) (-1215.573) (-1215.734) * (-1213.000) (-1215.195) (-1212.673) [-1212.811] -- 0:00:32
Average standard deviation of split frequencies: 0.014521
606000 -- [-1214.779] (-1215.649) (-1214.789) (-1214.222) * [-1213.705] (-1214.634) (-1218.963) (-1214.797) -- 0:00:32
607000 -- (-1214.240) [-1212.424] (-1216.648) (-1214.095) * (-1213.359) [-1214.684] (-1214.162) (-1213.172) -- 0:00:32
608000 -- (-1214.919) (-1218.584) (-1213.685) [-1214.447] * (-1216.735) (-1213.673) (-1216.788) [-1215.217] -- 0:00:32
609000 -- (-1213.300) (-1217.003) [-1214.584] (-1214.232) * (-1213.820) [-1213.548] (-1213.895) (-1215.205) -- 0:00:32
610000 -- (-1212.552) [-1214.753] (-1213.598) (-1213.988) * (-1217.559) [-1213.132] (-1214.250) (-1214.308) -- 0:00:31
Average standard deviation of split frequencies: 0.015439
611000 -- (-1215.861) (-1217.461) (-1212.585) [-1214.010] * (-1213.555) [-1214.979] (-1215.463) (-1214.018) -- 0:00:31
612000 -- (-1215.243) (-1219.343) (-1216.079) [-1212.889] * (-1215.736) (-1215.678) [-1215.088] (-1213.887) -- 0:00:31
613000 -- (-1213.784) (-1213.034) [-1213.590] (-1214.465) * (-1214.129) (-1216.011) (-1214.702) [-1213.479] -- 0:00:31
614000 -- (-1214.470) [-1217.547] (-1214.917) (-1216.670) * (-1213.432) (-1215.331) (-1220.580) [-1212.982] -- 0:00:31
615000 -- (-1213.427) (-1213.559) (-1213.783) [-1213.079] * (-1215.190) [-1212.927] (-1217.870) (-1214.402) -- 0:00:31
Average standard deviation of split frequencies: 0.014795
616000 -- (-1214.136) (-1216.115) (-1214.398) [-1212.693] * (-1213.689) [-1213.804] (-1216.666) (-1215.513) -- 0:00:31
617000 -- (-1213.106) [-1211.846] (-1215.541) (-1216.408) * (-1218.080) (-1215.194) (-1213.434) [-1213.911] -- 0:00:31
618000 -- (-1216.700) [-1214.653] (-1215.155) (-1215.022) * (-1213.910) (-1215.007) [-1213.582] (-1213.316) -- 0:00:31
619000 -- (-1215.144) [-1214.362] (-1214.313) (-1215.881) * (-1214.528) (-1213.730) (-1213.486) [-1212.958] -- 0:00:31
620000 -- (-1215.518) [-1215.247] (-1213.220) (-1214.868) * (-1214.551) (-1213.051) [-1213.671] (-1214.786) -- 0:00:31
Average standard deviation of split frequencies: 0.013671
621000 -- (-1221.331) (-1213.135) (-1212.964) [-1214.655] * [-1214.410] (-1212.797) (-1215.153) (-1214.227) -- 0:00:31
622000 -- (-1216.601) [-1214.212] (-1214.940) (-1215.872) * (-1213.791) [-1213.377] (-1214.469) (-1216.032) -- 0:00:30
623000 -- (-1214.017) (-1213.628) (-1215.118) [-1213.223] * (-1215.310) [-1215.104] (-1213.702) (-1214.269) -- 0:00:30
624000 -- (-1213.929) [-1214.612] (-1213.087) (-1213.424) * (-1213.987) (-1215.131) [-1214.572] (-1215.508) -- 0:00:30
625000 -- (-1214.006) (-1213.638) (-1215.794) [-1212.969] * (-1213.823) [-1214.767] (-1213.790) (-1213.080) -- 0:00:30
Average standard deviation of split frequencies: 0.015061
626000 -- [-1214.524] (-1213.783) (-1214.690) (-1214.537) * (-1214.070) (-1214.373) (-1217.948) [-1213.716] -- 0:00:30
627000 -- (-1216.174) (-1213.816) [-1214.037] (-1213.993) * (-1216.037) (-1214.605) (-1213.761) [-1214.145] -- 0:00:30
628000 -- (-1218.048) [-1214.798] (-1215.632) (-1214.317) * (-1218.034) (-1215.293) (-1214.595) [-1216.225] -- 0:00:30
629000 -- (-1211.448) [-1211.020] (-1214.514) (-1212.097) * (-1214.151) (-1214.848) [-1214.350] (-1217.389) -- 0:00:30
630000 -- (-1214.795) (-1214.292) (-1215.351) [-1213.398] * (-1214.920) (-1214.532) [-1213.671] (-1213.884) -- 0:00:30
Average standard deviation of split frequencies: 0.014949
631000 -- (-1213.641) (-1215.562) (-1213.636) [-1216.234] * [-1213.521] (-1215.008) (-1215.763) (-1214.073) -- 0:00:30
632000 -- [-1214.979] (-1214.217) (-1215.938) (-1218.034) * (-1219.595) (-1217.473) (-1215.723) [-1216.122] -- 0:00:30
633000 -- (-1214.237) (-1213.624) (-1215.028) [-1216.306] * (-1214.603) (-1214.242) [-1214.024] (-1213.828) -- 0:00:30
634000 -- (-1217.059) (-1213.027) [-1214.500] (-1216.295) * (-1218.883) [-1213.861] (-1213.940) (-1214.934) -- 0:00:30
635000 -- (-1215.153) [-1213.546] (-1216.592) (-1213.018) * (-1213.421) (-1215.800) [-1213.221] (-1215.581) -- 0:00:29
Average standard deviation of split frequencies: 0.015812
636000 -- [-1213.669] (-1214.623) (-1217.806) (-1217.557) * (-1214.017) (-1215.080) (-1214.361) [-1213.109] -- 0:00:29
637000 -- (-1213.878) (-1212.886) [-1213.879] (-1217.433) * (-1217.017) (-1213.704) (-1213.614) [-1216.269] -- 0:00:29
638000 -- [-1214.346] (-1213.460) (-1213.658) (-1213.444) * [-1214.424] (-1215.188) (-1219.794) (-1212.717) -- 0:00:29
639000 -- (-1216.273) [-1214.387] (-1212.979) (-1213.263) * (-1214.433) (-1214.182) (-1216.569) [-1212.877] -- 0:00:29
640000 -- [-1226.032] (-1212.572) (-1213.603) (-1215.149) * (-1216.323) (-1213.090) (-1215.570) [-1213.666] -- 0:00:29
Average standard deviation of split frequencies: 0.015207
641000 -- (-1214.413) [-1214.197] (-1213.813) (-1213.283) * [-1213.143] (-1213.984) (-1212.927) (-1216.873) -- 0:00:29
642000 -- (-1215.120) (-1215.357) [-1215.468] (-1213.257) * (-1213.553) (-1214.586) (-1213.646) [-1213.964] -- 0:00:29
643000 -- (-1213.467) [-1213.647] (-1216.076) (-1213.478) * [-1212.983] (-1217.512) (-1212.998) (-1214.320) -- 0:00:29
644000 -- (-1215.911) [-1213.824] (-1214.420) (-1214.269) * (-1217.262) (-1214.986) (-1216.066) [-1214.938] -- 0:00:29
645000 -- (-1213.523) [-1213.324] (-1214.930) (-1213.170) * (-1213.722) [-1213.363] (-1214.091) (-1213.003) -- 0:00:29
Average standard deviation of split frequencies: 0.014595
646000 -- [-1212.618] (-1215.639) (-1214.523) (-1214.363) * (-1215.498) [-1212.592] (-1214.006) (-1214.426) -- 0:00:29
647000 -- [-1209.957] (-1219.558) (-1213.732) (-1213.988) * (-1213.942) (-1213.740) (-1218.153) [-1215.574] -- 0:00:28
648000 -- [-1211.736] (-1214.202) (-1214.027) (-1216.257) * (-1212.903) (-1214.350) [-1213.200] (-1220.501) -- 0:00:28
649000 -- (-1214.374) (-1222.432) (-1214.081) [-1212.503] * (-1213.689) [-1216.461] (-1213.220) (-1214.329) -- 0:00:28
650000 -- (-1213.120) (-1213.447) (-1214.867) [-1215.145] * (-1215.151) (-1215.594) (-1216.067) [-1213.546] -- 0:00:28
Average standard deviation of split frequencies: 0.014007
651000 -- (-1221.813) (-1214.050) [-1217.632] (-1216.240) * (-1214.475) (-1213.964) (-1216.635) [-1212.949] -- 0:00:28
652000 -- (-1213.075) (-1217.629) [-1212.559] (-1213.320) * (-1213.782) [-1213.647] (-1212.717) (-1214.651) -- 0:00:28
653000 -- (-1212.530) (-1213.845) [-1210.990] (-1215.427) * [-1213.302] (-1214.566) (-1219.066) (-1215.528) -- 0:00:28
654000 -- [-1215.430] (-1212.837) (-1213.876) (-1216.430) * (-1213.934) (-1215.554) (-1212.722) [-1215.661] -- 0:00:28
655000 -- [-1214.007] (-1213.172) (-1215.195) (-1213.625) * (-1215.091) [-1213.395] (-1214.525) (-1214.030) -- 0:00:28
Average standard deviation of split frequencies: 0.013893
656000 -- (-1215.168) [-1213.215] (-1216.748) (-1223.227) * (-1219.362) (-1212.983) [-1212.893] (-1214.116) -- 0:00:28
657000 -- (-1216.355) [-1212.815] (-1213.178) (-1216.517) * (-1213.171) [-1212.507] (-1214.337) (-1214.120) -- 0:00:28
658000 -- [-1213.034] (-1213.954) (-1215.689) (-1213.351) * [-1213.422] (-1213.827) (-1219.462) (-1216.485) -- 0:00:28
659000 -- (-1212.571) [-1214.553] (-1214.455) (-1213.344) * (-1216.571) (-1214.232) [-1214.394] (-1215.651) -- 0:00:27
660000 -- (-1214.285) [-1214.050] (-1217.454) (-1215.232) * (-1214.968) [-1215.785] (-1214.296) (-1215.934) -- 0:00:27
Average standard deviation of split frequencies: 0.013795
661000 -- (-1214.563) (-1214.534) (-1214.823) [-1215.495] * (-1214.330) (-1217.777) (-1213.186) [-1213.682] -- 0:00:27
662000 -- (-1213.235) (-1213.571) (-1218.190) [-1214.832] * (-1214.610) (-1213.918) [-1212.608] (-1215.144) -- 0:00:27
663000 -- (-1219.070) [-1214.004] (-1215.282) (-1213.523) * (-1213.233) [-1212.692] (-1214.058) (-1216.325) -- 0:00:27
664000 -- (-1217.951) [-1213.970] (-1214.247) (-1214.537) * (-1214.495) (-1213.837) [-1217.849] (-1212.734) -- 0:00:27
665000 -- (-1216.391) [-1213.504] (-1215.362) (-1213.750) * [-1212.928] (-1212.783) (-1214.497) (-1212.782) -- 0:00:27
Average standard deviation of split frequencies: 0.014156
666000 -- [-1213.171] (-1215.704) (-1214.807) (-1213.378) * (-1213.140) [-1216.054] (-1214.295) (-1214.997) -- 0:00:27
667000 -- (-1214.169) (-1217.855) (-1213.456) [-1212.307] * (-1218.196) [-1212.911] (-1213.398) (-1213.143) -- 0:00:27
668000 -- (-1214.900) (-1212.682) [-1215.633] (-1214.544) * [-1212.443] (-1216.337) (-1213.288) (-1214.710) -- 0:00:27
669000 -- (-1213.949) [-1215.485] (-1215.806) (-1212.695) * (-1213.506) [-1214.217] (-1215.973) (-1215.344) -- 0:00:27
670000 -- (-1213.172) [-1216.115] (-1212.896) (-1214.300) * (-1212.865) [-1213.345] (-1216.206) (-1213.241) -- 0:00:27
Average standard deviation of split frequencies: 0.014526
671000 -- (-1215.742) [-1211.029] (-1212.887) (-1214.607) * (-1212.845) [-1215.103] (-1213.798) (-1216.386) -- 0:00:26
672000 -- (-1215.093) [-1211.851] (-1215.139) (-1212.796) * [-1215.688] (-1212.909) (-1214.595) (-1217.822) -- 0:00:26
673000 -- (-1216.540) [-1211.855] (-1213.268) (-1215.385) * [-1213.607] (-1215.004) (-1213.586) (-1214.214) -- 0:00:26
674000 -- (-1216.864) [-1212.871] (-1214.959) (-1215.482) * (-1212.967) (-1216.038) [-1215.192] (-1213.988) -- 0:00:26
675000 -- (-1213.123) [-1211.458] (-1214.899) (-1212.676) * (-1216.352) [-1214.566] (-1213.353) (-1214.798) -- 0:00:26
Average standard deviation of split frequencies: 0.013482
676000 -- (-1217.774) [-1210.115] (-1216.310) (-1214.130) * (-1213.309) (-1214.011) (-1218.084) [-1214.362] -- 0:00:26
677000 -- (-1212.996) [-1211.393] (-1213.685) (-1213.682) * (-1216.161) [-1214.178] (-1213.206) (-1213.436) -- 0:00:26
678000 -- (-1213.186) [-1212.236] (-1217.247) (-1214.457) * (-1213.768) [-1213.783] (-1214.430) (-1214.278) -- 0:00:26
679000 -- (-1213.266) [-1212.254] (-1215.292) (-1214.769) * (-1214.658) (-1212.995) [-1215.304] (-1214.054) -- 0:00:26
680000 -- (-1215.229) [-1213.298] (-1215.206) (-1214.542) * (-1213.232) (-1215.824) (-1213.377) [-1213.656] -- 0:00:26
Average standard deviation of split frequencies: 0.013390
681000 -- (-1214.559) [-1210.345] (-1214.354) (-1214.759) * (-1213.200) [-1215.204] (-1214.292) (-1214.712) -- 0:00:26
682000 -- (-1214.749) [-1211.680] (-1214.573) (-1215.034) * (-1213.819) (-1213.866) (-1213.150) [-1211.000] -- 0:00:26
683000 -- (-1214.945) [-1211.879] (-1214.458) (-1217.826) * (-1213.850) (-1213.808) (-1215.728) [-1215.483] -- 0:00:25
684000 -- (-1212.850) [-1212.529] (-1213.828) (-1216.166) * (-1214.611) (-1216.089) (-1215.560) [-1211.820] -- 0:00:25
685000 -- (-1213.044) [-1212.800] (-1217.261) (-1213.730) * (-1213.380) (-1218.776) (-1213.411) [-1211.252] -- 0:00:25
Average standard deviation of split frequencies: 0.013744
686000 -- (-1214.804) [-1210.801] (-1216.533) (-1213.448) * (-1217.548) (-1213.447) [-1212.459] (-1214.517) -- 0:00:25
687000 -- (-1214.531) [-1210.247] (-1214.278) (-1217.699) * (-1219.965) [-1213.300] (-1214.514) (-1213.778) -- 0:00:25
688000 -- (-1214.553) (-1212.312) (-1213.979) [-1212.858] * [-1213.232] (-1213.312) (-1212.583) (-1214.468) -- 0:00:25
689000 -- (-1212.392) [-1212.599] (-1214.353) (-1216.092) * (-1214.275) (-1215.864) [-1213.863] (-1214.822) -- 0:00:25
690000 -- (-1213.295) [-1211.612] (-1214.061) (-1214.074) * (-1212.945) [-1215.156] (-1215.582) (-1214.504) -- 0:00:25
Average standard deviation of split frequencies: 0.015016
691000 -- (-1213.216) [-1213.253] (-1215.541) (-1214.707) * (-1212.625) [-1214.711] (-1214.217) (-1214.319) -- 0:00:25
692000 -- (-1214.740) [-1211.971] (-1212.763) (-1215.845) * [-1214.974] (-1213.784) (-1219.733) (-1213.702) -- 0:00:25
693000 -- (-1213.110) [-1212.653] (-1224.659) (-1214.586) * (-1215.859) (-1212.588) (-1213.860) [-1213.315] -- 0:00:25
694000 -- (-1215.099) (-1211.515) [-1214.429] (-1215.932) * (-1214.145) [-1211.654] (-1212.841) (-1213.633) -- 0:00:25
695000 -- (-1214.973) [-1211.075] (-1214.612) (-1212.954) * (-1213.290) (-1214.309) [-1214.654] (-1214.176) -- 0:00:25
Average standard deviation of split frequencies: 0.015804
696000 -- (-1214.301) [-1212.990] (-1220.633) (-1215.352) * (-1215.235) (-1216.058) (-1215.201) [-1215.425] -- 0:00:24
697000 -- (-1213.484) [-1212.151] (-1215.795) (-1213.339) * (-1212.133) [-1214.399] (-1216.447) (-1212.638) -- 0:00:24
698000 -- (-1212.241) [-1212.847] (-1215.530) (-1213.630) * (-1216.661) [-1213.598] (-1213.850) (-1216.176) -- 0:00:24
699000 -- (-1214.784) [-1211.599] (-1218.764) (-1213.102) * [-1214.799] (-1213.929) (-1213.690) (-1216.459) -- 0:00:24
700000 -- (-1215.367) [-1212.173] (-1213.067) (-1214.981) * (-1215.851) [-1213.744] (-1213.360) (-1225.163) -- 0:00:24
Average standard deviation of split frequencies: 0.017493
701000 -- (-1215.456) [-1211.457] (-1213.587) (-1213.382) * (-1216.525) (-1213.129) [-1213.008] (-1216.017) -- 0:00:24
702000 -- (-1215.452) [-1210.667] (-1215.576) (-1214.211) * (-1219.652) [-1215.585] (-1214.289) (-1215.279) -- 0:00:24
703000 -- (-1213.259) [-1211.714] (-1217.725) (-1213.672) * (-1213.237) [-1214.944] (-1215.501) (-1215.242) -- 0:00:24
704000 -- (-1212.898) [-1211.654] (-1214.070) (-1218.795) * (-1214.881) (-1213.746) [-1213.806] (-1214.197) -- 0:00:24
705000 -- (-1214.948) [-1211.625] (-1212.712) (-1221.673) * [-1218.783] (-1215.458) (-1214.519) (-1216.864) -- 0:00:24
Average standard deviation of split frequencies: 0.016470
706000 -- (-1212.845) [-1212.222] (-1215.552) (-1214.769) * (-1218.639) [-1215.134] (-1215.542) (-1214.773) -- 0:00:24
707000 -- (-1216.018) [-1214.463] (-1215.267) (-1214.027) * (-1214.127) (-1214.107) (-1214.132) [-1216.450] -- 0:00:24
708000 -- (-1217.402) [-1218.792] (-1213.401) (-1213.794) * [-1214.362] (-1213.363) (-1213.437) (-1215.303) -- 0:00:23
709000 -- (-1213.987) [-1212.033] (-1217.638) (-1215.298) * (-1216.166) (-1213.660) [-1214.279] (-1212.849) -- 0:00:23
710000 -- (-1213.234) [-1212.983] (-1216.400) (-1213.679) * (-1216.145) (-1216.463) [-1212.876] (-1213.037) -- 0:00:23
Average standard deviation of split frequencies: 0.015035
711000 -- (-1213.554) (-1214.309) (-1212.935) [-1214.251] * (-1212.971) (-1214.848) [-1212.816] (-1215.204) -- 0:00:23
712000 -- (-1213.401) [-1212.168] (-1212.984) (-1215.738) * (-1216.401) (-1215.226) [-1213.343] (-1215.653) -- 0:00:23
713000 -- (-1214.146) [-1211.021] (-1212.770) (-1214.966) * [-1214.606] (-1214.910) (-1218.074) (-1218.101) -- 0:00:23
714000 -- (-1214.570) [-1209.705] (-1216.102) (-1213.824) * (-1213.103) (-1213.495) [-1213.650] (-1215.730) -- 0:00:23
715000 -- (-1214.321) [-1218.428] (-1217.092) (-1213.979) * (-1214.413) (-1214.086) [-1216.335] (-1213.071) -- 0:00:23
Average standard deviation of split frequencies: 0.014923
716000 -- (-1214.750) [-1210.871] (-1213.689) (-1214.474) * [-1216.090] (-1223.450) (-1216.314) (-1212.834) -- 0:00:23
717000 -- (-1213.168) [-1212.564] (-1218.782) (-1212.566) * [-1213.295] (-1214.755) (-1212.396) (-1212.971) -- 0:00:23
718000 -- (-1214.142) [-1209.831] (-1213.597) (-1214.396) * (-1213.818) (-1217.628) [-1213.744] (-1214.327) -- 0:00:23
719000 -- (-1221.995) [-1211.883] (-1214.630) (-1216.495) * (-1213.766) (-1216.491) (-1214.002) [-1213.517] -- 0:00:23
720000 -- (-1215.490) [-1212.894] (-1215.005) (-1214.276) * [-1213.135] (-1213.862) (-1214.723) (-1214.128) -- 0:00:22
Average standard deviation of split frequencies: 0.014827
721000 -- (-1212.752) [-1210.891] (-1216.235) (-1216.260) * (-1216.410) (-1213.673) (-1212.939) [-1214.646] -- 0:00:22
722000 -- (-1213.250) [-1212.889] (-1215.628) (-1214.939) * [-1215.765] (-1214.069) (-1213.054) (-1216.602) -- 0:00:22
723000 -- (-1215.416) [-1211.946] (-1214.813) (-1217.080) * [-1215.761] (-1214.312) (-1214.177) (-1214.390) -- 0:00:22
724000 -- (-1213.122) [-1210.694] (-1213.522) (-1216.015) * (-1215.845) [-1214.056] (-1212.513) (-1213.491) -- 0:00:22
725000 -- (-1215.020) [-1213.246] (-1214.794) (-1213.179) * (-1214.963) [-1212.300] (-1213.458) (-1213.071) -- 0:00:22
Average standard deviation of split frequencies: 0.013419
726000 -- (-1213.169) [-1214.413] (-1215.725) (-1215.918) * (-1214.825) (-1215.419) (-1216.484) [-1216.155] -- 0:00:22
727000 -- (-1213.755) [-1214.670] (-1220.922) (-1215.754) * (-1214.734) [-1215.181] (-1214.739) (-1214.898) -- 0:00:22
728000 -- (-1212.966) [-1212.653] (-1213.342) (-1214.185) * (-1214.159) [-1212.864] (-1221.080) (-1214.618) -- 0:00:22
729000 -- (-1215.720) [-1211.605] (-1217.294) (-1215.082) * (-1213.949) (-1213.731) (-1212.768) [-1214.402] -- 0:00:22
730000 -- (-1213.891) [-1210.259] (-1216.746) (-1214.005) * (-1214.776) [-1212.695] (-1214.020) (-1212.635) -- 0:00:22
Average standard deviation of split frequencies: 0.012473
731000 -- (-1212.942) [-1211.023] (-1212.729) (-1217.149) * [-1214.320] (-1214.369) (-1212.303) (-1213.859) -- 0:00:22
732000 -- (-1214.015) [-1212.703] (-1212.755) (-1214.663) * (-1213.446) (-1217.953) (-1214.967) [-1215.264] -- 0:00:21
733000 -- (-1214.022) [-1215.001] (-1215.878) (-1214.746) * (-1213.576) [-1215.611] (-1215.248) (-1213.198) -- 0:00:21
734000 -- (-1218.264) [-1211.651] (-1216.558) (-1212.713) * (-1213.557) [-1215.017] (-1216.225) (-1215.067) -- 0:00:21
735000 -- (-1216.522) [-1211.383] (-1214.816) (-1215.307) * (-1222.380) [-1213.090] (-1215.750) (-1215.897) -- 0:00:21
Average standard deviation of split frequencies: 0.011529
736000 -- (-1213.734) [-1213.366] (-1213.953) (-1217.531) * [-1214.457] (-1214.342) (-1213.846) (-1216.393) -- 0:00:21
737000 -- (-1215.824) [-1212.149] (-1218.765) (-1216.530) * (-1213.185) (-1216.338) (-1214.453) [-1217.082] -- 0:00:21
738000 -- (-1213.289) [-1212.420] (-1212.529) (-1215.812) * (-1213.925) (-1215.367) (-1219.763) [-1212.484] -- 0:00:21
739000 -- (-1212.881) [-1213.371] (-1213.091) (-1213.885) * [-1213.598] (-1217.003) (-1213.936) (-1217.351) -- 0:00:21
740000 -- (-1215.264) [-1212.977] (-1215.301) (-1220.395) * (-1215.254) (-1216.160) (-1213.614) [-1213.334] -- 0:00:21
Average standard deviation of split frequencies: 0.011032
741000 -- (-1214.843) [-1214.316] (-1215.595) (-1217.499) * (-1217.696) (-1215.670) (-1215.796) [-1209.863] -- 0:00:21
742000 -- (-1212.807) [-1210.770] (-1217.303) (-1214.744) * (-1213.946) (-1213.202) (-1212.552) [-1211.672] -- 0:00:21
743000 -- (-1213.550) [-1209.985] (-1213.621) (-1212.985) * [-1212.645] (-1214.168) (-1215.427) (-1215.931) -- 0:00:21
744000 -- (-1216.330) [-1212.283] (-1214.973) (-1213.334) * (-1213.382) (-1213.416) [-1213.527] (-1219.792) -- 0:00:20
745000 -- (-1214.110) [-1213.607] (-1213.650) (-1214.017) * (-1213.357) (-1216.552) [-1214.609] (-1218.605) -- 0:00:20
Average standard deviation of split frequencies: 0.010111
746000 -- (-1214.036) [-1211.101] (-1215.198) (-1213.796) * (-1216.589) (-1214.708) (-1215.558) [-1217.445] -- 0:00:20
747000 -- (-1213.848) [-1212.401] (-1212.776) (-1217.030) * [-1214.599] (-1212.627) (-1212.302) (-1214.658) -- 0:00:20
748000 -- (-1215.286) [-1210.432] (-1217.783) (-1214.966) * [-1216.450] (-1214.267) (-1216.469) (-1214.875) -- 0:00:20
749000 -- (-1215.250) [-1213.085] (-1215.889) (-1215.050) * [-1217.623] (-1217.110) (-1213.823) (-1213.997) -- 0:00:20
750000 -- (-1215.536) [-1211.772] (-1218.158) (-1216.189) * (-1215.384) (-1215.983) [-1222.675] (-1215.516) -- 0:00:20
Average standard deviation of split frequencies: 0.010048
751000 -- (-1212.817) [-1209.440] (-1213.319) (-1213.791) * (-1216.548) (-1215.258) [-1212.396] (-1217.278) -- 0:00:20
752000 -- (-1216.160) [-1212.423] (-1214.391) (-1213.950) * [-1213.182] (-1216.575) (-1214.739) (-1214.217) -- 0:00:20
753000 -- (-1215.554) [-1209.144] (-1213.453) (-1213.535) * (-1215.407) (-1215.730) (-1213.325) [-1214.595] -- 0:00:20
754000 -- (-1214.269) [-1210.214] (-1217.452) (-1214.682) * (-1214.460) [-1212.969] (-1213.787) (-1212.420) -- 0:00:20
755000 -- (-1213.609) [-1209.872] (-1216.046) (-1214.691) * (-1212.803) (-1216.050) (-1215.147) [-1213.448] -- 0:00:20
Average standard deviation of split frequencies: 0.010393
756000 -- (-1212.834) [-1209.909] (-1214.055) (-1213.797) * (-1212.636) [-1213.219] (-1213.182) (-1212.354) -- 0:00:20
757000 -- (-1215.614) [-1211.654] (-1213.336) (-1216.889) * (-1215.492) (-1215.842) [-1213.167] (-1215.079) -- 0:00:19
758000 -- (-1216.349) [-1213.143] (-1214.351) (-1216.551) * (-1214.721) (-1217.698) [-1213.019] (-1217.416) -- 0:00:19
759000 -- (-1213.194) [-1210.648] (-1220.075) (-1219.065) * (-1213.235) [-1218.782] (-1221.784) (-1212.942) -- 0:00:19
760000 -- (-1213.170) [-1210.913] (-1215.291) (-1213.649) * [-1214.317] (-1214.311) (-1214.501) (-1213.374) -- 0:00:19
Average standard deviation of split frequencies: 0.010329
761000 -- (-1214.189) [-1210.716] (-1214.790) (-1212.605) * (-1214.241) [-1214.729] (-1215.506) (-1215.285) -- 0:00:19
762000 -- [-1213.186] (-1212.352) (-1214.870) (-1217.930) * (-1213.546) (-1213.676) [-1214.635] (-1213.497) -- 0:00:19
763000 -- (-1212.922) [-1211.010] (-1216.127) (-1214.627) * (-1214.877) [-1214.354] (-1215.394) (-1213.436) -- 0:00:19
764000 -- (-1214.451) [-1212.667] (-1215.798) (-1213.879) * (-1214.244) [-1214.382] (-1213.514) (-1214.060) -- 0:00:19
765000 -- (-1213.732) [-1210.275] (-1213.340) (-1214.143) * (-1214.140) [-1215.193] (-1212.939) (-1213.528) -- 0:00:19
Average standard deviation of split frequencies: 0.009436
766000 -- (-1214.657) [-1214.774] (-1214.456) (-1216.146) * (-1213.009) [-1212.921] (-1213.614) (-1212.305) -- 0:00:19
767000 -- (-1213.272) [-1211.108] (-1214.005) (-1214.828) * (-1217.318) [-1213.133] (-1215.507) (-1215.760) -- 0:00:19
768000 -- (-1214.774) [-1210.099] (-1214.348) (-1215.625) * (-1215.976) [-1213.525] (-1214.500) (-1214.495) -- 0:00:19
769000 -- (-1215.417) [-1210.395] (-1212.838) (-1213.946) * (-1214.258) (-1213.701) (-1213.693) [-1213.024] -- 0:00:18
770000 -- (-1212.570) [-1210.492] (-1216.005) (-1220.252) * [-1217.408] (-1213.014) (-1212.615) (-1215.861) -- 0:00:18
Average standard deviation of split frequencies: 0.009379
771000 -- (-1215.526) [-1211.868] (-1213.545) (-1214.011) * (-1215.294) [-1214.575] (-1215.000) (-1219.110) -- 0:00:18
772000 -- (-1215.500) (-1216.719) (-1215.575) [-1214.234] * (-1215.740) [-1214.880] (-1216.584) (-1214.949) -- 0:00:18
773000 -- (-1213.842) [-1213.144] (-1213.900) (-1211.844) * (-1215.566) (-1213.555) [-1214.579] (-1213.735) -- 0:00:18
774000 -- (-1214.592) [-1213.309] (-1213.444) (-1216.487) * (-1217.496) (-1215.239) (-1214.417) [-1214.666] -- 0:00:18
775000 -- (-1213.852) [-1211.663] (-1214.703) (-1213.083) * (-1215.025) [-1212.609] (-1213.481) (-1216.266) -- 0:00:18
Average standard deviation of split frequencies: 0.007290
776000 -- (-1214.089) [-1214.176] (-1213.656) (-1213.710) * (-1216.367) (-1216.305) [-1214.464] (-1218.738) -- 0:00:18
777000 -- (-1213.608) [-1211.451] (-1215.348) (-1213.317) * [-1215.355] (-1215.359) (-1213.763) (-1215.145) -- 0:00:18
778000 -- (-1213.531) [-1212.854] (-1215.522) (-1220.096) * (-1215.855) [-1213.252] (-1215.567) (-1214.610) -- 0:00:18
779000 -- (-1213.002) [-1214.696] (-1212.992) (-1216.043) * (-1216.167) (-1215.797) [-1214.989] (-1215.873) -- 0:00:18
780000 -- (-1216.251) [-1211.350] (-1213.132) (-1218.237) * (-1215.383) [-1212.814] (-1213.302) (-1213.928) -- 0:00:18
Average standard deviation of split frequencies: 0.006844
781000 -- (-1215.124) [-1212.759] (-1215.708) (-1213.526) * (-1213.333) (-1213.795) [-1213.331] (-1213.922) -- 0:00:17
782000 -- (-1213.910) [-1211.538] (-1212.585) (-1215.966) * (-1213.375) [-1215.734] (-1213.751) (-1214.414) -- 0:00:17
783000 -- (-1213.087) [-1211.387] (-1215.254) (-1217.716) * (-1214.532) (-1213.468) (-1213.756) [-1214.262] -- 0:00:17
784000 -- (-1213.905) [-1210.828] (-1215.256) (-1213.823) * [-1215.975] (-1213.637) (-1215.068) (-1213.890) -- 0:00:17
785000 -- (-1215.230) [-1212.025] (-1217.095) (-1214.985) * [-1212.570] (-1216.665) (-1213.808) (-1213.476) -- 0:00:17
Average standard deviation of split frequencies: 0.007997
786000 -- (-1214.941) [-1211.808] (-1222.373) (-1215.945) * (-1214.359) [-1212.505] (-1217.347) (-1214.357) -- 0:00:17
787000 -- (-1215.374) [-1213.151] (-1212.987) (-1219.527) * (-1214.320) [-1211.689] (-1213.429) (-1214.171) -- 0:00:17
788000 -- (-1215.439) [-1211.877] (-1212.823) (-1213.173) * [-1215.698] (-1213.625) (-1217.321) (-1221.089) -- 0:00:17
789000 -- (-1214.879) [-1210.622] (-1213.913) (-1216.529) * [-1213.768] (-1215.136) (-1214.715) (-1219.155) -- 0:00:17
790000 -- (-1214.585) [-1212.769] (-1215.665) (-1215.866) * (-1215.607) [-1216.226] (-1213.653) (-1214.993) -- 0:00:17
Average standard deviation of split frequencies: 0.006757
791000 -- (-1212.857) [-1212.437] (-1215.363) (-1215.318) * (-1215.723) (-1216.297) [-1213.725] (-1213.599) -- 0:00:17
792000 -- (-1212.954) [-1213.000] (-1213.113) (-1215.394) * [-1216.779] (-1214.537) (-1213.041) (-1214.783) -- 0:00:17
793000 -- (-1215.802) [-1211.834] (-1213.659) (-1214.295) * (-1214.934) [-1214.929] (-1213.741) (-1213.117) -- 0:00:16
794000 -- (-1214.754) [-1210.266] (-1214.058) (-1215.330) * (-1217.163) (-1216.220) (-1217.374) [-1213.896] -- 0:00:16
795000 -- (-1213.675) [-1212.434] (-1213.285) (-1214.488) * (-1216.320) (-1214.806) (-1215.792) [-1210.935] -- 0:00:16
Average standard deviation of split frequencies: 0.007107
796000 -- (-1215.183) [-1212.385] (-1214.055) (-1215.947) * (-1214.166) (-1214.321) (-1212.848) [-1213.507] -- 0:00:16
797000 -- (-1213.626) [-1212.385] (-1213.070) (-1215.192) * [-1215.270] (-1217.045) (-1216.729) (-1214.455) -- 0:00:16
798000 -- (-1215.581) [-1216.675] (-1213.508) (-1213.174) * (-1215.487) (-1215.889) (-1213.170) [-1214.599] -- 0:00:16
799000 -- (-1215.470) [-1212.245] (-1214.063) (-1212.738) * [-1211.962] (-1214.409) (-1214.508) (-1215.585) -- 0:00:16
800000 -- (-1213.340) [-1210.119] (-1224.180) (-1212.780) * (-1216.219) (-1215.825) [-1212.676] (-1214.889) -- 0:00:16
Average standard deviation of split frequencies: 0.006673
801000 -- (-1220.787) [-1214.224] (-1213.573) (-1213.249) * [-1213.721] (-1214.689) (-1213.820) (-1213.032) -- 0:00:16
802000 -- (-1213.864) [-1211.837] (-1212.696) (-1214.430) * [-1214.694] (-1213.873) (-1213.389) (-1214.279) -- 0:00:16
803000 -- (-1215.231) [-1215.665] (-1213.461) (-1212.960) * (-1217.234) (-1214.506) [-1220.572] (-1214.899) -- 0:00:16
804000 -- (-1218.372) [-1215.534] (-1213.216) (-1216.259) * (-1213.646) [-1213.995] (-1215.864) (-1213.465) -- 0:00:16
805000 -- (-1213.182) [-1215.949] (-1215.834) (-1218.492) * (-1213.991) [-1213.747] (-1214.738) (-1213.439) -- 0:00:15
Average standard deviation of split frequencies: 0.007798
806000 -- (-1217.409) [-1213.692] (-1213.022) (-1215.347) * [-1214.835] (-1213.848) (-1215.222) (-1213.321) -- 0:00:15
807000 -- (-1218.802) [-1212.524] (-1218.272) (-1220.706) * [-1214.303] (-1215.357) (-1213.219) (-1214.301) -- 0:00:15
808000 -- (-1213.680) [-1212.059] (-1215.656) (-1214.021) * (-1215.275) [-1213.732] (-1216.030) (-1213.854) -- 0:00:15
809000 -- (-1212.965) [-1213.400] (-1217.258) (-1214.208) * (-1213.351) [-1213.771] (-1216.283) (-1214.130) -- 0:00:15
810000 -- (-1213.445) [-1213.007] (-1212.100) (-1215.208) * (-1214.383) [-1214.997] (-1213.227) (-1213.462) -- 0:00:15
Average standard deviation of split frequencies: 0.008529
811000 -- (-1213.616) [-1211.672] (-1217.483) (-1220.128) * (-1218.435) (-1213.132) [-1214.448] (-1214.048) -- 0:00:15
812000 -- (-1213.220) [-1215.825] (-1213.120) (-1218.021) * (-1213.458) [-1212.669] (-1214.786) (-1214.388) -- 0:00:15
813000 -- (-1214.529) [-1211.341] (-1213.130) (-1213.896) * (-1212.663) [-1212.996] (-1214.720) (-1213.822) -- 0:00:15
814000 -- (-1217.969) [-1213.165] (-1214.196) (-1219.693) * (-1213.808) [-1216.075] (-1218.970) (-1213.591) -- 0:00:15
815000 -- (-1216.787) [-1210.546] (-1214.043) (-1215.203) * (-1215.098) [-1214.995] (-1212.904) (-1213.071) -- 0:00:15
Average standard deviation of split frequencies: 0.009243
816000 -- (-1214.622) [-1210.629] (-1215.649) (-1213.713) * (-1214.100) (-1216.132) (-1214.878) [-1215.818] -- 0:00:15
817000 -- (-1213.623) [-1210.565] (-1216.111) (-1214.949) * (-1214.523) [-1214.904] (-1215.036) (-1212.809) -- 0:00:15
818000 -- (-1216.464) [-1211.251] (-1214.233) (-1215.930) * (-1213.738) (-1213.695) [-1213.100] (-1213.847) -- 0:00:14
819000 -- (-1216.679) [-1210.948] (-1215.239) (-1215.376) * [-1217.346] (-1214.073) (-1213.927) (-1214.635) -- 0:00:14
820000 -- (-1215.534) [-1215.023] (-1214.242) (-1213.262) * [-1214.294] (-1213.177) (-1212.711) (-1213.031) -- 0:00:14
Average standard deviation of split frequencies: 0.008808
821000 -- (-1215.374) [-1213.873] (-1213.456) (-1213.419) * [-1213.162] (-1213.870) (-1214.673) (-1213.807) -- 0:00:14
822000 -- (-1213.572) [-1213.339] (-1213.286) (-1215.785) * (-1214.488) [-1213.632] (-1214.629) (-1214.868) -- 0:00:14
823000 -- (-1220.527) [-1211.745] (-1214.087) (-1214.179) * [-1215.625] (-1213.803) (-1215.144) (-1214.312) -- 0:00:14
824000 -- (-1212.983) [-1210.941] (-1212.560) (-1213.686) * (-1213.990) (-1213.371) (-1216.403) [-1213.306] -- 0:00:14
825000 -- (-1214.510) [-1212.481] (-1215.271) (-1217.656) * (-1213.907) [-1214.618] (-1213.682) (-1212.738) -- 0:00:14
Average standard deviation of split frequencies: 0.009131
826000 -- (-1214.391) [-1212.807] (-1214.758) (-1217.040) * [-1213.063] (-1213.107) (-1214.324) (-1214.131) -- 0:00:14
827000 -- (-1212.907) [-1211.246] (-1216.085) (-1214.517) * [-1216.832] (-1217.210) (-1213.948) (-1213.044) -- 0:00:14
828000 -- (-1215.960) [-1214.997] (-1215.543) (-1215.879) * (-1220.472) (-1218.709) (-1213.523) [-1216.430] -- 0:00:14
829000 -- (-1217.476) [-1211.572] (-1219.795) (-1215.338) * (-1216.271) [-1215.886] (-1213.576) (-1218.622) -- 0:00:14
830000 -- (-1215.542) [-1211.622] (-1215.845) (-1214.135) * (-1213.170) [-1214.630] (-1215.351) (-1214.117) -- 0:00:13
Average standard deviation of split frequencies: 0.009080
831000 -- [-1214.409] (-1213.157) (-1215.865) (-1214.646) * (-1214.154) [-1214.163] (-1216.602) (-1213.711) -- 0:00:13
832000 -- (-1213.408) (-1216.847) [-1213.566] (-1219.075) * [-1213.440] (-1213.928) (-1219.470) (-1215.810) -- 0:00:13
833000 -- (-1212.403) (-1213.548) [-1214.173] (-1215.729) * (-1215.384) (-1213.292) (-1214.214) [-1213.648] -- 0:00:13
834000 -- [-1214.544] (-1213.226) (-1215.700) (-1213.928) * (-1217.768) (-1214.335) [-1215.576] (-1216.231) -- 0:00:13
835000 -- [-1213.061] (-1215.364) (-1215.688) (-1218.632) * (-1220.176) [-1212.897] (-1215.797) (-1216.443) -- 0:00:13
Average standard deviation of split frequencies: 0.009022
836000 -- (-1215.436) [-1213.948] (-1215.050) (-1214.611) * [-1214.332] (-1214.024) (-1214.079) (-1216.365) -- 0:00:13
837000 -- [-1213.270] (-1214.437) (-1212.998) (-1213.310) * (-1214.864) (-1220.175) [-1215.524] (-1215.488) -- 0:00:13
838000 -- (-1213.207) [-1216.777] (-1215.269) (-1214.310) * (-1212.488) [-1212.791] (-1214.476) (-1214.429) -- 0:00:13
839000 -- (-1215.569) (-1215.558) [-1214.323] (-1214.026) * [-1214.063] (-1213.747) (-1214.089) (-1214.423) -- 0:00:13
840000 -- (-1213.227) (-1214.449) [-1216.753] (-1213.694) * (-1221.883) [-1213.235] (-1218.141) (-1213.157) -- 0:00:13
Average standard deviation of split frequencies: 0.009346
841000 -- [-1214.578] (-1216.801) (-1216.316) (-1213.012) * (-1214.089) (-1214.371) [-1212.939] (-1216.689) -- 0:00:13
842000 -- [-1215.088] (-1213.494) (-1216.896) (-1215.639) * (-1213.149) [-1213.968] (-1214.197) (-1215.241) -- 0:00:12
843000 -- (-1216.484) (-1215.011) (-1213.389) [-1212.742] * [-1213.002] (-1215.643) (-1213.676) (-1212.870) -- 0:00:12
844000 -- (-1214.768) (-1219.146) [-1219.170] (-1218.245) * [-1213.321] (-1217.394) (-1213.600) (-1212.496) -- 0:00:12
845000 -- (-1216.487) [-1212.885] (-1216.416) (-1213.989) * (-1214.737) [-1214.265] (-1214.990) (-1212.844) -- 0:00:12
Average standard deviation of split frequencies: 0.010401
846000 -- [-1213.653] (-1216.653) (-1216.491) (-1213.056) * [-1213.550] (-1215.647) (-1213.575) (-1213.740) -- 0:00:12
847000 -- [-1215.154] (-1214.611) (-1217.370) (-1216.467) * (-1215.093) (-1213.368) [-1212.195] (-1214.746) -- 0:00:12
848000 -- (-1213.806) (-1212.891) (-1213.118) [-1214.346] * (-1214.922) (-1215.922) [-1214.279] (-1213.730) -- 0:00:12
849000 -- (-1214.327) [-1212.555] (-1213.500) (-1213.094) * (-1214.772) [-1216.001] (-1213.597) (-1214.767) -- 0:00:12
850000 -- (-1219.601) [-1213.692] (-1218.078) (-1214.128) * (-1217.561) (-1217.264) [-1216.109] (-1212.748) -- 0:00:12
Average standard deviation of split frequencies: 0.010344
851000 -- (-1213.986) (-1218.054) (-1213.053) [-1214.407] * (-1214.801) (-1216.267) [-1213.955] (-1223.380) -- 0:00:12
852000 -- (-1213.165) (-1216.699) [-1213.298] (-1214.404) * (-1213.503) (-1216.259) [-1213.313] (-1214.041) -- 0:00:12
853000 -- (-1217.159) (-1214.093) [-1212.585] (-1214.654) * (-1219.670) [-1215.360] (-1214.106) (-1218.173) -- 0:00:12
854000 -- (-1211.940) (-1213.121) [-1210.941] (-1217.639) * (-1215.784) [-1213.701] (-1214.924) (-1214.082) -- 0:00:11
855000 -- (-1213.133) (-1213.548) [-1212.426] (-1214.060) * (-1214.518) (-1214.277) [-1214.084] (-1216.481) -- 0:00:11
Average standard deviation of split frequencies: 0.010280
856000 -- (-1215.508) (-1215.163) [-1211.520] (-1213.530) * (-1214.287) (-1213.730) [-1215.121] (-1213.053) -- 0:00:11
857000 -- (-1212.822) (-1215.002) [-1215.584] (-1215.109) * [-1213.158] (-1213.950) (-1212.767) (-1215.395) -- 0:00:11
858000 -- (-1215.730) (-1213.880) [-1211.642] (-1214.752) * (-1214.642) [-1218.763] (-1213.429) (-1215.809) -- 0:00:11
859000 -- (-1213.183) (-1213.828) [-1214.732] (-1217.240) * (-1214.936) (-1213.985) [-1213.603] (-1215.806) -- 0:00:11
860000 -- (-1213.838) (-1217.509) [-1210.557] (-1213.381) * (-1213.179) (-1214.361) (-1212.933) [-1213.167] -- 0:00:11
Average standard deviation of split frequencies: 0.009859
861000 -- (-1221.269) (-1215.736) [-1211.068] (-1215.545) * (-1213.084) [-1214.061] (-1218.521) (-1214.372) -- 0:00:11
862000 -- [-1213.482] (-1215.253) (-1217.527) (-1216.938) * (-1214.041) (-1213.649) (-1217.296) [-1213.611] -- 0:00:11
863000 -- (-1212.734) (-1214.089) [-1218.921] (-1212.241) * (-1213.537) (-1220.408) (-1216.048) [-1214.783] -- 0:00:11
864000 -- (-1219.507) (-1213.289) [-1214.142] (-1216.594) * (-1213.890) (-1214.081) (-1214.235) [-1213.735] -- 0:00:11
865000 -- (-1214.369) (-1214.157) [-1214.033] (-1215.585) * (-1213.167) [-1212.889] (-1213.247) (-1213.452) -- 0:00:11
Average standard deviation of split frequencies: 0.011976
866000 -- (-1217.359) [-1216.867] (-1214.700) (-1217.547) * [-1213.197] (-1213.229) (-1215.107) (-1215.249) -- 0:00:10
867000 -- (-1213.118) (-1215.202) (-1214.721) [-1213.955] * (-1212.602) [-1213.443] (-1213.468) (-1215.008) -- 0:00:10
868000 -- (-1213.502) (-1212.888) [-1214.183] (-1213.857) * (-1213.122) [-1213.908] (-1215.153) (-1216.185) -- 0:00:10
869000 -- (-1219.472) [-1213.063] (-1213.499) (-1215.534) * (-1214.961) [-1213.869] (-1213.021) (-1219.070) -- 0:00:10
870000 -- (-1215.633) (-1217.718) [-1215.858] (-1214.113) * (-1213.907) (-1219.148) (-1212.996) [-1215.589] -- 0:00:10
Average standard deviation of split frequencies: 0.012272
871000 -- (-1216.318) [-1213.779] (-1215.002) (-1214.481) * [-1216.295] (-1214.382) (-1213.102) (-1213.777) -- 0:00:10
872000 -- (-1215.274) (-1216.641) (-1215.900) [-1217.666] * [-1213.257] (-1218.538) (-1213.667) (-1216.829) -- 0:00:10
873000 -- (-1214.920) (-1217.931) (-1215.702) [-1213.684] * (-1215.823) (-1213.300) [-1214.410] (-1214.018) -- 0:00:10
874000 -- (-1214.755) [-1212.816] (-1214.863) (-1214.422) * (-1215.583) [-1214.749] (-1214.451) (-1215.177) -- 0:00:10
875000 -- (-1215.147) [-1213.602] (-1212.745) (-1214.152) * (-1216.449) (-1214.657) [-1213.721] (-1213.232) -- 0:00:10
Average standard deviation of split frequencies: 0.011839
876000 -- [-1214.202] (-1218.532) (-1214.850) (-1214.899) * (-1216.016) (-1213.708) [-1213.237] (-1214.726) -- 0:00:10
877000 -- [-1214.874] (-1213.000) (-1216.602) (-1215.509) * (-1215.811) (-1214.420) [-1212.161] (-1215.977) -- 0:00:10
878000 -- (-1215.727) [-1213.490] (-1215.069) (-1213.987) * (-1213.531) (-1213.441) [-1216.329] (-1220.245) -- 0:00:10
879000 -- (-1216.954) (-1213.514) (-1213.534) [-1212.917] * (-1215.173) (-1214.175) [-1210.234] (-1213.022) -- 0:00:09
880000 -- (-1216.924) [-1213.638] (-1213.956) (-1215.337) * (-1215.167) (-1213.705) [-1211.636] (-1215.304) -- 0:00:09
Average standard deviation of split frequencies: 0.012847
881000 -- (-1213.570) (-1213.330) (-1214.152) [-1214.566] * (-1213.955) (-1216.392) [-1210.901] (-1212.732) -- 0:00:09
882000 -- [-1214.120] (-1212.807) (-1212.103) (-1213.139) * (-1216.609) (-1216.975) [-1211.116] (-1214.490) -- 0:00:09
883000 -- (-1215.408) (-1217.014) [-1214.762] (-1213.004) * (-1213.518) (-1217.987) [-1211.401] (-1213.624) -- 0:00:09
884000 -- (-1213.629) [-1215.182] (-1215.402) (-1213.824) * (-1216.418) (-1212.771) [-1211.192] (-1215.953) -- 0:00:09
885000 -- (-1213.922) (-1214.754) (-1213.548) [-1212.898] * (-1214.348) (-1213.213) [-1210.647] (-1214.527) -- 0:00:09
Average standard deviation of split frequencies: 0.012769
886000 -- (-1217.898) (-1213.829) (-1213.340) [-1214.745] * (-1214.099) (-1214.389) [-1211.232] (-1216.772) -- 0:00:09
887000 -- (-1221.951) [-1215.884] (-1220.014) (-1212.931) * (-1214.160) (-1212.500) [-1212.763] (-1213.046) -- 0:00:09
888000 -- (-1213.281) (-1214.379) (-1214.380) [-1213.997] * (-1214.233) (-1213.438) [-1212.551] (-1213.007) -- 0:00:09
889000 -- (-1213.344) [-1214.356] (-1215.157) (-1215.022) * (-1213.595) (-1214.159) [-1214.859] (-1212.750) -- 0:00:09
890000 -- [-1217.408] (-1214.346) (-1217.266) (-1213.900) * (-1214.967) (-1213.120) [-1211.338] (-1214.278) -- 0:00:09
Average standard deviation of split frequencies: 0.013055
891000 -- (-1214.661) (-1214.432) [-1213.849] (-1217.971) * (-1217.843) (-1214.067) [-1211.148] (-1215.161) -- 0:00:08
892000 -- (-1214.392) (-1214.005) [-1213.669] (-1213.346) * (-1214.217) (-1217.993) [-1212.632] (-1213.031) -- 0:00:08
893000 -- (-1215.419) (-1218.621) (-1213.072) [-1213.877] * (-1213.645) (-1219.779) [-1212.397] (-1213.767) -- 0:00:08
894000 -- (-1213.686) (-1215.214) (-1215.129) [-1216.349] * (-1217.001) (-1215.359) [-1213.871] (-1217.002) -- 0:00:08
895000 -- [-1213.423] (-1214.476) (-1215.736) (-1215.051) * (-1213.726) (-1216.800) [-1211.866] (-1218.969) -- 0:00:08
Average standard deviation of split frequencies: 0.012978
896000 -- (-1214.176) (-1217.433) (-1219.248) [-1214.950] * (-1216.418) (-1215.667) [-1212.072] (-1216.890) -- 0:00:08
897000 -- (-1213.021) (-1216.679) [-1213.650] (-1212.742) * (-1212.472) (-1214.951) [-1213.686] (-1213.598) -- 0:00:08
898000 -- (-1214.086) (-1213.430) (-1216.862) [-1212.365] * (-1216.628) (-1214.831) [-1211.577] (-1212.780) -- 0:00:08
899000 -- [-1215.327] (-1214.211) (-1215.486) (-1214.355) * (-1214.416) (-1216.933) [-1213.666] (-1216.029) -- 0:00:08
900000 -- (-1214.261) (-1219.913) (-1215.210) [-1214.702] * (-1214.875) (-1214.516) [-1209.581] (-1215.762) -- 0:00:08
Average standard deviation of split frequencies: 0.013259
901000 -- (-1212.946) (-1212.653) [-1214.113] (-1213.231) * (-1213.200) (-1214.308) (-1214.907) [-1214.641] -- 0:00:08
902000 -- (-1213.863) (-1215.709) (-1213.599) [-1216.008] * (-1212.615) (-1214.534) [-1211.356] (-1211.742) -- 0:00:08
903000 -- (-1214.345) (-1216.632) [-1213.653] (-1216.065) * (-1217.618) (-1212.541) [-1210.356] (-1213.322) -- 0:00:07
904000 -- (-1216.155) (-1214.091) (-1214.954) [-1214.963] * (-1214.127) (-1212.534) [-1210.928] (-1214.834) -- 0:00:07
905000 -- (-1215.554) [-1213.783] (-1215.484) (-1214.737) * (-1217.056) (-1217.588) [-1213.094] (-1215.621) -- 0:00:07
Average standard deviation of split frequencies: 0.013528
906000 -- (-1214.107) [-1217.100] (-1214.219) (-1213.689) * (-1217.262) (-1217.244) [-1212.024] (-1217.701) -- 0:00:07
907000 -- (-1213.587) (-1214.847) (-1214.181) [-1214.338] * (-1213.196) (-1213.157) [-1212.790] (-1215.793) -- 0:00:07
908000 -- (-1216.896) (-1215.510) (-1216.768) [-1215.288] * (-1213.033) (-1227.071) [-1212.418] (-1214.029) -- 0:00:07
909000 -- (-1214.997) [-1215.271] (-1219.229) (-1216.944) * (-1213.405) (-1215.747) [-1212.398] (-1213.580) -- 0:00:07
910000 -- (-1215.197) [-1214.470] (-1213.285) (-1215.107) * (-1215.482) (-1215.033) [-1209.600] (-1213.417) -- 0:00:07
Average standard deviation of split frequencies: 0.013459
911000 -- (-1213.232) (-1213.001) (-1216.334) [-1213.083] * (-1213.670) (-1212.639) [-1210.684] (-1213.797) -- 0:00:07
912000 -- (-1215.463) [-1213.457] (-1215.064) (-1213.975) * (-1213.340) (-1214.832) [-1210.633] (-1213.129) -- 0:00:07
913000 -- [-1213.399] (-1213.681) (-1214.862) (-1213.456) * (-1215.445) (-1213.747) [-1210.377] (-1213.489) -- 0:00:07
914000 -- (-1216.372) (-1218.873) (-1216.065) [-1214.613] * (-1214.303) (-1214.839) [-1209.771] (-1216.773) -- 0:00:07
915000 -- [-1212.230] (-1216.223) (-1214.107) (-1215.153) * (-1213.362) (-1220.528) [-1213.091] (-1213.962) -- 0:00:06
Average standard deviation of split frequencies: 0.012351
916000 -- [-1211.976] (-1216.026) (-1213.533) (-1214.256) * (-1212.916) (-1215.426) [-1210.026] (-1217.352) -- 0:00:06
917000 -- (-1213.047) (-1214.353) (-1216.257) [-1215.749] * (-1215.155) (-1214.567) [-1213.608] (-1214.240) -- 0:00:06
918000 -- (-1214.108) [-1214.448] (-1216.945) (-1216.193) * (-1214.952) (-1214.853) [-1212.517] (-1213.923) -- 0:00:06
919000 -- (-1214.314) (-1213.746) [-1213.618] (-1213.410) * (-1212.478) (-1215.120) [-1209.345] (-1214.893) -- 0:00:06
920000 -- (-1212.753) [-1215.665] (-1214.039) (-1214.507) * (-1214.556) (-1214.406) (-1212.755) [-1213.214] -- 0:00:06
Average standard deviation of split frequencies: 0.011606
921000 -- (-1213.949) (-1212.920) [-1215.685] (-1215.693) * (-1215.333) (-1217.419) [-1210.614] (-1213.395) -- 0:00:06
922000 -- [-1213.867] (-1214.805) (-1215.426) (-1212.823) * (-1215.960) (-1216.455) [-1211.371] (-1215.944) -- 0:00:06
923000 -- (-1214.083) [-1213.244] (-1220.257) (-1212.936) * (-1214.799) (-1216.521) [-1211.877] (-1218.117) -- 0:00:06
924000 -- (-1213.837) [-1217.208] (-1213.544) (-1213.746) * (-1217.646) (-1215.338) [-1212.089] (-1213.592) -- 0:00:06
925000 -- (-1214.581) [-1215.840] (-1212.908) (-1215.044) * (-1216.151) (-1215.019) [-1213.282] (-1214.590) -- 0:00:06
Average standard deviation of split frequencies: 0.011539
926000 -- [-1212.068] (-1215.805) (-1213.502) (-1213.335) * (-1217.158) (-1213.157) [-1212.214] (-1214.051) -- 0:00:06
927000 -- [-1215.281] (-1213.052) (-1214.155) (-1213.756) * (-1213.699) (-1214.923) [-1211.423] (-1215.577) -- 0:00:05
928000 -- [-1214.728] (-1219.539) (-1213.250) (-1215.913) * (-1213.370) (-1215.263) [-1211.846] (-1214.330) -- 0:00:05
929000 -- [-1212.836] (-1216.098) (-1215.732) (-1213.804) * (-1214.164) (-1215.620) [-1210.780] (-1217.258) -- 0:00:05
930000 -- (-1212.897) (-1216.376) [-1214.186] (-1212.948) * (-1214.568) (-1213.023) [-1209.044] (-1215.761) -- 0:00:05
Average standard deviation of split frequencies: 0.011481
931000 -- [-1211.987] (-1216.012) (-1213.694) (-1212.660) * (-1217.607) (-1213.692) (-1213.056) [-1217.151] -- 0:00:05
932000 -- [-1212.476] (-1216.509) (-1214.854) (-1213.966) * (-1218.937) (-1215.656) [-1215.301] (-1213.778) -- 0:00:05
933000 -- [-1213.008] (-1215.203) (-1215.463) (-1214.030) * (-1214.851) (-1214.290) [-1211.982] (-1213.544) -- 0:00:05
934000 -- [-1212.361] (-1213.811) (-1215.061) (-1213.441) * (-1213.013) (-1213.651) [-1213.116] (-1213.296) -- 0:00:05
935000 -- [-1213.422] (-1217.632) (-1213.011) (-1216.472) * (-1220.654) (-1213.742) [-1212.823] (-1217.212) -- 0:00:05
Average standard deviation of split frequencies: 0.011416
936000 -- [-1214.419] (-1214.223) (-1212.768) (-1213.119) * (-1220.091) (-1213.319) [-1212.225] (-1213.463) -- 0:00:05
937000 -- [-1210.897] (-1213.333) (-1216.001) (-1215.763) * (-1216.516) (-1217.443) [-1214.045] (-1214.650) -- 0:00:05
938000 -- [-1210.994] (-1213.845) (-1214.535) (-1217.408) * (-1213.490) (-1216.095) [-1213.908] (-1214.861) -- 0:00:05
939000 -- [-1211.299] (-1214.331) (-1215.482) (-1214.009) * (-1216.010) (-1212.632) [-1212.899] (-1212.832) -- 0:00:05
940000 -- [-1216.513] (-1224.373) (-1215.009) (-1219.602) * (-1214.677) (-1213.639) [-1212.817] (-1218.052) -- 0:00:04
Average standard deviation of split frequencies: 0.012027
941000 -- [-1215.314] (-1214.431) (-1215.990) (-1215.966) * (-1216.881) (-1212.899) [-1212.471] (-1214.206) -- 0:00:04
942000 -- [-1215.399] (-1213.694) (-1213.545) (-1217.380) * (-1216.106) (-1215.892) [-1212.906] (-1216.048) -- 0:00:04
943000 -- (-1210.799) (-1213.149) (-1216.762) [-1213.558] * (-1213.588) (-1215.394) [-1213.155] (-1213.118) -- 0:00:04
944000 -- (-1216.138) (-1213.113) (-1222.191) [-1215.985] * (-1213.026) (-1214.884) [-1216.890] (-1216.386) -- 0:00:04
945000 -- [-1213.342] (-1212.639) (-1215.530) (-1219.416) * (-1214.145) (-1213.296) [-1212.567] (-1212.894) -- 0:00:04
Average standard deviation of split frequencies: 0.012292
946000 -- (-1214.312) (-1215.089) [-1213.553] (-1213.770) * (-1215.695) (-1213.295) [-1211.809] (-1213.420) -- 0:00:04
947000 -- (-1214.707) (-1212.627) (-1214.742) [-1214.704] * (-1213.159) (-1213.588) [-1219.184] (-1213.076) -- 0:00:04
948000 -- (-1215.366) (-1213.600) [-1215.558] (-1215.515) * (-1213.267) (-1215.312) [-1211.091] (-1213.090) -- 0:00:04
949000 -- (-1214.678) (-1215.295) [-1210.683] (-1215.981) * (-1215.450) (-1212.621) [-1213.517] (-1226.546) -- 0:00:04
950000 -- (-1215.966) [-1215.805] (-1211.549) (-1216.224) * (-1213.462) (-1214.001) [-1212.746] (-1215.521) -- 0:00:04
Average standard deviation of split frequencies: 0.014215
951000 -- (-1212.988) (-1220.970) [-1211.563] (-1211.860) * (-1213.311) (-1213.752) [-1210.692] (-1215.402) -- 0:00:04
952000 -- (-1218.018) (-1212.713) [-1210.011] (-1215.458) * (-1216.783) (-1212.634) [-1213.103] (-1215.994) -- 0:00:03
953000 -- (-1214.405) (-1213.427) [-1211.785] (-1213.484) * (-1218.178) (-1214.090) [-1213.135] (-1215.249) -- 0:00:03
954000 -- (-1215.123) (-1218.353) [-1211.322] (-1212.907) * (-1216.933) (-1212.867) [-1212.443] (-1213.570) -- 0:00:03
955000 -- (-1214.709) (-1215.559) [-1209.246] (-1213.206) * (-1214.043) (-1212.882) [-1210.230] (-1212.785) -- 0:00:03
Average standard deviation of split frequencies: 0.014136
956000 -- (-1212.933) (-1213.802) [-1212.994] (-1217.388) * (-1214.238) (-1216.482) [-1214.011] (-1213.140) -- 0:00:03
957000 -- (-1212.835) (-1214.290) [-1210.555] (-1213.063) * (-1214.232) (-1217.953) [-1209.428] (-1214.781) -- 0:00:03
958000 -- (-1215.065) (-1213.804) [-1213.784] (-1213.340) * (-1214.785) (-1213.404) [-1211.924] (-1213.240) -- 0:00:03
959000 -- (-1213.213) (-1215.145) [-1211.430] (-1214.719) * (-1217.417) (-1215.306) [-1213.948] (-1214.894) -- 0:00:03
960000 -- (-1214.046) (-1213.417) [-1209.589] (-1214.170) * [-1215.646] (-1213.719) (-1214.087) (-1214.066) -- 0:00:03
Average standard deviation of split frequencies: 0.013740
961000 -- (-1214.147) (-1214.451) [-1211.577] (-1214.590) * [-1213.499] (-1214.077) (-1219.780) (-1214.029) -- 0:00:03
962000 -- (-1216.095) (-1217.856) [-1210.227] (-1214.726) * (-1213.364) (-1221.511) [-1212.012] (-1214.640) -- 0:00:03
963000 -- (-1213.327) (-1215.487) [-1213.390] (-1215.415) * [-1213.915] (-1216.842) (-1214.717) (-1217.685) -- 0:00:03
964000 -- (-1217.833) (-1215.574) [-1215.911] (-1212.694) * (-1214.794) [-1214.293] (-1214.322) (-1212.803) -- 0:00:02
965000 -- (-1224.731) (-1214.863) [-1215.165] (-1213.583) * (-1215.109) [-1213.252] (-1215.393) (-1214.629) -- 0:00:02
Average standard deviation of split frequencies: 0.013664
966000 -- (-1213.579) (-1213.442) [-1210.497] (-1214.800) * (-1215.312) (-1213.700) (-1215.112) [-1214.833] -- 0:00:02
967000 -- (-1215.792) (-1214.226) [-1211.831] (-1214.211) * [-1215.315] (-1214.110) (-1217.548) (-1217.169) -- 0:00:02
968000 -- (-1213.447) (-1214.073) [-1212.653] (-1212.630) * [-1213.473] (-1216.953) (-1213.525) (-1216.112) -- 0:00:02
969000 -- (-1217.863) (-1213.147) [-1210.943] (-1213.633) * (-1215.316) (-1213.505) (-1214.142) [-1213.366] -- 0:00:02
970000 -- (-1215.133) (-1212.759) [-1215.101] (-1215.183) * [-1213.414] (-1213.371) (-1214.624) (-1215.536) -- 0:00:02
Average standard deviation of split frequencies: 0.012951
971000 -- (-1215.362) (-1214.616) [-1212.033] (-1214.532) * [-1215.699] (-1215.444) (-1214.136) (-1216.056) -- 0:00:02
972000 -- (-1213.479) (-1214.869) [-1210.688] (-1217.453) * [-1212.832] (-1216.444) (-1213.013) (-1216.802) -- 0:00:02
973000 -- (-1213.077) (-1213.635) [-1210.488] (-1213.928) * (-1217.407) (-1216.868) [-1212.574] (-1213.657) -- 0:00:02
974000 -- (-1216.513) (-1213.922) [-1215.931] (-1214.487) * (-1214.272) (-1214.221) (-1213.401) [-1213.178] -- 0:00:02
975000 -- (-1215.197) (-1218.046) [-1211.496] (-1214.825) * (-1216.415) (-1213.573) [-1213.885] (-1216.320) -- 0:00:02
Average standard deviation of split frequencies: 0.012236
976000 -- (-1218.220) (-1214.382) [-1211.778] (-1213.539) * (-1215.361) (-1213.302) (-1216.285) [-1215.969] -- 0:00:01
977000 -- (-1215.238) (-1221.055) [-1209.875] (-1214.222) * (-1214.218) (-1213.643) [-1212.628] (-1213.961) -- 0:00:01
978000 -- (-1215.273) (-1213.365) [-1210.186] (-1218.294) * (-1214.853) (-1213.910) (-1216.691) [-1213.614] -- 0:00:01
979000 -- (-1214.022) (-1213.951) [-1212.633] (-1213.127) * (-1214.268) (-1213.974) [-1212.708] (-1219.438) -- 0:00:01
980000 -- (-1214.633) (-1216.109) [-1212.945] (-1212.863) * (-1212.970) (-1214.554) [-1215.190] (-1218.691) -- 0:00:01
Average standard deviation of split frequencies: 0.013139
981000 -- (-1214.788) (-1213.507) [-1210.778] (-1214.185) * (-1219.424) (-1213.994) [-1213.780] (-1213.552) -- 0:00:01
982000 -- (-1218.951) (-1214.970) [-1213.357] (-1212.695) * (-1214.864) [-1213.475] (-1214.930) (-1212.941) -- 0:00:01
983000 -- (-1213.002) (-1213.757) [-1216.157] (-1216.189) * (-1214.231) (-1218.448) (-1214.875) [-1213.527] -- 0:00:01
984000 -- (-1212.853) (-1214.005) [-1218.107] (-1212.544) * [-1213.347] (-1215.737) (-1215.359) (-1213.136) -- 0:00:01
985000 -- (-1214.357) (-1212.935) [-1210.585] (-1214.423) * (-1212.429) (-1214.431) [-1214.404] (-1214.845) -- 0:00:01
Average standard deviation of split frequencies: 0.013705
986000 -- (-1214.855) (-1212.530) [-1211.487] (-1216.676) * (-1215.293) (-1214.835) [-1215.606] (-1214.571) -- 0:00:01
987000 -- (-1215.807) (-1215.226) [-1212.025] (-1214.955) * (-1221.124) (-1213.596) [-1213.900] (-1217.200) -- 0:00:01
988000 -- (-1215.022) (-1218.564) [-1210.639] (-1214.220) * (-1215.918) (-1217.553) (-1213.924) [-1212.773] -- 0:00:00
989000 -- (-1215.897) (-1214.213) [-1219.555] (-1214.052) * (-1213.997) (-1215.479) (-1213.741) [-1213.853] -- 0:00:00
990000 -- (-1216.382) (-1212.817) [-1212.703] (-1215.007) * (-1215.134) [-1214.029] (-1217.875) (-1214.424) -- 0:00:00
Average standard deviation of split frequencies: 0.013958
991000 -- (-1212.762) (-1217.720) [-1212.737] (-1215.521) * (-1213.884) (-1213.245) (-1217.254) [-1213.141] -- 0:00:00
992000 -- (-1217.144) (-1213.487) [-1214.252] (-1214.129) * [-1217.829] (-1217.458) (-1213.653) (-1216.558) -- 0:00:00
993000 -- (-1215.131) (-1213.866) [-1212.487] (-1212.690) * (-1214.070) (-1217.500) (-1215.180) [-1214.548] -- 0:00:00
994000 -- (-1212.896) (-1216.928) [-1215.379] (-1216.685) * (-1214.384) (-1213.281) (-1212.607) [-1212.817] -- 0:00:00
995000 -- (-1213.720) (-1216.914) [-1213.924] (-1213.851) * (-1216.028) (-1213.643) (-1214.808) [-1212.674] -- 0:00:00
Average standard deviation of split frequencies: 0.012937
996000 -- (-1215.172) (-1214.109) [-1214.221] (-1215.571) * (-1217.482) [-1212.703] (-1212.810) (-1213.788) -- 0:00:00
997000 -- (-1213.248) (-1215.036) [-1212.965] (-1219.108) * (-1216.731) [-1213.274] (-1213.579) (-1213.924) -- 0:00:00
998000 -- (-1220.334) (-1213.575) [-1215.627] (-1214.710) * (-1217.110) [-1212.709] (-1213.657) (-1216.278) -- 0:00:00
999000 -- (-1215.664) (-1214.387) [-1215.270] (-1212.948) * [-1215.596] (-1213.552) (-1217.716) (-1216.813) -- 0:00:00
1000000 -- (-1214.800) (-1215.750) [-1212.298] (-1215.115) * (-1215.080) (-1213.507) (-1215.213) [-1214.366] -- 0:00:00
Average standard deviation of split frequencies: 0.015075
Analysis completed in 1 mins 22 seconds
Analysis used 81.05 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1208.27
Likelihood of best state for "cold" chain of run 2 was -1208.28
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 68 %) Dirichlet(Revmat{all})
98.8 % ( 97 %) Slider(Revmat{all})
26.6 % ( 25 %) Dirichlet(Pi{all})
28.6 % ( 22 %) Slider(Pi{all})
77.3 % ( 51 %) Multiplier(Alpha{1,2})
79.2 % ( 65 %) Multiplier(Alpha{3})
46.7 % ( 94 %) Slider(Pinvar{all})
98.0 % ( 97 %) ExtSPR(Tau{all},V{all})
99.1 % (100 %) NNI(Tau{all},V{all})
73.3 % ( 65 %) ParsSPR(Tau{all},V{all})
30.1 % ( 31 %) Multiplier(V{all})
89.9 % ( 87 %) Nodeslider(V{all})
38.5 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 70 %) Dirichlet(Revmat{all})
99.2 % (100 %) Slider(Revmat{all})
26.6 % ( 32 %) Dirichlet(Pi{all})
28.1 % ( 20 %) Slider(Pi{all})
78.3 % ( 58 %) Multiplier(Alpha{1,2})
78.6 % ( 50 %) Multiplier(Alpha{3})
42.0 % ( 20 %) Slider(Pinvar{all})
98.0 % ( 96 %) ExtSPR(Tau{all},V{all})
99.0 % (100 %) NNI(Tau{all},V{all})
73.4 % ( 75 %) ParsSPR(Tau{all},V{all})
30.3 % ( 29 %) Multiplier(V{all})
90.7 % ( 99 %) Nodeslider(V{all})
38.3 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.49 0.32 0.22
2 | 167259 0.73 0.55
3 | 166461 166928 0.79
4 | 166589 167014 165749
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.53 0.36 0.25
2 | 166714 0.75 0.55
3 | 166207 166562 0.78
4 | 166958 166149 167410
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1211.00
| 1 |
| 2 |
| 2 2 2 1 |
| 2 1 1 2 2 |
| 2 11 1 2 2 |
| 2 1 1 1 2 11 |
| 1 |
| 2 2 2 1 1 |
| 2 1 1 1 1 1|
| 2 2 2 2 |
|1 2 2 1 2 2 1 2 |
| 1 1 1 1 1 1 2 2 2 21 |
| 1 11 121 *11121 1 1 11 1*111 2 2212 1 1 2|
|22 2112 2 2 2 121 1 2 2 2 222 22 2 1 2 |
| * 2 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1214.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1212.27 -1218.77
2 -1212.12 -1216.37
--------------------------------------
TOTAL -1212.20 -1218.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 6.475232 78.548632 0.000010 25.627120 2.927722 40.88 66.29 1.002
r(A<->C){all} 0.164363 0.018219 0.000174 0.427855 0.131176 101.22 127.53 1.002
r(A<->G){all} 0.146867 0.016004 0.000045 0.404462 0.114653 69.08 133.82 1.000
r(A<->T){all} 0.147184 0.015947 0.000057 0.397870 0.112353 161.78 164.79 1.001
r(C<->G){all} 0.165770 0.019431 0.000034 0.450929 0.129907 132.72 155.82 1.000
r(C<->T){all} 0.166034 0.019519 0.000076 0.436496 0.129687 35.25 106.76 1.009
r(G<->T){all} 0.209783 0.025295 0.000048 0.520336 0.172740 76.55 79.56 1.004
pi(A){all} 0.291395 0.000230 0.260810 0.319845 0.291325 663.93 916.33 1.000
pi(C){all} 0.146830 0.000141 0.124085 0.170177 0.146535 1033.01 1056.76 1.000
pi(G){all} 0.206520 0.000175 0.179966 0.230575 0.206547 1089.49 1150.86 1.001
pi(T){all} 0.355255 0.000244 0.323334 0.384207 0.355431 1071.27 1156.70 1.000
alpha{1,2} 0.902051 0.920939 0.000659 2.780874 0.588855 699.35 917.23 1.001
alpha{3} 0.913965 0.973764 0.000068 2.900909 0.586969 926.56 1074.92 1.002
pinvar{all} 0.871093 0.055449 0.319857 0.999893 0.996366 10.58 14.43 1.011
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- .*.*
7 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1030 0.343105 0.022612 0.327115 0.359094 2
6 996 0.331779 0.017901 0.319121 0.344437 2
7 976 0.325117 0.004711 0.321785 0.328448 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 1.355869 6.535402 0.000001 6.202517 0.303123 1.003 2
length{all}[2] 1.279223 5.850412 0.000000 6.280429 0.254010 1.000 2
length{all}[3] 1.308279 6.811462 0.000000 6.062456 0.276442 1.001 2
length{all}[4] 1.243255 5.601974 0.000000 5.794042 0.261776 1.001 2
length{all}[5] 1.186748 5.881639 0.000001 5.666614 0.267595 1.003 2
length{all}[6] 1.426948 8.097126 0.000001 6.705640 0.302083 0.999 2
length{all}[7] 1.254921 5.702504 0.000001 6.321765 0.243757 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.015075
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values (excluding NA and >10.0) = 1.001
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------ C3 (3)
|
\-------------------------------------------------------------- C4 (4)
|----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Fri Oct 21 22:38:34 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.05 sec, SCORE=1000, Nseq=4, Len=300
C1 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C3 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
C4 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLC
**************************************************
C1 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C2 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C3 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
C4 QFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVN
**************************************************
C1 DYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFT
C2 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C3 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
C4 DYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFT
**************************** *********************
C1 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C2 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C3 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
C4 YINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSS
**************************************************
C1 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C2 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C3 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
C4 SEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSK
**************************************************
C1 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C2 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C3 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
C4 FRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
**************************************************
-- Starting log on Fri Oct 21 22:57:08 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml,HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C1 900 sites
reading seq# 2 C2 900 sites
reading seq# 3 C3 900 sites
reading seq# 4 C4 900 sitesns = 4 ls = 900
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 300 / 300 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 300 / 300 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 1
0.078260 0.027577 0.065518 0.050345 0.300000 0.573498 0.149471
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.531981
np = 7
lnL0 = -1213.155096
Iterating by ming2
Initial: fx= 1213.155096
x= 0.07826 0.02758 0.06552 0.05035 0.30000 0.57350 0.14947
1 h-m-p 0.0000 0.0001 510.8364 ++ 1184.727972 m 0.0001 12 | 1/7
2 h-m-p 0.0001 0.0004 286.7550 +CYCCYC 1164.832914 5 0.0004 33 | 1/7
3 h-m-p 0.0000 0.0000 666.0324 ++ 1160.730827 m 0.0000 43 | 2/7
4 h-m-p 0.0000 0.0000 1346.6869 ++ 1157.185271 m 0.0000 53 | 2/7
5 h-m-p 0.0000 0.0000 141.7195
h-m-p: 1.66910566e-21 8.34552830e-21 1.41719522e+02 1157.185271
.. | 2/7
6 h-m-p 0.0000 0.0000 448.1807 ++ 1156.296699 m 0.0000 70 | 3/7
7 h-m-p 0.0027 0.5751 1.0107 ++++ 1155.984680 m 0.5751 82 | 4/7
8 h-m-p 0.5790 2.8951 0.0793 +C 1155.953133 0 2.2281 93 | 4/7
9 h-m-p 0.1504 0.7518 0.0694 ++ 1155.949554 m 0.7518 106 | 5/7
10 h-m-p 0.7718 8.0000 0.0063 C 1155.948639 0 0.8481 119 | 5/7
11 h-m-p 1.6000 8.0000 0.0002 Y 1155.948637 0 1.1022 131 | 5/7
12 h-m-p 1.6000 8.0000 0.0000 ------N 1155.948637 0 0.0001 149
Out..
lnL = -1155.948637
150 lfun, 450 eigenQcodon, 1200 P(t)
end of tree file.
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 1
0.097837 0.015947 0.093733 0.095083 0.000100 1.082696 0.375974 0.287076 1.513996
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.298091
np = 9
lnL0 = -1234.464001
Iterating by ming2
Initial: fx= 1234.464001
x= 0.09784 0.01595 0.09373 0.09508 0.00011 1.08270 0.37597 0.28708 1.51400
1 h-m-p 0.0000 0.0000 504.7834 ++ 1233.884121 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 335.7203 +++ 1213.465323 m 0.0002 27 | 2/9
3 h-m-p 0.0001 0.0006 212.0727 ++ 1165.014555 m 0.0006 39 | 3/9
4 h-m-p 0.0003 0.0015 56.3951 +YYCCYC 1156.867851 5 0.0014 61 | 3/9
5 h-m-p 0.0000 0.0000 299.2772 ++ 1156.014179 m 0.0000 73 | 4/9
6 h-m-p 0.0306 2.2929 0.2894 +YC 1156.005442 1 0.2610 87 | 4/9
7 h-m-p 0.5877 7.7597 0.1285 ++ 1155.941269 m 7.7597 104 | 5/9
8 h-m-p 1.6000 8.0000 0.0090 CY 1155.934664 1 1.5530 123 | 5/9
9 h-m-p 0.1972 8.0000 0.0712 +++ 1155.928107 m 8.0000 140 | 5/9
10 h-m-p 0.1152 8.0000 4.9416 +YCYC 1155.910120 3 0.8765 161 | 5/9
11 h-m-p 1.6000 8.0000 0.0226 ++ 1155.906796 m 8.0000 173 | 5/9
12 h-m-p 0.0647 8.0000 2.7970 ++CYC 1155.883272 2 0.9229 194 | 5/9
13 h-m-p 1.6000 8.0000 0.6996 YC 1155.865454 1 3.7111 207 | 5/9
14 h-m-p 1.6000 8.0000 1.0115 +YC 1155.860823 1 4.7132 225 | 5/9
15 h-m-p 1.6000 8.0000 1.6788 CC 1155.858423 1 1.8778 239 | 5/9
16 h-m-p 1.5831 8.0000 1.9913 ++ 1155.855426 m 8.0000 251 | 5/9
17 h-m-p 1.6000 8.0000 4.9073 CC 1155.854120 1 1.9984 265 | 5/9
18 h-m-p 1.6000 8.0000 5.8750 +Y 1155.852770 0 6.8461 278 | 5/9
19 h-m-p 1.5885 7.9425 11.1938 CC 1155.852214 1 1.9224 292 | 5/9
20 h-m-p 0.9766 4.8829 13.8258 ++ 1155.851676 m 4.8829 304 | 5/9
21 h-m-p -0.0000 -0.0000 36.7625
h-m-p: -0.00000000e+00 -0.00000000e+00 3.67625043e+01 1155.851676
.. | 5/9
22 h-m-p 0.0000 0.0017 1.9544 C 1155.851655 0 0.0000 325 | 5/9
23 h-m-p 1.6000 8.0000 0.0000 C 1155.851655 0 0.3664 337 | 5/9
24 h-m-p 0.4413 8.0000 0.0000 C 1155.851655 0 0.1440 353
Out..
lnL = -1155.851655
354 lfun, 1416 eigenQcodon, 4248 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1158.782393 S = -1157.318532 -2.373632
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:03
did 20 / 54 patterns 0:03
did 30 / 54 patterns 0:03
did 40 / 54 patterns 0:03
did 50 / 54 patterns 0:03
did 54 / 54 patterns 0:03end of tree file.
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 1
0.103870 0.044280 0.015463 0.063345 0.000100 0.891205 1.828628
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.117457
np = 7
lnL0 = -1214.414811
Iterating by ming2
Initial: fx= 1214.414811
x= 0.10387 0.04428 0.01546 0.06334 0.00011 0.89120 1.82863
1 h-m-p 0.0000 0.0000 522.6038 ++ 1213.885533 m 0.0000 12 | 1/7
2 h-m-p 0.0000 0.0024 80.7103 ++++ 1206.088635 m 0.0024 24 | 1/7
3 h-m-p 0.0008 0.0042 171.5360 ++ 1168.247372 m 0.0042 34 | 2/7
4 h-m-p 0.0000 0.0001 117.2307 ++ 1163.291710 m 0.0001 44 | 3/7
5 h-m-p 0.0000 0.0000 264.5470 ++ 1162.086241 m 0.0000 54 | 4/7
6 h-m-p 0.0061 3.0641 0.6377 +++++ 1155.994669 m 3.0641 67 | 5/7
7 h-m-p 1.6000 8.0000 0.0003 ++ 1155.960999 m 8.0000 80 | 5/7
8 h-m-p 1.6000 8.0000 0.0003 YC 1155.960555 1 0.7968 93 | 5/7
9 h-m-p 1.6000 8.0000 0.0000 ++ 1155.960244 m 8.0000 105 | 5/7
10 h-m-p 0.2838 8.0000 0.0011 ++CYC 1155.959332 2 3.2332 123 | 5/7
11 h-m-p 1.6000 8.0000 0.0002 YC 1155.959264 1 1.0746 136 | 5/7
12 h-m-p 1.1718 8.0000 0.0002 ++ 1155.959229 m 8.0000 148 | 5/7
13 h-m-p 1.6000 8.0000 0.0007 +Y 1155.959212 0 6.4000 161 | 5/7
14 h-m-p 1.6000 8.0000 0.0002 Y 1155.959211 0 1.0612 173 | 5/7
15 h-m-p 1.0251 8.0000 0.0002 ++ 1155.959211 m 8.0000 185 | 5/7
16 h-m-p 1.6000 8.0000 0.0006 C 1155.959210 0 2.4246 197 | 5/7
17 h-m-p 1.6000 8.0000 0.0005 C 1155.959210 0 2.0094 209 | 5/7
18 h-m-p 1.1535 8.0000 0.0009 ++ 1155.959210 m 8.0000 221 | 5/7
19 h-m-p 0.6183 3.9391 0.0120 ----------C 1155.959210 0 0.0000 243 | 5/7
20 h-m-p 0.0160 8.0000 1.2999 +++
QuantileBeta(0.85, 5.37657, 0.00500) = 1.000000e+00 2000 rounds
Y 1155.948637 0 0.6829 258 | 5/7
21 h-m-p 1.6000 8.0000 0.0050 C 1155.948637 0 1.4434 268 | 5/7
22 h-m-p 1.6000 8.0000 0.0029 -Y 1155.948637 0 0.1993 281 | 5/7
23 h-m-p 0.0800 8.0000 0.0072 +C 1155.948637 0 0.3693 294 | 5/7
24 h-m-p 0.1990 8.0000 0.0134 Y 1155.948637 0 0.4950 306 | 5/7
25 h-m-p 0.3070 8.0000 0.0217 Y 1155.948637 0 0.7453 318 | 5/7
26 h-m-p 0.4621 8.0000 0.0350 +Y 1155.948637 0 1.2661 331 | 5/7
27 h-m-p 0.7789 8.0000 0.0568 +C 1155.948637 0 3.1157 344 | 5/7
28 h-m-p 1.6000 8.0000 0.1029 ++ 1155.948637 m 8.0000 356 | 5/7
29 h-m-p 1.6000 8.0000 0.1868
QuantileBeta(0.85, 2.30193, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.19867, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
+ 1155.948637 m 8.0000 368
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49773, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49743, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49758, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
30 h-m-p 1.6000 8.0000 0.4362
QuantileBeta(0.85, 4.19548, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.28919, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 6.98709, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
C 1155.948637 0 5.9787 381
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10564, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10523, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.10543, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
31 h-m-p 1.6000 8.0000 0.0964
QuantileBeta(0.85, 6.25963, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.14398, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
Y 1155.948637 0 0.7574 393
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17864, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17822, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.17843, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
32 h-m-p 0.0826 8.0000 0.8837
QuantileBeta(0.85, 6.25143, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.47042, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 7.34638, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
C 1155.948637 0 0.4611 406
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58607, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58563, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.58585, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
33 h-m-p 0.4936 8.0000 0.8253
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.21554, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99761, 0.00500) = 1.000000e+00 2000 rounds
C 1155.948637 0 0.4936 418
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99350, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99305, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
34 h-m-p 0.2907 8.0000 1.4014
QuantileBeta(0.85, 7.40069, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.62296, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 13.51201, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
Y 1155.948637 0 0.8558 431
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19264, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
35 h-m-p 0.9905 6.7615 1.2109
QuantileBeta(0.85, 6.99327, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.89280, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.11768, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.17390, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.18795, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19147, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19234, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19256, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19261, 0.00500) = 1.000000e+00 2000 rounds
Y 1155.948637 0 0.0000 448
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
36 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 8.19263, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19266, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
Y 1155.948637 0 0.8340 458
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19287, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19238, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
| 5/7
37 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
N 1155.948637 0 0.0063 473
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1155.948637
474 lfun, 5214 eigenQcodon, 18960 P(t)
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19262, 0.00500) = 1.000000e+00 2000 rounds
end of tree file.
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 1
0.057489 0.107120 0.058768 0.099822 0.000100 0.900000 0.547944 1.112925 1.300000
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.599693
np = 9
lnL0 = -1236.677993
Iterating by ming2
Initial: fx= 1236.677993
x= 0.05749 0.10712 0.05877 0.09982 0.00011 0.90000 0.54794 1.11292 1.30000
1 h-m-p 0.0000 0.0000 458.8602 ++ 1236.440963 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0005 210.5495 +++ 1222.929926 m 0.0005 27 | 1/9
3 h-m-p 0.0002 0.0008 405.3732 ++ 1178.161492 m 0.0008 39 | 2/9
4 h-m-p 0.0000 0.0000 29965.2981 ++ 1158.378578 m 0.0000 51 | 3/9
5 h-m-p 0.0000 0.0001 746.9140 ++ 1156.565911 m 0.0001 63 | 4/9
6 h-m-p 0.0352 0.4196 1.7734 ++ 1155.986618 m 0.4196 75 | 5/9
7 h-m-p 0.0424 0.2120 0.2761 ++ 1155.971471 m 0.2120 87 | 5/9
8 h-m-p -0.0000 -0.0000 0.4668
h-m-p: -1.41098654e-18 -7.05493272e-18 4.66782777e-01 1155.971471
.. | 5/9
9 h-m-p 0.0007 0.3712 134.7086 --CYC 1155.909950 2 0.0000 122 | 5/9
10 h-m-p 0.0310 8.0000 0.0340 +++++ 1155.902086 m 8.0000 137 | 5/9
11 h-m-p 0.3667 8.0000 0.7418 +++ 1155.870171 m 8.0000 154 | 6/9
12 h-m-p 1.6000 8.0000 0.2373 CC 1155.863206 1 1.5456 172 | 6/9
13 h-m-p 0.9609 8.0000 0.3817 ++ 1155.859871 m 8.0000 187 | 6/9
14 h-m-p 0.8703 8.0000 3.5081 ++ 1155.853472 m 8.0000 202 | 6/9
15 h-m-p 1.6000 8.0000 2.5233 YC 1155.853111 1 3.2073 215 | 6/9
16 h-m-p 1.6000 8.0000 4.8358 +Y 1155.852220 0 7.0548 228 | 6/9
17 h-m-p 1.6000 8.0000 11.8006 CC 1155.851814 1 2.3209 242 | 6/9
18 h-m-p 1.6000 8.0000 15.2385 +YC 1155.851452 1 4.8623 256 | 6/9
19 h-m-p 1.6000 8.0000 25.8069 CC 1155.851266 1 2.3947 270 | 6/9
20 h-m-p 1.6000 8.0000 34.2794 +YC 1155.851106 1 4.8147 284 | 6/9
21 h-m-p 1.6000 8.0000 59.1001 C 1155.851022 0 2.5164 296 | 6/9
22 h-m-p 1.1695 5.8475 75.3089 +C 1155.850957 0 4.0118 309 | 6/9
23 h-m-p 0.2135 1.0676 129.4880 ++ 1155.850931 m 1.0676 321 | 7/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1155.850930 0 1.0490 333 | 7/9
25 h-m-p 1.6000 8.0000 0.0000 ---------------Y 1155.850930 0 0.0000 362
Out..
lnL = -1155.850930
363 lfun, 4356 eigenQcodon, 15972 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1160.579918 S = -1159.402400 -1.981167
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:17
did 20 / 54 patterns 0:17
did 30 / 54 patterns 0:18
did 40 / 54 patterns 0:18
did 50 / 54 patterns 0:18
did 54 / 54 patterns 0:18end of tree file.
Time used: 0:18
The loglikelihoods for models M1, M2, M7 and M8 are -1155.948637 -1155.851655 -1155.948637 -1155.850930 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCV
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCV
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCV
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCV
************************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVE
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVE
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVE
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 PHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVE
************************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DKFDLLISYMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLY
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DKFDLLISDMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLY
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DKFDLLISDMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLY
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 DKFDLLISDMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLY
******** ***************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 EIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTM
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 EIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTM
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 EIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTM
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 EIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTM
************************************************************
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
************************************************************
>HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCATATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA >HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCAGATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA >HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCAGATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA >HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 TCTGCTGAGTGGAAGTGTGGTTACAGCATGCCGAGCCTTTATAAAATACAGAATATGTGTATGGATGCATGTAATTTGTATAATTATGGTGCTAGTATTAAGTTGCCAGATGGTATTATGTTTAACGTTGTTAAATATACCCAGCTGTGTCAGTTTCTTAATACTACTACCATGTGTGTTCCTCATAATATGCGTGTTTTACACCTTGGTGCTGGCTCTGATAAGGGTGTAGCACCGGGTACAGCTGTTCTACGTAGATGGCTCCCTGACGATGCAATAATTGTTGACAATGATGTTAATGATTATGTCAGTGATGCTGATTTTAGTATAACAGGTGATTGTACACATGTTTATGTCGAAGACAAATTTGACCTACTTATATCAGATATGTATGATGGAAAAATTAAGAGCATTGATGGTGACAATGTGTCTAAAGATGGATTTTTCACTTATATTAATGGATTTATACGTGAAAAACTTGCGCTTGGTGGCGCTATGGCTGTTAAGATTACCGAGTATAGTTGGAACAAACAGCTTTATGAGATTGCACAGAAGTTTGAATATTGGACCCTGTTTTGTACCAGTGTCAACACGTCATCTTCTGAGGCTTTCCTTATTGGTATTAACTATCTTGGTGACTTTTCTAGTGCTAGTGTTATAGATGGTAATGTTATGCATGCTAACTATATATTTTGGCGCAACTCCACTATTATGACTATGTCATATAATTCAGTTCTTGATTTGTCAAAATTTAGGTGTAAACATAAAGCAACTGTTATTATTACACTTAAAGATAAAGACATTACTGATATGGTGCTTGGTCTAATTAAAAATGGCAAGTTGTTAATTCGCAACTCGCAGAAATTATTGAATTTTAGCAACCATCTTGTTACAACTAAA
>HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVEDKFDLLISYMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK >HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK >HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK >HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2 SAEWKCGYSMPSLYKIQNMCMDACNLYNYGASIKLPDGIMFNVVKYTQLCQFLNTTTMCVPHNMRVLHLGAGSDKGVAPGTAVLRRWLPDDAIIVDNDVNDYVSDADFSITGDCTHVYVEDKFDLLISDMYDGKIKSIDGDNVSKDGFFTYINGFIREKLALGGAMAVKITEYSWNKQLYEIAQKFEYWTLFCTSVNTSSSEAFLIGINYLGDFSSASVIDGNVMHANYIFWRNSTIMTMSYNSVLDLSKFRCKHKATVIITLKDKDITDMVLGLIKNGKLLIRNSQKLLNFSNHLVTTK
Reading sequence file /data//pss_subsets/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result/original_alignment/codeml/fasta/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1 Found 4 sequences of length 900 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 0.1% Found 0 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... 100.0% Using a window size of 80 with k as 1 Too few informative sites to use normal approximation. Try doing a permutation test or increasing alignment length Can also try decreasing windowsize.
#NEXUS
[ID: 8647129146]
begin taxa;
dimensions ntax=4;
taxlabels
HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
end;
begin trees;
translate
1 HKU2_HK_298_2006_NA_VIPR_P_148283158_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
2 HKU2_GD_430_2006_nsp16_VIPR_P_148283140_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
3 HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2,
4 HKU2_HK_33_2006_NA_VIPR_P_148283167_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:3.031230e-01,2:2.540102e-01,3:2.764423e-01,4:2.617760e-01);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:3.031230e-01,2:2.540102e-01,3:2.764423e-01,4:2.617760e-01);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1212.27 -1218.77
2 -1212.12 -1216.37
--------------------------------------
TOTAL -1212.20 -1218.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 6.475232 78.548632 0.000010 25.627120 2.927722 40.88 66.29 1.002
r(A<->C){all} 0.164363 0.018219 0.000174 0.427855 0.131176 101.22 127.53 1.002
r(A<->G){all} 0.146867 0.016004 0.000045 0.404462 0.114653 69.08 133.82 1.000
r(A<->T){all} 0.147184 0.015947 0.000057 0.397870 0.112353 161.78 164.79 1.001
r(C<->G){all} 0.165770 0.019431 0.000034 0.450929 0.129907 132.72 155.82 1.000
r(C<->T){all} 0.166034 0.019519 0.000076 0.436496 0.129687 35.25 106.76 1.009
r(G<->T){all} 0.209783 0.025295 0.000048 0.520336 0.172740 76.55 79.56 1.004
pi(A){all} 0.291395 0.000230 0.260810 0.319845 0.291325 663.93 916.33 1.000
pi(C){all} 0.146830 0.000141 0.124085 0.170177 0.146535 1033.01 1056.76 1.000
pi(G){all} 0.206520 0.000175 0.179966 0.230575 0.206547 1089.49 1150.86 1.001
pi(T){all} 0.355255 0.000244 0.323334 0.384207 0.355431 1071.27 1156.70 1.000
alpha{1,2} 0.902051 0.920939 0.000659 2.780874 0.588855 699.35 917.23 1.001
alpha{3} 0.913965 0.973764 0.000068 2.900909 0.586969 926.56 1074.92 1.002
pinvar{all} 0.871093 0.055449 0.319857 0.999893 0.996366 10.58 14.43 1.011
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/HKU2_HK_46_2006_NA_VIPR_P_148283149_19577_20476_1_NA_NA_Unknown_Rhinolophus_bat_coronavirus_HKU2.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 300
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 12 12 12 12 | Ser TCT 6 6 6 6 | Tyr TAT 15 14 14 14 | Cys TGT 8 8 8 8
TTC 2 2 2 2 | TCC 1 1 1 1 | TAC 1 1 1 1 | TGC 0 0 0 0
Leu TTA 3 3 3 3 | TCA 5 5 5 5 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 5 5 5 5 | TCG 1 1 1 1 | TAG 0 0 0 0 | Trp TGG 5 5 5 5
------------------------------------------------------------------------------------------------------
Leu CTT 13 13 13 13 | Pro CCT 2 2 2 2 | His CAT 5 5 5 5 | Arg CGT 3 3 3 3
CTC 1 1 1 1 | CCC 0 0 0 0 | CAC 1 1 1 1 | CGC 2 2 2 2
CTA 3 3 3 3 | CCA 1 1 1 1 | Gln CAA 0 0 0 0 | CGA 0 0 0 0
CTG 2 2 2 2 | CCG 2 2 2 2 | CAG 6 6 6 6 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 16 16 16 16 | Thr ACT 8 8 8 8 | Asn AAT 13 13 13 13 | Ser AGT 7 7 7 7
ATC 0 0 0 0 | ACC 5 5 5 5 | AAC 8 8 8 8 | AGC 4 4 4 4
ATA 7 7 7 7 | ACA 5 5 5 5 | Lys AAA 15 15 15 15 | Arg AGA 1 1 1 1
Met ATG 12 12 12 12 | ACG 1 1 1 1 | AAG 7 7 7 7 | AGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Val GTT 14 14 14 14 | Ala GCT 10 10 10 10 | Asp GAT 16 17 17 17 | Gly GGT 13 13 13 13
GTC 3 3 3 3 | GCC 0 0 0 0 | GAC 7 7 7 7 | GGC 3 3 3 3
GTA 1 1 1 1 | GCA 5 5 5 5 | Glu GAA 3 3 3 3 | GGA 3 3 3 3
GTG 2 2 2 2 | GCG 1 1 1 1 | GAG 4 4 4 4 | GGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C1
position 1: T:0.21333 C:0.13667 A:0.36667 G:0.28333
position 2: T:0.32000 C:0.17667 A:0.33667 G:0.16667
position 3: T:0.53667 C:0.12667 A:0.17333 G:0.16333
Average T:0.35667 C:0.14667 A:0.29222 G:0.20444
#2: C2
position 1: T:0.21000 C:0.13667 A:0.36667 G:0.28667
position 2: T:0.32000 C:0.17667 A:0.33667 G:0.16667
position 3: T:0.53667 C:0.12667 A:0.17333 G:0.16333
Average T:0.35556 C:0.14667 A:0.29222 G:0.20556
#3: C3
position 1: T:0.21000 C:0.13667 A:0.36667 G:0.28667
position 2: T:0.32000 C:0.17667 A:0.33667 G:0.16667
position 3: T:0.53667 C:0.12667 A:0.17333 G:0.16333
Average T:0.35556 C:0.14667 A:0.29222 G:0.20556
#4: C4
position 1: T:0.21000 C:0.13667 A:0.36667 G:0.28667
position 2: T:0.32000 C:0.17667 A:0.33667 G:0.16667
position 3: T:0.53667 C:0.12667 A:0.17333 G:0.16333
Average T:0.35556 C:0.14667 A:0.29222 G:0.20556
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 48 | Ser S TCT 24 | Tyr Y TAT 57 | Cys C TGT 32
TTC 8 | TCC 4 | TAC 4 | TGC 0
Leu L TTA 12 | TCA 20 | *** * TAA 0 | *** * TGA 0
TTG 20 | TCG 4 | TAG 0 | Trp W TGG 20
------------------------------------------------------------------------------
Leu L CTT 52 | Pro P CCT 8 | His H CAT 20 | Arg R CGT 12
CTC 4 | CCC 0 | CAC 4 | CGC 8
CTA 12 | CCA 4 | Gln Q CAA 0 | CGA 0
CTG 8 | CCG 8 | CAG 24 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 64 | Thr T ACT 32 | Asn N AAT 52 | Ser S AGT 28
ATC 0 | ACC 20 | AAC 32 | AGC 16
ATA 28 | ACA 20 | Lys K AAA 60 | Arg R AGA 4
Met M ATG 48 | ACG 4 | AAG 28 | AGG 4
------------------------------------------------------------------------------
Val V GTT 56 | Ala A GCT 40 | Asp D GAT 67 | Gly G GGT 52
GTC 12 | GCC 0 | GAC 28 | GGC 12
GTA 4 | GCA 20 | Glu E GAA 12 | GGA 12
GTG 8 | GCG 4 | GAG 16 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21083 C:0.13667 A:0.36667 G:0.28583
position 2: T:0.32000 C:0.17667 A:0.33667 G:0.16667
position 3: T:0.53667 C:0.12667 A:0.17333 G:0.16333
Average T:0.35583 C:0.14667 A:0.29222 G:0.20528
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 1
lnL(ntime: 4 np: 7): -1155.948637 +0.000000
5..1 5..2 5..3 5..4
0.003370 0.000004 0.000004 0.000004 0.000100 0.000010 0.300479
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003382
(1: 0.003370, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.003370, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.30048 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.003 805.3 94.7 1.0000 0.0011 0.0011 0.9 0.1
5..2 0.000 805.3 94.7 1.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 805.3 94.7 1.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 805.3 94.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 1
lnL(ntime: 4 np: 9): -1155.851655 +0.000000
5..1 5..2 5..3 5..4
0.003326 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 1.000000 124.051368
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003338
(1: 0.003326, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.003326, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 124.05137
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.003 805.3 94.7 124.0514 0.0012 0.0000 1.0 0.0
5..2 0.000 805.3 94.7 124.0514 0.0000 0.0000 0.0 0.0
5..3 0.000 805.3 94.7 124.0514 0.0000 0.0000 0.0 0.0
5..4 0.000 805.3 94.7 124.0514 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 1.000** 124.051
2 A 1.000** 124.051
3 E 1.000** 124.051
4 W 1.000** 124.051
5 K 1.000** 124.051
6 C 1.000** 124.051
7 G 1.000** 124.051
8 Y 1.000** 124.051
9 S 1.000** 124.051
10 M 1.000** 124.051
11 P 1.000** 124.051
12 S 1.000** 124.051
13 L 1.000** 124.051
14 Y 1.000** 124.051
15 K 1.000** 124.051
16 I 1.000** 124.051
17 Q 1.000** 124.051
18 N 1.000** 124.051
19 M 1.000** 124.051
20 C 1.000** 124.051
21 M 1.000** 124.051
22 D 1.000** 124.051
23 A 1.000** 124.051
24 C 1.000** 124.051
25 N 1.000** 124.051
26 L 1.000** 124.051
27 Y 1.000** 124.051
28 N 1.000** 124.051
29 Y 1.000** 124.051
30 G 1.000** 124.051
31 A 1.000** 124.051
32 S 1.000** 124.051
33 I 1.000** 124.051
34 K 1.000** 124.051
35 L 1.000** 124.051
36 P 1.000** 124.051
37 D 1.000** 124.051
38 G 1.000** 124.051
39 I 1.000** 124.051
40 M 1.000** 124.051
41 F 1.000** 124.051
42 N 1.000** 124.051
43 V 1.000** 124.051
44 V 1.000** 124.051
45 K 1.000** 124.051
46 Y 1.000** 124.051
47 T 1.000** 124.051
48 Q 1.000** 124.051
49 L 1.000** 124.051
50 C 1.000** 124.051
51 Q 1.000** 124.051
52 F 1.000** 124.051
53 L 1.000** 124.051
54 N 1.000** 124.051
55 T 1.000** 124.051
56 T 1.000** 124.051
57 T 1.000** 124.051
58 M 1.000** 124.051
59 C 1.000** 124.051
60 V 1.000** 124.051
61 P 1.000** 124.051
62 H 1.000** 124.051
63 N 1.000** 124.051
64 M 1.000** 124.051
65 R 1.000** 124.051
66 V 1.000** 124.051
67 L 1.000** 124.051
68 H 1.000** 124.051
69 L 1.000** 124.051
70 G 1.000** 124.051
71 A 1.000** 124.051
72 G 1.000** 124.051
73 S 1.000** 124.051
74 D 1.000** 124.051
75 K 1.000** 124.051
76 G 1.000** 124.051
77 V 1.000** 124.051
78 A 1.000** 124.051
79 P 1.000** 124.051
80 G 1.000** 124.051
81 T 1.000** 124.051
82 A 1.000** 124.051
83 V 1.000** 124.051
84 L 1.000** 124.051
85 R 1.000** 124.051
86 R 1.000** 124.051
87 W 1.000** 124.051
88 L 1.000** 124.051
89 P 1.000** 124.051
90 D 1.000** 124.051
91 D 1.000** 124.051
92 A 1.000** 124.051
93 I 1.000** 124.051
94 I 1.000** 124.051
95 V 1.000** 124.051
96 D 1.000** 124.051
97 N 1.000** 124.051
98 D 1.000** 124.051
99 V 1.000** 124.051
100 N 1.000** 124.051
101 D 1.000** 124.051
102 Y 1.000** 124.051
103 V 1.000** 124.051
104 S 1.000** 124.051
105 D 1.000** 124.051
106 A 1.000** 124.051
107 D 1.000** 124.051
108 F 1.000** 124.051
109 S 1.000** 124.051
110 I 1.000** 124.051
111 T 1.000** 124.051
112 G 1.000** 124.051
113 D 1.000** 124.051
114 C 1.000** 124.051
115 T 1.000** 124.051
116 H 1.000** 124.051
117 V 1.000** 124.051
118 Y 1.000** 124.051
119 V 1.000** 124.051
120 E 1.000** 124.051
121 D 1.000** 124.051
122 K 1.000** 124.051
123 F 1.000** 124.051
124 D 1.000** 124.051
125 L 1.000** 124.051
126 L 1.000** 124.051
127 I 1.000** 124.051
128 S 1.000** 124.051
129 Y 1.000** 124.051
130 M 1.000** 124.051
131 Y 1.000** 124.051
132 D 1.000** 124.051
133 G 1.000** 124.051
134 K 1.000** 124.051
135 I 1.000** 124.051
136 K 1.000** 124.051
137 S 1.000** 124.051
138 I 1.000** 124.051
139 D 1.000** 124.051
140 G 1.000** 124.051
141 D 1.000** 124.051
142 N 1.000** 124.051
143 V 1.000** 124.051
144 S 1.000** 124.051
145 K 1.000** 124.051
146 D 1.000** 124.051
147 G 1.000** 124.051
148 F 1.000** 124.051
149 F 1.000** 124.051
150 T 1.000** 124.051
151 Y 1.000** 124.051
152 I 1.000** 124.051
153 N 1.000** 124.051
154 G 1.000** 124.051
155 F 1.000** 124.051
156 I 1.000** 124.051
157 R 1.000** 124.051
158 E 1.000** 124.051
159 K 1.000** 124.051
160 L 1.000** 124.051
161 A 1.000** 124.051
162 L 1.000** 124.051
163 G 1.000** 124.051
164 G 1.000** 124.051
165 A 1.000** 124.051
166 M 1.000** 124.051
167 A 1.000** 124.051
168 V 1.000** 124.051
169 K 1.000** 124.051
170 I 1.000** 124.051
171 T 1.000** 124.051
172 E 1.000** 124.051
173 Y 1.000** 124.051
174 S 1.000** 124.051
175 W 1.000** 124.051
176 N 1.000** 124.051
177 K 1.000** 124.051
178 Q 1.000** 124.051
179 L 1.000** 124.051
180 Y 1.000** 124.051
181 E 1.000** 124.051
182 I 1.000** 124.051
183 A 1.000** 124.051
184 Q 1.000** 124.051
185 K 1.000** 124.051
186 F 1.000** 124.051
187 E 1.000** 124.051
188 Y 1.000** 124.051
189 W 1.000** 124.051
190 T 1.000** 124.051
191 L 1.000** 124.051
192 F 1.000** 124.051
193 C 1.000** 124.051
194 T 1.000** 124.051
195 S 1.000** 124.051
196 V 1.000** 124.051
197 N 1.000** 124.051
198 T 1.000** 124.051
199 S 1.000** 124.051
200 S 1.000** 124.051
201 S 1.000** 124.051
202 E 1.000** 124.051
203 A 1.000** 124.051
204 F 1.000** 124.051
205 L 1.000** 124.051
206 I 1.000** 124.051
207 G 1.000** 124.051
208 I 1.000** 124.051
209 N 1.000** 124.051
210 Y 1.000** 124.051
211 L 1.000** 124.051
212 G 1.000** 124.051
213 D 1.000** 124.051
214 F 1.000** 124.051
215 S 1.000** 124.051
216 S 1.000** 124.051
217 A 1.000** 124.051
218 S 1.000** 124.051
219 V 1.000** 124.051
220 I 1.000** 124.051
221 D 1.000** 124.051
222 G 1.000** 124.051
223 N 1.000** 124.051
224 V 1.000** 124.051
225 M 1.000** 124.051
226 H 1.000** 124.051
227 A 1.000** 124.051
228 N 1.000** 124.051
229 Y 1.000** 124.051
230 I 1.000** 124.051
231 F 1.000** 124.051
232 W 1.000** 124.051
233 R 1.000** 124.051
234 N 1.000** 124.051
235 S 1.000** 124.051
236 T 1.000** 124.051
237 I 1.000** 124.051
238 M 1.000** 124.051
239 T 1.000** 124.051
240 M 1.000** 124.051
241 S 1.000** 124.051
242 Y 1.000** 124.051
243 N 1.000** 124.051
244 S 1.000** 124.051
245 V 1.000** 124.051
246 L 1.000** 124.051
247 D 1.000** 124.051
248 L 1.000** 124.051
249 S 1.000** 124.051
250 K 1.000** 124.051
251 F 1.000** 124.051
252 R 1.000** 124.051
253 C 1.000** 124.051
254 K 1.000** 124.051
255 H 1.000** 124.051
256 K 1.000** 124.051
257 A 1.000** 124.051
258 T 1.000** 124.051
259 V 1.000** 124.051
260 I 1.000** 124.051
261 I 1.000** 124.051
262 T 1.000** 124.051
263 L 1.000** 124.051
264 K 1.000** 124.051
265 D 1.000** 124.051
266 K 1.000** 124.051
267 D 1.000** 124.051
268 I 1.000** 124.051
269 T 1.000** 124.051
270 D 1.000** 124.051
271 M 1.000** 124.051
272 V 1.000** 124.051
273 L 1.000** 124.051
274 G 1.000** 124.051
275 L 1.000** 124.051
276 I 1.000** 124.051
277 K 1.000** 124.051
278 N 1.000** 124.051
279 G 1.000** 124.051
280 K 1.000** 124.051
281 L 1.000** 124.051
282 L 1.000** 124.051
283 I 1.000** 124.051
284 R 1.000** 124.051
285 N 1.000** 124.051
286 S 1.000** 124.051
287 Q 1.000** 124.051
288 K 1.000** 124.051
289 L 1.000** 124.051
290 L 1.000** 124.051
291 N 1.000** 124.051
292 F 1.000** 124.051
293 S 1.000** 124.051
294 N 1.000** 124.051
295 H 1.000** 124.051
296 L 1.000** 124.051
297 V 1.000** 124.051
298 T 1.000** 124.051
299 T 1.000** 124.051
300 K 1.000** 124.051
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
129 Y 0.797 6.041 +- 3.442
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.041 0.054 0.068 0.081 0.094 0.107 0.120 0.133 0.145 0.158
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.007 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.022 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 1
lnL(ntime: 4 np: 7): -1155.948637 +0.000000
5..1 5..2 5..3 5..4
0.003370 0.000004 0.000004 0.000004 0.000100 8.192624 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003382
(1: 0.003370, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.003370, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 8.19262 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.003 805.3 94.7 1.0000 0.0011 0.0011 0.9 0.1
5..2 0.000 805.3 94.7 1.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 805.3 94.7 1.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 805.3 94.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 1
lnL(ntime: 4 np: 9): -1155.850930 +0.000000
5..1 5..2 5..3 5..4
0.003325 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.366916 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.003337
(1: 0.003325, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(C1: 0.003325, C2: 0.000004, C3: 0.000004, C4: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.36692
(p1 = 0.99999) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.003 805.3 94.7 998.9900 0.0012 0.0000 1.0 0.0
5..2 0.000 805.3 94.7 998.9900 0.0000 0.0000 0.0 0.0
5..3 0.000 805.3 94.7 998.9900 0.0000 0.0000 0.0 0.0
5..4 0.000 805.3 94.7 998.9900 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 1.000** 998.990
2 A 1.000** 998.990
3 E 1.000** 998.990
4 W 1.000** 998.990
5 K 1.000** 998.990
6 C 1.000** 998.990
7 G 1.000** 998.990
8 Y 1.000** 998.990
9 S 1.000** 998.990
10 M 1.000** 998.990
11 P 1.000** 998.990
12 S 1.000** 998.990
13 L 1.000** 998.990
14 Y 1.000** 998.990
15 K 1.000** 998.990
16 I 1.000** 998.990
17 Q 1.000** 998.990
18 N 1.000** 998.990
19 M 1.000** 998.990
20 C 1.000** 998.990
21 M 1.000** 998.990
22 D 1.000** 998.990
23 A 1.000** 998.990
24 C 1.000** 998.990
25 N 1.000** 998.990
26 L 1.000** 998.990
27 Y 1.000** 998.990
28 N 1.000** 998.990
29 Y 1.000** 998.990
30 G 1.000** 998.990
31 A 1.000** 998.990
32 S 1.000** 998.990
33 I 1.000** 998.990
34 K 1.000** 998.990
35 L 1.000** 998.990
36 P 1.000** 998.990
37 D 1.000** 998.990
38 G 1.000** 998.990
39 I 1.000** 998.990
40 M 1.000** 998.990
41 F 1.000** 998.990
42 N 1.000** 998.990
43 V 1.000** 998.990
44 V 1.000** 998.990
45 K 1.000** 998.990
46 Y 1.000** 998.990
47 T 1.000** 998.990
48 Q 1.000** 998.990
49 L 1.000** 998.990
50 C 1.000** 998.990
51 Q 1.000** 998.990
52 F 1.000** 998.990
53 L 1.000** 998.990
54 N 1.000** 998.990
55 T 1.000** 998.990
56 T 1.000** 998.990
57 T 1.000** 998.990
58 M 1.000** 998.990
59 C 1.000** 998.990
60 V 1.000** 998.990
61 P 1.000** 998.990
62 H 1.000** 998.990
63 N 1.000** 998.990
64 M 1.000** 998.990
65 R 1.000** 998.990
66 V 1.000** 998.990
67 L 1.000** 998.990
68 H 1.000** 998.990
69 L 1.000** 998.990
70 G 1.000** 998.990
71 A 1.000** 998.990
72 G 1.000** 998.990
73 S 1.000** 998.990
74 D 1.000** 998.990
75 K 1.000** 998.990
76 G 1.000** 998.990
77 V 1.000** 998.990
78 A 1.000** 998.990
79 P 1.000** 998.990
80 G 1.000** 998.990
81 T 1.000** 998.990
82 A 1.000** 998.990
83 V 1.000** 998.990
84 L 1.000** 998.990
85 R 1.000** 998.990
86 R 1.000** 998.990
87 W 1.000** 998.990
88 L 1.000** 998.990
89 P 1.000** 998.990
90 D 1.000** 998.990
91 D 1.000** 998.990
92 A 1.000** 998.990
93 I 1.000** 998.990
94 I 1.000** 998.990
95 V 1.000** 998.990
96 D 1.000** 998.990
97 N 1.000** 998.990
98 D 1.000** 998.990
99 V 1.000** 998.990
100 N 1.000** 998.990
101 D 1.000** 998.990
102 Y 1.000** 998.990
103 V 1.000** 998.990
104 S 1.000** 998.990
105 D 1.000** 998.990
106 A 1.000** 998.990
107 D 1.000** 998.990
108 F 1.000** 998.990
109 S 1.000** 998.990
110 I 1.000** 998.990
111 T 1.000** 998.990
112 G 1.000** 998.990
113 D 1.000** 998.990
114 C 1.000** 998.990
115 T 1.000** 998.990
116 H 1.000** 998.990
117 V 1.000** 998.990
118 Y 1.000** 998.990
119 V 1.000** 998.990
120 E 1.000** 998.990
121 D 1.000** 998.990
122 K 1.000** 998.990
123 F 1.000** 998.990
124 D 1.000** 998.990
125 L 1.000** 998.990
126 L 1.000** 998.990
127 I 1.000** 998.990
128 S 1.000** 998.990
129 Y 1.000** 999.000
130 M 1.000** 998.990
131 Y 1.000** 998.990
132 D 1.000** 998.990
133 G 1.000** 998.990
134 K 1.000** 998.990
135 I 1.000** 998.990
136 K 1.000** 998.990
137 S 1.000** 998.990
138 I 1.000** 998.990
139 D 1.000** 998.990
140 G 1.000** 998.990
141 D 1.000** 998.990
142 N 1.000** 998.990
143 V 1.000** 998.990
144 S 1.000** 998.990
145 K 1.000** 998.990
146 D 1.000** 998.990
147 G 1.000** 998.990
148 F 1.000** 998.990
149 F 1.000** 998.990
150 T 1.000** 998.990
151 Y 1.000** 998.990
152 I 1.000** 998.990
153 N 1.000** 998.990
154 G 1.000** 998.990
155 F 1.000** 998.990
156 I 1.000** 998.990
157 R 1.000** 998.990
158 E 1.000** 998.990
159 K 1.000** 998.990
160 L 1.000** 998.990
161 A 1.000** 998.990
162 L 1.000** 998.990
163 G 1.000** 998.990
164 G 1.000** 998.990
165 A 1.000** 998.990
166 M 1.000** 998.990
167 A 1.000** 998.990
168 V 1.000** 998.990
169 K 1.000** 998.990
170 I 1.000** 998.990
171 T 1.000** 998.990
172 E 1.000** 998.990
173 Y 1.000** 998.990
174 S 1.000** 998.990
175 W 1.000** 998.990
176 N 1.000** 998.990
177 K 1.000** 998.990
178 Q 1.000** 998.990
179 L 1.000** 998.990
180 Y 1.000** 998.990
181 E 1.000** 998.990
182 I 1.000** 998.990
183 A 1.000** 998.990
184 Q 1.000** 998.990
185 K 1.000** 998.990
186 F 1.000** 998.990
187 E 1.000** 998.990
188 Y 1.000** 998.990
189 W 1.000** 998.990
190 T 1.000** 998.990
191 L 1.000** 998.990
192 F 1.000** 998.990
193 C 1.000** 998.990
194 T 1.000** 998.990
195 S 1.000** 998.990
196 V 1.000** 998.990
197 N 1.000** 998.990
198 T 1.000** 998.990
199 S 1.000** 998.990
200 S 1.000** 998.990
201 S 1.000** 998.990
202 E 1.000** 998.990
203 A 1.000** 998.990
204 F 1.000** 998.990
205 L 1.000** 998.990
206 I 1.000** 998.990
207 G 1.000** 998.990
208 I 1.000** 998.990
209 N 1.000** 998.990
210 Y 1.000** 998.990
211 L 1.000** 998.990
212 G 1.000** 998.990
213 D 1.000** 998.990
214 F 1.000** 998.990
215 S 1.000** 998.990
216 S 1.000** 998.990
217 A 1.000** 998.990
218 S 1.000** 998.990
219 V 1.000** 998.990
220 I 1.000** 998.990
221 D 1.000** 998.990
222 G 1.000** 998.990
223 N 1.000** 998.990
224 V 1.000** 998.990
225 M 1.000** 998.990
226 H 1.000** 998.990
227 A 1.000** 998.990
228 N 1.000** 998.990
229 Y 1.000** 998.990
230 I 1.000** 998.990
231 F 1.000** 998.990
232 W 1.000** 998.990
233 R 1.000** 998.990
234 N 1.000** 998.990
235 S 1.000** 998.990
236 T 1.000** 998.990
237 I 1.000** 998.990
238 M 1.000** 998.990
239 T 1.000** 998.990
240 M 1.000** 998.990
241 S 1.000** 998.990
242 Y 1.000** 998.990
243 N 1.000** 998.990
244 S 1.000** 998.990
245 V 1.000** 998.990
246 L 1.000** 998.990
247 D 1.000** 998.990
248 L 1.000** 998.990
249 S 1.000** 998.990
250 K 1.000** 998.990
251 F 1.000** 998.990
252 R 1.000** 998.990
253 C 1.000** 998.990
254 K 1.000** 998.990
255 H 1.000** 998.990
256 K 1.000** 998.990
257 A 1.000** 998.990
258 T 1.000** 998.990
259 V 1.000** 998.990
260 I 1.000** 998.990
261 I 1.000** 998.990
262 T 1.000** 998.990
263 L 1.000** 998.990
264 K 1.000** 998.990
265 D 1.000** 998.990
266 K 1.000** 998.990
267 D 1.000** 998.990
268 I 1.000** 998.990
269 T 1.000** 998.990
270 D 1.000** 998.990
271 M 1.000** 998.990
272 V 1.000** 998.990
273 L 1.000** 998.990
274 G 1.000** 998.990
275 L 1.000** 998.990
276 I 1.000** 998.990
277 K 1.000** 998.990
278 N 1.000** 998.990
279 G 1.000** 998.990
280 K 1.000** 998.990
281 L 1.000** 998.990
282 L 1.000** 998.990
283 I 1.000** 998.990
284 R 1.000** 998.990
285 N 1.000** 998.990
286 S 1.000** 998.990
287 Q 1.000** 998.990
288 K 1.000** 998.990
289 L 1.000** 998.990
290 L 1.000** 998.990
291 N 1.000** 998.990
292 F 1.000** 998.990
293 S 1.000** 998.990
294 N 1.000** 998.990
295 H 1.000** 998.990
296 L 1.000** 998.990
297 V 1.000** 998.990
298 T 1.000** 998.990
299 T 1.000** 998.990
300 K 1.000** 998.990
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C1)
Pr(w>1) post mean +- SE for w
1 S 0.639 4.861 +- 3.857
2 A 0.639 4.861 +- 3.857
3 E 0.639 4.861 +- 3.857
4 W 0.639 4.861 +- 3.857
5 K 0.639 4.861 +- 3.857
6 C 0.639 4.861 +- 3.857
7 G 0.639 4.861 +- 3.857
8 Y 0.639 4.861 +- 3.857
9 S 0.639 4.861 +- 3.857
10 M 0.639 4.861 +- 3.857
11 P 0.639 4.861 +- 3.857
12 S 0.639 4.861 +- 3.857
13 L 0.639 4.861 +- 3.857
14 Y 0.639 4.861 +- 3.857
15 K 0.639 4.861 +- 3.857
16 I 0.639 4.861 +- 3.857
17 Q 0.639 4.861 +- 3.857
18 N 0.639 4.861 +- 3.857
19 M 0.639 4.861 +- 3.857
20 C 0.639 4.861 +- 3.857
21 M 0.639 4.861 +- 3.857
22 D 0.639 4.861 +- 3.857
23 A 0.639 4.861 +- 3.857
24 C 0.639 4.861 +- 3.857
25 N 0.639 4.861 +- 3.857
26 L 0.639 4.861 +- 3.857
27 Y 0.639 4.861 +- 3.857
28 N 0.639 4.861 +- 3.857
29 Y 0.639 4.861 +- 3.857
30 G 0.639 4.861 +- 3.857
31 A 0.639 4.861 +- 3.857
32 S 0.639 4.861 +- 3.857
33 I 0.639 4.861 +- 3.857
34 K 0.639 4.861 +- 3.857
35 L 0.639 4.861 +- 3.857
36 P 0.639 4.861 +- 3.857
37 D 0.639 4.861 +- 3.857
38 G 0.639 4.861 +- 3.857
39 I 0.639 4.861 +- 3.857
40 M 0.639 4.861 +- 3.857
41 F 0.639 4.861 +- 3.857
42 N 0.639 4.861 +- 3.857
43 V 0.639 4.861 +- 3.857
44 V 0.639 4.861 +- 3.857
45 K 0.639 4.861 +- 3.857
46 Y 0.639 4.861 +- 3.857
47 T 0.639 4.861 +- 3.857
48 Q 0.639 4.861 +- 3.857
49 L 0.639 4.861 +- 3.857
50 C 0.639 4.861 +- 3.857
51 Q 0.639 4.861 +- 3.857
52 F 0.639 4.861 +- 3.857
53 L 0.639 4.861 +- 3.857
54 N 0.639 4.861 +- 3.857
55 T 0.639 4.861 +- 3.857
56 T 0.639 4.861 +- 3.857
57 T 0.639 4.861 +- 3.857
58 M 0.639 4.861 +- 3.857
59 C 0.639 4.861 +- 3.857
60 V 0.639 4.861 +- 3.857
61 P 0.639 4.861 +- 3.857
62 H 0.639 4.861 +- 3.857
63 N 0.639 4.861 +- 3.857
64 M 0.639 4.861 +- 3.857
65 R 0.639 4.861 +- 3.857
66 V 0.639 4.861 +- 3.857
67 L 0.639 4.861 +- 3.857
68 H 0.639 4.861 +- 3.857
69 L 0.639 4.861 +- 3.857
70 G 0.639 4.861 +- 3.857
71 A 0.639 4.861 +- 3.857
72 G 0.639 4.861 +- 3.857
73 S 0.639 4.861 +- 3.857
74 D 0.639 4.861 +- 3.857
75 K 0.639 4.861 +- 3.857
76 G 0.639 4.861 +- 3.857
77 V 0.639 4.861 +- 3.857
78 A 0.639 4.861 +- 3.857
79 P 0.639 4.861 +- 3.857
80 G 0.639 4.861 +- 3.857
81 T 0.639 4.861 +- 3.857
82 A 0.639 4.861 +- 3.857
83 V 0.639 4.861 +- 3.857
84 L 0.639 4.861 +- 3.857
85 R 0.639 4.861 +- 3.857
86 R 0.639 4.861 +- 3.857
87 W 0.639 4.861 +- 3.857
88 L 0.639 4.861 +- 3.857
89 P 0.639 4.861 +- 3.857
90 D 0.639 4.861 +- 3.857
91 D 0.639 4.861 +- 3.857
92 A 0.639 4.861 +- 3.857
93 I 0.639 4.861 +- 3.857
94 I 0.639 4.861 +- 3.857
95 V 0.639 4.861 +- 3.857
96 D 0.639 4.861 +- 3.857
97 N 0.639 4.861 +- 3.857
98 D 0.639 4.861 +- 3.857
99 V 0.639 4.861 +- 3.857
100 N 0.639 4.861 +- 3.857
101 D 0.639 4.861 +- 3.857
102 Y 0.639 4.861 +- 3.857
103 V 0.639 4.861 +- 3.857
104 S 0.639 4.861 +- 3.857
105 D 0.639 4.861 +- 3.857
106 A 0.639 4.861 +- 3.857
107 D 0.639 4.861 +- 3.857
108 F 0.639 4.861 +- 3.857
109 S 0.639 4.861 +- 3.857
110 I 0.639 4.861 +- 3.857
111 T 0.639 4.861 +- 3.857
112 G 0.639 4.861 +- 3.857
113 D 0.639 4.861 +- 3.857
114 C 0.639 4.861 +- 3.857
115 T 0.639 4.861 +- 3.857
116 H 0.639 4.861 +- 3.857
117 V 0.639 4.861 +- 3.857
118 Y 0.639 4.861 +- 3.857
119 V 0.639 4.861 +- 3.857
120 E 0.639 4.861 +- 3.857
121 D 0.639 4.861 +- 3.857
122 K 0.639 4.861 +- 3.857
123 F 0.639 4.861 +- 3.857
124 D 0.639 4.861 +- 3.857
125 L 0.639 4.861 +- 3.857
126 L 0.639 4.861 +- 3.857
127 I 0.639 4.861 +- 3.857
128 S 0.639 4.861 +- 3.857
129 Y 0.923 6.858 +- 3.003
130 M 0.639 4.861 +- 3.857
131 Y 0.639 4.861 +- 3.857
132 D 0.639 4.861 +- 3.857
133 G 0.639 4.861 +- 3.857
134 K 0.639 4.861 +- 3.857
135 I 0.639 4.861 +- 3.857
136 K 0.639 4.861 +- 3.857
137 S 0.639 4.861 +- 3.857
138 I 0.639 4.861 +- 3.857
139 D 0.639 4.861 +- 3.857
140 G 0.639 4.861 +- 3.857
141 D 0.639 4.861 +- 3.857
142 N 0.639 4.861 +- 3.857
143 V 0.639 4.861 +- 3.857
144 S 0.639 4.861 +- 3.857
145 K 0.639 4.861 +- 3.857
146 D 0.639 4.861 +- 3.857
147 G 0.639 4.861 +- 3.857
148 F 0.639 4.861 +- 3.857
149 F 0.639 4.861 +- 3.857
150 T 0.639 4.861 +- 3.857
151 Y 0.639 4.861 +- 3.857
152 I 0.639 4.861 +- 3.857
153 N 0.639 4.861 +- 3.857
154 G 0.639 4.861 +- 3.857
155 F 0.639 4.861 +- 3.857
156 I 0.639 4.861 +- 3.857
157 R 0.639 4.861 +- 3.857
158 E 0.639 4.861 +- 3.857
159 K 0.639 4.861 +- 3.857
160 L 0.639 4.861 +- 3.857
161 A 0.639 4.861 +- 3.857
162 L 0.639 4.861 +- 3.857
163 G 0.639 4.861 +- 3.857
164 G 0.639 4.861 +- 3.857
165 A 0.639 4.861 +- 3.857
166 M 0.639 4.861 +- 3.857
167 A 0.639 4.861 +- 3.857
168 V 0.639 4.861 +- 3.857
169 K 0.639 4.861 +- 3.857
170 I 0.639 4.861 +- 3.857
171 T 0.639 4.861 +- 3.857
172 E 0.639 4.861 +- 3.857
173 Y 0.639 4.861 +- 3.857
174 S 0.639 4.861 +- 3.857
175 W 0.639 4.861 +- 3.857
176 N 0.639 4.861 +- 3.857
177 K 0.639 4.861 +- 3.857
178 Q 0.639 4.861 +- 3.857
179 L 0.639 4.861 +- 3.857
180 Y 0.639 4.861 +- 3.857
181 E 0.639 4.861 +- 3.857
182 I 0.639 4.861 +- 3.857
183 A 0.639 4.861 +- 3.857
184 Q 0.639 4.861 +- 3.857
185 K 0.639 4.861 +- 3.857
186 F 0.639 4.861 +- 3.857
187 E 0.639 4.861 +- 3.857
188 Y 0.639 4.861 +- 3.857
189 W 0.639 4.861 +- 3.857
190 T 0.639 4.861 +- 3.857
191 L 0.639 4.861 +- 3.857
192 F 0.639 4.861 +- 3.857
193 C 0.639 4.861 +- 3.857
194 T 0.639 4.861 +- 3.857
195 S 0.639 4.861 +- 3.857
196 V 0.639 4.861 +- 3.857
197 N 0.639 4.861 +- 3.857
198 T 0.639 4.861 +- 3.857
199 S 0.639 4.861 +- 3.857
200 S 0.639 4.861 +- 3.857
201 S 0.639 4.861 +- 3.857
202 E 0.639 4.861 +- 3.857
203 A 0.639 4.861 +- 3.857
204 F 0.639 4.861 +- 3.857
205 L 0.639 4.861 +- 3.857
206 I 0.639 4.861 +- 3.857
207 G 0.639 4.861 +- 3.857
208 I 0.639 4.861 +- 3.857
209 N 0.639 4.861 +- 3.857
210 Y 0.639 4.861 +- 3.857
211 L 0.639 4.861 +- 3.857
212 G 0.639 4.861 +- 3.857
213 D 0.639 4.861 +- 3.857
214 F 0.639 4.861 +- 3.857
215 S 0.639 4.861 +- 3.857
216 S 0.639 4.861 +- 3.857
217 A 0.639 4.861 +- 3.857
218 S 0.639 4.861 +- 3.857
219 V 0.639 4.861 +- 3.857
220 I 0.639 4.861 +- 3.857
221 D 0.639 4.861 +- 3.857
222 G 0.639 4.861 +- 3.857
223 N 0.639 4.861 +- 3.857
224 V 0.639 4.861 +- 3.857
225 M 0.639 4.861 +- 3.857
226 H 0.639 4.861 +- 3.857
227 A 0.639 4.861 +- 3.857
228 N 0.639 4.861 +- 3.857
229 Y 0.639 4.861 +- 3.857
230 I 0.639 4.861 +- 3.857
231 F 0.639 4.861 +- 3.857
232 W 0.639 4.861 +- 3.857
233 R 0.639 4.861 +- 3.857
234 N 0.639 4.861 +- 3.857
235 S 0.639 4.861 +- 3.857
236 T 0.639 4.861 +- 3.857
237 I 0.639 4.861 +- 3.857
238 M 0.639 4.861 +- 3.857
239 T 0.639 4.861 +- 3.857
240 M 0.639 4.861 +- 3.857
241 S 0.639 4.861 +- 3.857
242 Y 0.639 4.861 +- 3.857
243 N 0.639 4.861 +- 3.857
244 S 0.639 4.861 +- 3.857
245 V 0.639 4.861 +- 3.857
246 L 0.639 4.861 +- 3.857
247 D 0.639 4.861 +- 3.857
248 L 0.639 4.861 +- 3.857
249 S 0.639 4.861 +- 3.857
250 K 0.639 4.861 +- 3.857
251 F 0.639 4.861 +- 3.857
252 R 0.639 4.861 +- 3.857
253 C 0.639 4.861 +- 3.857
254 K 0.639 4.861 +- 3.857
255 H 0.639 4.861 +- 3.857
256 K 0.639 4.861 +- 3.857
257 A 0.639 4.861 +- 3.857
258 T 0.639 4.861 +- 3.857
259 V 0.639 4.861 +- 3.857
260 I 0.639 4.861 +- 3.857
261 I 0.639 4.861 +- 3.857
262 T 0.639 4.861 +- 3.857
263 L 0.639 4.861 +- 3.857
264 K 0.639 4.861 +- 3.857
265 D 0.639 4.861 +- 3.857
266 K 0.639 4.861 +- 3.857
267 D 0.639 4.861 +- 3.857
268 I 0.639 4.861 +- 3.857
269 T 0.639 4.861 +- 3.857
270 D 0.639 4.861 +- 3.857
271 M 0.639 4.861 +- 3.857
272 V 0.639 4.861 +- 3.857
273 L 0.639 4.861 +- 3.857
274 G 0.639 4.861 +- 3.857
275 L 0.639 4.861 +- 3.857
276 I 0.639 4.861 +- 3.857
277 K 0.639 4.861 +- 3.857
278 N 0.639 4.861 +- 3.857
279 G 0.639 4.861 +- 3.857
280 K 0.639 4.861 +- 3.857
281 L 0.639 4.861 +- 3.857
282 L 0.639 4.861 +- 3.857
283 I 0.639 4.861 +- 3.857
284 R 0.639 4.861 +- 3.857
285 N 0.639 4.861 +- 3.857
286 S 0.639 4.861 +- 3.857
287 Q 0.639 4.861 +- 3.857
288 K 0.639 4.861 +- 3.857
289 L 0.639 4.861 +- 3.857
290 L 0.639 4.861 +- 3.857
291 N 0.639 4.861 +- 3.857
292 F 0.639 4.861 +- 3.857
293 S 0.639 4.861 +- 3.857
294 N 0.639 4.861 +- 3.857
295 H 0.639 4.861 +- 3.857
296 L 0.639 4.861 +- 3.857
297 V 0.639 4.861 +- 3.857
298 T 0.639 4.861 +- 3.857
299 T 0.639 4.861 +- 3.857
300 K 0.639 4.861 +- 3.857
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:18
Model 1: NearlyNeutral -1155.948637 Model 2: PositiveSelection -1155.851655 Model 7: beta -1155.948637 Model 8: beta&w>1 -1155.850930 Model 2 vs 1 .193964 Model 8 vs 7 .195414
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
