--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:07:06 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1222/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -792.97 -796.29
2 -792.95 -796.69
--------------------------------------
TOTAL -792.96 -796.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897772 0.089982 0.355598 1.460203 0.863950 1343.88 1419.38 1.000
r(A<->C){all} 0.169610 0.020390 0.000065 0.456099 0.129928 270.09 310.25 1.004
r(A<->G){all} 0.167104 0.019446 0.000043 0.440783 0.128072 233.86 296.14 1.001
r(A<->T){all} 0.160052 0.018389 0.000023 0.420664 0.124792 201.49 234.35 1.000
r(C<->G){all} 0.162032 0.019440 0.000020 0.443227 0.123539 159.62 172.88 1.001
r(C<->T){all} 0.165480 0.020639 0.000014 0.457291 0.122929 100.34 108.06 1.000
r(G<->T){all} 0.175723 0.021684 0.000119 0.466393 0.136385 148.65 223.64 1.000
pi(A){all} 0.143858 0.000212 0.116718 0.173054 0.143601 1342.76 1361.04 1.000
pi(C){all} 0.269710 0.000342 0.233640 0.305209 0.269363 1069.11 1219.97 1.000
pi(G){all} 0.367536 0.000395 0.327609 0.404195 0.366984 1000.65 1070.77 1.000
pi(T){all} 0.218897 0.000300 0.185126 0.251413 0.219189 1057.13 1256.56 1.001
alpha{1,2} 0.415751 0.215669 0.000103 1.363644 0.245073 1010.17 1141.49 1.000
alpha{3} 0.445590 0.228746 0.000198 1.416554 0.279176 1128.75 1189.47 1.000
pinvar{all} 0.997327 0.000010 0.991368 0.999999 0.998376 1254.08 1270.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -766.315188
Model 2: PositiveSelection -766.315095
Model 0: one-ratio -766.31511
Model 7: beta -766.315095
Model 8: beta&w>1 -766.315514
Model 0 vs 1 1.560000000608852E-4
Model 2 vs 1 1.859999999851425E-4
Model 8 vs 7 8.379999999306165E-4
>C1
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C2
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C3
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C4
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C5
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C6
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=198
C1 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C2 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C3 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C4 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C5 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C6 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
**************************************************
C1 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C2 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C3 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C4 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C5 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C6 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
**************************************************
C1 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C2 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C3 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C4 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C5 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C6 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
**************************************************
C1 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C2 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C3 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C4 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C5 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C6 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 198 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 198 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5940]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5940]--->[5940]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.741 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C2 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C3 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C4 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C5 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
C6 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
**************************************************
C1 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C2 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C3 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C4 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C5 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
C6 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
**************************************************
C1 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C2 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C3 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C4 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C5 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
C6 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
**************************************************
C1 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C2 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C3 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C4 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C5 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
C6 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
C2 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
C3 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
C4 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
C5 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
C6 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
**************************************************
C1 GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
C2 GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
C3 GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
C4 GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
C5 GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
C6 GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
**************************************************
C1 TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
C2 TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
C3 TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
C4 TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
C5 TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
C6 TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
**************************************************
C1 GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
C2 GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
C3 GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
C4 GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
C5 GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
C6 GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
**************************************************
C1 CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
C2 CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
C3 CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
C4 CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
C5 CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
C6 CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
**************************************************
C1 TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
C2 TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
C3 TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
C4 TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
C5 TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
C6 TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
**************************************************
C1 CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
C2 CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
C3 CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
C4 CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
C5 CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
C6 CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
**************************************************
C1 TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
C2 TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
C3 TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
C4 TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
C5 TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
C6 TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
**************************************************
C1 ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
C2 ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
C3 ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
C4 ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
C5 ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
C6 ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
**************************************************
C1 CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
C2 CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
C3 CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
C4 CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
C5 CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
C6 CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
**************************************************
C1 CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
C2 CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
C3 CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
C4 CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
C5 CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
C6 CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
**************************************************
C1 CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
C2 CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
C3 CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
C4 CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
C5 CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
C6 CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
********************************************
>C1
GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>C2
GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>C3
GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>C4
GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>C5
GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>C6
GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG
GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT
TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG
GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC
CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC
TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG
CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC
TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA
ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT
CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC
CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG
CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>C1
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C2
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C3
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C4
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C5
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
>C6
VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 594 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856752
Setting output file names to "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1080103498
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5717295636
Seed = 1733974319
Swapseed = 1579856752
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1329.400471 -- -24.965149
Chain 2 -- -1329.400471 -- -24.965149
Chain 3 -- -1329.400471 -- -24.965149
Chain 4 -- -1329.400471 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1329.400471 -- -24.965149
Chain 2 -- -1329.400393 -- -24.965149
Chain 3 -- -1329.400471 -- -24.965149
Chain 4 -- -1329.400471 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1329.400] (-1329.400) (-1329.400) (-1329.400) * [-1329.400] (-1329.400) (-1329.400) (-1329.400)
500 -- [-814.615] (-815.714) (-819.185) (-814.214) * (-823.772) (-815.747) (-805.638) [-810.507] -- 0:00:00
1000 -- (-812.000) (-806.709) [-801.864] (-819.195) * (-799.509) [-807.768] (-803.551) (-805.203) -- 0:00:00
1500 -- (-800.793) (-816.509) (-806.755) [-803.580] * (-800.474) [-809.738] (-804.487) (-803.526) -- 0:00:00
2000 -- (-802.855) (-796.205) [-803.312] (-805.431) * (-801.025) [-801.294] (-804.621) (-804.958) -- 0:00:00
2500 -- (-808.860) (-806.642) (-806.844) [-802.359] * (-808.492) (-804.634) (-800.458) [-797.852] -- 0:00:00
3000 -- (-799.982) (-806.893) [-798.602] (-801.309) * (-801.232) [-797.830] (-799.863) (-799.969) -- 0:00:00
3500 -- [-801.541] (-807.186) (-806.702) (-800.266) * (-798.955) [-800.458] (-801.934) (-802.970) -- 0:00:00
4000 -- (-812.541) [-802.971] (-807.679) (-804.738) * (-801.489) [-802.498] (-804.071) (-800.617) -- 0:00:00
4500 -- (-796.010) (-805.961) (-801.950) [-807.032] * (-805.323) (-801.178) [-809.117] (-803.555) -- 0:00:00
5000 -- [-802.139] (-799.562) (-803.916) (-804.311) * (-805.771) [-800.382] (-801.949) (-797.015) -- 0:00:00
Average standard deviation of split frequencies: 0.070711
5500 -- (-807.284) (-804.529) (-802.038) [-799.719] * (-812.860) (-798.456) (-804.484) [-798.356] -- 0:00:00
6000 -- (-813.203) (-803.788) (-802.364) [-799.277] * (-799.838) (-799.395) [-803.800] (-801.415) -- 0:00:00
6500 -- (-802.846) [-795.788] (-798.128) (-800.294) * (-805.533) [-802.397] (-800.973) (-803.327) -- 0:00:00
7000 -- (-816.693) (-802.205) [-802.408] (-801.078) * (-804.014) (-804.874) (-802.116) [-796.590] -- 0:02:21
7500 -- [-800.233] (-800.420) (-800.864) (-805.409) * (-797.878) [-804.184] (-805.128) (-815.047) -- 0:02:12
8000 -- (-806.813) [-800.256] (-807.587) (-805.191) * (-804.975) [-806.368] (-803.560) (-809.090) -- 0:02:04
8500 -- [-804.017] (-804.293) (-804.148) (-798.806) * (-802.004) [-803.922] (-799.621) (-810.736) -- 0:01:56
9000 -- (-799.138) (-802.235) (-797.272) [-803.849] * (-799.834) (-811.718) (-802.108) [-799.671] -- 0:01:50
9500 -- (-805.123) (-801.825) [-800.204] (-800.569) * (-799.859) [-801.007] (-806.650) (-809.166) -- 0:01:44
10000 -- (-803.958) (-800.395) (-798.298) [-799.176] * (-807.206) (-800.599) [-797.664] (-802.096) -- 0:01:39
Average standard deviation of split frequencies: 0.055243
10500 -- (-798.946) [-802.196] (-802.139) (-807.131) * (-802.722) (-805.597) (-805.857) [-802.807] -- 0:01:34
11000 -- (-798.021) [-798.341] (-804.055) (-803.622) * (-810.458) [-798.758] (-807.754) (-802.517) -- 0:01:29
11500 -- (-799.880) [-805.923] (-811.331) (-799.407) * (-801.918) (-797.560) [-800.477] (-804.167) -- 0:01:25
12000 -- (-816.276) (-797.092) [-798.602] (-805.312) * (-810.226) (-804.919) [-799.896] (-800.313) -- 0:01:22
12500 -- [-799.979] (-806.028) (-810.637) (-799.183) * [-793.344] (-802.630) (-802.437) (-796.910) -- 0:01:19
13000 -- (-806.425) (-803.135) (-801.616) [-799.832] * (-792.959) (-801.144) (-806.874) [-799.208] -- 0:01:15
13500 -- (-804.700) (-800.750) (-802.783) [-805.197] * (-797.224) [-796.448] (-801.017) (-806.898) -- 0:01:13
14000 -- (-803.977) (-810.284) (-799.150) [-798.248] * (-798.288) (-803.290) [-806.477] (-798.596) -- 0:01:10
14500 -- (-801.270) [-806.289] (-804.658) (-800.923) * (-794.413) (-800.362) [-799.050] (-800.928) -- 0:01:07
15000 -- (-809.528) (-799.967) [-799.050] (-797.848) * [-793.887] (-800.837) (-802.351) (-797.471) -- 0:01:05
Average standard deviation of split frequencies: 0.055652
15500 -- [-802.604] (-803.463) (-803.766) (-820.896) * (-793.043) [-802.658] (-803.632) (-800.716) -- 0:01:03
16000 -- (-806.908) (-805.634) (-801.907) [-798.260] * (-794.487) [-801.412] (-814.613) (-801.059) -- 0:01:01
16500 -- (-802.838) (-806.338) [-800.489] (-797.909) * (-793.832) [-808.931] (-803.483) (-799.563) -- 0:00:59
17000 -- (-801.448) (-804.723) (-800.908) [-794.625] * [-793.708] (-803.506) (-804.944) (-802.579) -- 0:00:57
17500 -- (-801.096) [-799.480] (-799.794) (-796.457) * [-792.795] (-807.998) (-802.235) (-801.255) -- 0:00:56
18000 -- (-803.064) [-801.817] (-806.649) (-796.141) * (-793.474) [-800.265] (-814.002) (-801.858) -- 0:00:54
18500 -- (-797.142) (-809.699) (-799.361) [-793.333] * (-795.021) [-805.593] (-806.049) (-809.824) -- 0:00:53
19000 -- (-802.142) [-803.298] (-802.067) (-794.841) * (-798.322) (-806.203) [-794.663] (-806.604) -- 0:00:51
19500 -- (-802.716) (-800.863) (-801.677) [-793.404] * [-793.416] (-804.101) (-795.042) (-811.062) -- 0:00:50
20000 -- (-799.856) (-798.540) (-806.319) [-792.351] * (-799.643) (-801.533) [-793.988] (-802.449) -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- (-801.005) (-811.199) (-809.255) [-792.284] * (-793.005) [-800.552] (-791.705) (-792.885) -- 0:00:47
21000 -- (-808.483) [-802.713] (-799.629) (-795.486) * (-792.790) (-800.380) (-791.513) [-794.735] -- 0:00:46
21500 -- (-798.625) (-811.801) (-804.464) [-791.889] * (-793.761) (-812.153) (-794.302) [-791.942] -- 0:00:45
22000 -- (-801.222) (-811.593) [-800.143] (-793.231) * [-792.412] (-802.782) (-792.119) (-793.388) -- 0:00:44
22500 -- [-798.479] (-795.869) (-803.742) (-794.723) * (-793.940) (-798.319) [-792.521] (-792.601) -- 0:00:43
23000 -- (-803.400) (-798.283) (-803.669) [-793.293] * [-792.627] (-803.348) (-794.346) (-795.114) -- 0:00:42
23500 -- (-805.607) [-795.341] (-801.264) (-792.352) * (-792.268) [-803.218] (-793.888) (-794.038) -- 0:01:23
24000 -- (-800.932) (-796.334) [-796.860] (-792.849) * (-792.339) (-810.341) (-794.475) [-793.015] -- 0:01:21
24500 -- (-811.173) [-795.100] (-801.542) (-795.374) * (-792.610) [-799.297] (-794.554) (-794.258) -- 0:01:19
25000 -- (-806.549) (-798.441) (-797.802) [-795.611] * (-795.168) (-812.912) (-795.969) [-795.295] -- 0:01:18
Average standard deviation of split frequencies: 0.042855
25500 -- (-811.696) (-793.291) (-806.743) [-793.683] * (-795.051) (-802.648) [-794.187] (-798.623) -- 0:01:16
26000 -- [-793.869] (-794.613) (-800.323) (-794.862) * (-793.072) [-800.696] (-791.476) (-794.586) -- 0:01:14
26500 -- (-793.574) (-791.838) [-806.881] (-795.334) * (-794.590) (-804.117) [-795.434] (-792.994) -- 0:01:13
27000 -- (-793.435) (-791.658) [-802.032] (-795.903) * (-794.556) (-804.349) [-792.705] (-797.473) -- 0:01:12
27500 -- (-793.519) (-792.755) [-798.055] (-793.580) * (-795.237) (-805.339) (-795.411) [-793.240] -- 0:01:10
28000 -- (-793.587) (-792.865) [-803.982] (-794.008) * [-804.452] (-817.070) (-792.140) (-793.442) -- 0:01:09
28500 -- (-793.105) [-794.318] (-801.397) (-793.400) * (-793.265) (-801.312) [-792.778] (-792.927) -- 0:01:08
29000 -- (-796.309) [-793.349] (-806.408) (-793.472) * (-795.209) (-793.643) [-793.957] (-797.893) -- 0:01:06
29500 -- (-793.040) (-793.752) [-800.290] (-793.155) * [-794.393] (-795.284) (-794.053) (-795.005) -- 0:01:05
30000 -- [-793.003] (-794.253) (-803.005) (-791.933) * (-796.643) (-796.468) (-791.629) [-793.109] -- 0:01:04
Average standard deviation of split frequencies: 0.039967
30500 -- (-793.216) (-792.506) [-803.069] (-794.050) * (-791.707) (-798.768) [-795.230] (-793.592) -- 0:01:03
31000 -- (-794.183) (-795.080) (-802.925) [-791.828] * (-791.721) (-792.948) (-793.565) [-793.637] -- 0:01:02
31500 -- (-793.731) (-794.590) [-797.181] (-792.690) * (-792.704) (-794.957) [-795.409] (-793.054) -- 0:01:01
32000 -- (-792.455) (-793.641) (-805.147) [-792.853] * (-793.201) [-795.678] (-793.895) (-793.439) -- 0:01:00
32500 -- (-792.945) [-792.497] (-808.254) (-793.346) * (-793.429) [-797.019] (-795.173) (-792.837) -- 0:00:59
33000 -- (-793.454) (-795.784) [-802.595] (-792.865) * (-792.823) (-793.128) (-795.824) [-794.025] -- 0:00:58
33500 -- (-794.265) (-799.573) (-802.075) [-795.389] * (-794.141) (-793.027) (-792.139) [-793.076] -- 0:00:57
34000 -- (-797.659) (-796.343) (-800.246) [-796.003] * [-792.353] (-793.305) (-791.695) (-793.630) -- 0:00:56
34500 -- (-793.796) (-796.383) (-810.885) [-792.583] * (-793.704) [-792.713] (-793.677) (-793.809) -- 0:00:55
35000 -- (-792.108) (-797.333) (-794.477) [-791.926] * (-791.959) [-794.267] (-797.293) (-792.091) -- 0:00:55
Average standard deviation of split frequencies: 0.035838
35500 -- (-792.158) (-792.781) (-793.563) [-792.523] * (-793.581) [-797.344] (-794.816) (-792.600) -- 0:00:54
36000 -- (-796.141) [-792.250] (-796.254) (-794.570) * (-793.330) (-792.567) [-792.783] (-792.944) -- 0:00:53
36500 -- [-794.277] (-792.174) (-795.280) (-792.365) * [-794.924] (-793.118) (-797.165) (-794.901) -- 0:00:52
37000 -- (-793.172) [-793.356] (-794.506) (-791.514) * (-792.129) (-793.259) (-797.270) [-793.230] -- 0:00:52
37500 -- [-791.984] (-795.454) (-793.815) (-791.856) * [-794.226] (-793.754) (-794.651) (-798.584) -- 0:00:51
38000 -- (-793.432) [-796.023] (-793.324) (-792.683) * [-793.417] (-795.489) (-794.606) (-794.599) -- 0:00:50
38500 -- (-794.339) (-792.993) [-795.008] (-792.793) * (-792.454) (-792.825) [-792.670] (-793.950) -- 0:00:49
39000 -- (-793.363) (-794.152) [-792.983] (-792.669) * [-793.493] (-794.367) (-792.724) (-794.610) -- 0:00:49
39500 -- (-798.437) [-794.747] (-792.765) (-794.637) * [-793.574] (-794.635) (-797.554) (-793.250) -- 0:00:48
40000 -- [-792.247] (-792.133) (-794.382) (-792.636) * (-794.172) (-792.303) (-793.142) [-803.160] -- 0:00:48
Average standard deviation of split frequencies: 0.030505
40500 -- (-794.180) [-792.801] (-796.131) (-796.489) * [-793.407] (-794.215) (-792.979) (-797.940) -- 0:01:11
41000 -- (-795.424) [-793.921] (-792.850) (-793.724) * (-796.979) (-793.709) [-794.420] (-798.257) -- 0:01:10
41500 -- [-794.306] (-792.421) (-792.311) (-793.436) * (-797.033) (-793.463) [-793.332] (-795.764) -- 0:01:09
42000 -- (-794.124) (-792.633) [-791.954] (-794.367) * (-793.796) (-794.094) (-795.906) [-794.190] -- 0:01:08
42500 -- [-796.392] (-792.832) (-792.845) (-794.595) * (-795.995) (-793.906) [-797.853] (-792.544) -- 0:01:07
43000 -- (-793.957) (-796.951) (-793.294) [-793.480] * [-792.653] (-800.819) (-791.837) (-792.581) -- 0:01:06
43500 -- (-791.581) (-796.116) [-796.174] (-799.054) * [-794.880] (-793.775) (-794.424) (-794.838) -- 0:01:05
44000 -- [-793.963] (-793.581) (-793.841) (-793.586) * (-797.337) (-798.299) (-796.541) [-794.613] -- 0:01:05
44500 -- (-793.949) [-796.992] (-793.089) (-792.219) * [-795.413] (-799.480) (-794.303) (-793.238) -- 0:01:04
45000 -- (-794.047) (-794.143) [-792.839] (-792.442) * [-791.892] (-794.699) (-795.811) (-796.975) -- 0:01:03
Average standard deviation of split frequencies: 0.027816
45500 -- (-797.508) [-791.830] (-791.841) (-795.140) * (-794.950) [-791.721] (-793.775) (-794.511) -- 0:01:02
46000 -- [-793.725] (-792.350) (-795.493) (-792.561) * (-791.799) (-794.964) (-792.963) [-795.516] -- 0:01:02
46500 -- (-795.518) [-792.887] (-799.110) (-798.673) * [-794.151] (-792.348) (-793.636) (-794.397) -- 0:01:01
47000 -- (-791.852) (-794.776) [-794.320] (-793.296) * (-793.093) (-792.583) (-793.937) [-793.700] -- 0:01:00
47500 -- (-792.390) (-794.260) (-794.648) [-793.630] * [-792.790] (-792.644) (-793.568) (-792.539) -- 0:01:00
48000 -- [-794.628] (-792.105) (-795.911) (-801.196) * (-795.640) [-795.103] (-795.737) (-794.761) -- 0:00:59
48500 -- (-797.489) [-792.809] (-793.174) (-795.789) * (-792.671) [-793.367] (-793.096) (-795.954) -- 0:00:58
49000 -- (-794.779) [-792.232] (-792.134) (-795.396) * (-792.257) (-793.218) (-793.437) [-794.782] -- 0:00:58
49500 -- (-796.039) (-792.738) [-792.259] (-792.233) * (-792.548) [-792.552] (-791.879) (-794.778) -- 0:00:57
50000 -- (-792.072) (-793.217) (-794.328) [-792.627] * [-794.557] (-793.348) (-793.010) (-793.343) -- 0:00:57
Average standard deviation of split frequencies: 0.031634
50500 -- [-793.813] (-797.373) (-795.886) (-793.256) * (-796.353) [-792.689] (-795.446) (-793.186) -- 0:00:56
51000 -- (-793.344) [-796.712] (-794.587) (-797.621) * [-795.767] (-799.173) (-792.996) (-794.517) -- 0:00:55
51500 -- (-799.500) [-794.308] (-794.101) (-797.125) * (-797.442) (-796.116) (-792.901) [-792.342] -- 0:00:55
52000 -- (-794.509) (-795.545) [-793.972] (-796.192) * (-795.754) (-794.280) (-792.899) [-792.093] -- 0:00:54
52500 -- (-792.774) [-795.163] (-793.581) (-796.987) * (-795.120) (-793.307) [-792.261] (-794.597) -- 0:00:54
53000 -- (-792.093) [-793.696] (-794.109) (-792.525) * (-794.650) (-796.787) (-796.603) [-792.212] -- 0:00:53
53500 -- (-793.048) [-793.316] (-793.392) (-795.820) * (-794.446) (-795.275) [-797.298] (-792.095) -- 0:00:53
54000 -- [-794.177] (-795.959) (-798.863) (-794.259) * (-794.591) (-794.544) (-795.248) [-793.261] -- 0:00:52
54500 -- (-793.998) [-794.947] (-795.118) (-794.910) * (-795.920) (-792.211) [-799.498] (-792.331) -- 0:00:52
55000 -- (-792.637) (-794.220) [-794.813] (-793.060) * (-797.637) (-791.819) [-796.527] (-794.035) -- 0:00:51
Average standard deviation of split frequencies: 0.031146
55500 -- (-793.729) [-792.762] (-795.576) (-792.364) * (-800.650) [-791.898] (-793.827) (-792.553) -- 0:00:51
56000 -- (-793.037) [-793.118] (-795.106) (-792.363) * (-796.354) (-792.843) (-793.341) [-792.590] -- 0:00:50
56500 -- [-793.480] (-794.701) (-795.612) (-792.951) * (-793.720) (-793.222) (-794.994) [-794.461] -- 0:00:50
57000 -- (-794.487) (-795.583) [-794.676] (-797.144) * (-795.390) (-794.327) [-795.665] (-793.385) -- 0:01:06
57500 -- (-796.072) [-793.145] (-794.250) (-794.050) * (-797.892) [-793.306] (-796.949) (-792.967) -- 0:01:05
58000 -- (-795.773) (-795.838) (-792.157) [-794.588] * [-798.055] (-792.755) (-796.386) (-792.785) -- 0:01:04
58500 -- (-797.687) [-792.709] (-791.621) (-794.166) * (-792.986) (-795.714) (-795.810) [-796.717] -- 0:01:04
59000 -- [-792.378] (-794.144) (-792.046) (-794.509) * (-795.373) (-793.994) (-796.502) [-793.611] -- 0:01:03
59500 -- (-791.342) (-791.777) (-792.023) [-795.702] * (-793.448) [-792.686] (-794.859) (-792.493) -- 0:01:03
60000 -- [-792.907] (-792.431) (-793.712) (-793.308) * (-795.240) (-791.758) (-795.249) [-792.756] -- 0:01:02
Average standard deviation of split frequencies: 0.026031
60500 -- [-794.230] (-794.540) (-793.747) (-797.509) * (-798.096) [-794.180] (-797.581) (-793.414) -- 0:01:02
61000 -- (-793.453) [-792.183] (-793.758) (-798.598) * [-794.180] (-795.396) (-793.495) (-794.292) -- 0:01:01
61500 -- (-793.711) [-795.165] (-793.202) (-792.947) * (-794.499) (-797.877) (-792.742) [-792.232] -- 0:01:01
62000 -- (-793.331) (-798.859) (-794.205) [-793.163] * [-793.580] (-796.271) (-793.821) (-797.115) -- 0:01:00
62500 -- [-792.683] (-792.510) (-793.489) (-792.262) * [-795.817] (-793.579) (-792.399) (-793.201) -- 0:01:00
63000 -- [-795.506] (-794.243) (-794.787) (-793.377) * (-796.358) (-795.644) [-795.157] (-796.749) -- 0:00:59
63500 -- (-797.088) [-792.948] (-793.556) (-791.506) * (-793.193) (-796.109) [-793.851] (-792.935) -- 0:00:58
64000 -- (-795.225) (-792.591) (-795.365) [-793.868] * (-797.903) [-796.896] (-792.210) (-793.462) -- 0:00:58
64500 -- (-794.388) (-792.050) [-792.729] (-792.878) * (-796.263) (-801.052) (-796.526) [-796.534] -- 0:00:58
65000 -- (-791.759) [-793.250] (-793.372) (-795.416) * (-794.271) [-792.398] (-798.324) (-794.976) -- 0:00:57
Average standard deviation of split frequencies: 0.022448
65500 -- [-791.649] (-795.381) (-794.374) (-792.375) * (-792.128) [-791.325] (-794.614) (-800.045) -- 0:00:57
66000 -- (-796.223) (-793.339) [-792.945] (-792.133) * (-793.377) (-792.420) (-794.812) [-793.057] -- 0:00:56
66500 -- [-791.673] (-793.917) (-794.956) (-791.552) * [-794.340] (-793.364) (-794.624) (-797.778) -- 0:00:56
67000 -- (-792.303) [-793.913] (-794.670) (-794.097) * (-798.054) [-794.020] (-794.595) (-797.172) -- 0:00:55
67500 -- (-796.218) (-795.499) [-793.152] (-793.446) * (-797.661) (-795.907) (-797.748) [-792.396] -- 0:00:55
68000 -- [-798.943] (-799.211) (-793.603) (-791.730) * (-791.642) (-794.357) (-797.869) [-793.156] -- 0:00:54
68500 -- (-793.364) (-792.602) [-793.369] (-791.934) * (-793.361) (-792.018) (-793.455) [-792.620] -- 0:00:54
69000 -- (-794.148) [-794.677] (-794.786) (-792.487) * [-793.091] (-792.937) (-793.392) (-795.969) -- 0:00:53
69500 -- (-794.475) [-794.289] (-792.557) (-793.277) * (-793.688) [-793.244] (-796.604) (-793.823) -- 0:00:53
70000 -- (-791.572) [-795.045] (-796.328) (-793.000) * (-793.997) [-794.205] (-792.489) (-792.393) -- 0:00:53
Average standard deviation of split frequencies: 0.021865
70500 -- (-792.856) (-796.663) (-793.923) [-793.260] * (-796.045) (-793.441) [-792.222] (-793.620) -- 0:00:52
71000 -- [-794.270] (-794.603) (-792.421) (-794.999) * (-801.072) (-793.330) [-794.309] (-795.613) -- 0:00:52
71500 -- [-792.000] (-796.050) (-791.428) (-793.261) * [-792.613] (-795.523) (-792.429) (-798.371) -- 0:00:51
72000 -- (-792.951) (-797.331) [-794.078] (-794.982) * (-793.938) [-797.013] (-793.880) (-797.613) -- 0:00:51
72500 -- [-793.100] (-794.011) (-799.172) (-793.484) * [-795.042] (-796.212) (-794.360) (-793.917) -- 0:00:51
73000 -- (-793.982) (-794.318) (-792.349) [-794.759] * [-792.852] (-795.849) (-793.730) (-793.998) -- 0:00:50
73500 -- [-792.327] (-793.896) (-792.992) (-798.401) * (-793.145) (-792.779) (-793.792) [-793.579] -- 0:01:03
74000 -- [-796.728] (-792.275) (-795.355) (-795.277) * [-792.145] (-794.585) (-795.124) (-794.023) -- 0:01:02
74500 -- (-792.959) (-792.726) [-792.147] (-792.368) * (-795.870) (-793.543) (-791.847) [-793.010] -- 0:01:02
75000 -- [-793.110] (-793.104) (-795.364) (-798.127) * (-793.813) (-794.180) [-794.375] (-798.457) -- 0:01:01
Average standard deviation of split frequencies: 0.017302
75500 -- (-794.815) (-793.778) (-795.240) [-794.757] * [-794.270] (-791.788) (-794.493) (-794.324) -- 0:01:01
76000 -- (-795.050) (-794.627) (-791.667) [-793.389] * [-792.650] (-793.808) (-796.078) (-792.197) -- 0:01:00
76500 -- [-793.685] (-793.071) (-792.970) (-793.579) * (-791.964) (-793.638) [-792.891] (-795.307) -- 0:01:00
77000 -- (-793.366) (-792.338) (-793.198) [-793.769] * (-792.863) (-792.696) [-792.542] (-795.174) -- 0:00:59
77500 -- [-792.921] (-792.975) (-799.780) (-793.392) * (-794.286) [-793.050] (-792.941) (-793.804) -- 0:00:59
78000 -- [-794.106] (-795.527) (-797.125) (-793.645) * (-793.230) (-795.053) [-793.142] (-794.839) -- 0:00:59
78500 -- [-793.440] (-794.276) (-792.269) (-793.227) * (-794.147) [-799.241] (-792.297) (-797.712) -- 0:00:58
79000 -- (-793.796) [-793.764] (-791.403) (-795.234) * (-794.717) [-796.329] (-791.670) (-796.223) -- 0:00:58
79500 -- (-798.425) (-793.249) [-791.817] (-793.358) * (-794.714) [-793.133] (-791.890) (-794.284) -- 0:00:57
80000 -- (-793.770) (-795.556) [-793.565] (-793.024) * (-792.547) (-794.433) (-792.444) [-795.919] -- 0:00:57
Average standard deviation of split frequencies: 0.016500
80500 -- (-794.325) [-792.080] (-794.715) (-792.803) * (-794.452) (-793.875) (-794.828) [-791.753] -- 0:00:57
81000 -- (-795.675) (-793.536) (-793.286) [-791.254] * (-793.428) (-792.269) (-792.524) [-793.836] -- 0:00:56
81500 -- (-796.534) (-795.229) [-792.673] (-793.219) * (-793.101) [-794.648] (-792.224) (-796.658) -- 0:00:56
82000 -- (-793.520) (-793.959) [-792.706] (-798.385) * (-792.803) (-792.610) (-791.921) [-795.214] -- 0:00:55
82500 -- (-793.305) [-793.612] (-794.490) (-791.514) * (-793.740) (-792.470) [-791.433] (-793.511) -- 0:00:55
83000 -- (-792.702) (-792.561) [-793.721] (-791.707) * [-793.806] (-792.232) (-792.113) (-791.451) -- 0:00:55
83500 -- (-792.349) (-793.524) [-792.520] (-792.755) * (-794.255) (-792.520) [-792.568] (-793.103) -- 0:00:54
84000 -- (-792.797) [-794.457] (-793.739) (-794.952) * (-793.109) (-791.894) (-794.692) [-791.936] -- 0:00:54
84500 -- (-794.926) (-793.653) [-792.368] (-794.726) * (-793.497) [-791.735] (-793.079) (-793.181) -- 0:00:54
85000 -- (-795.670) [-792.475] (-794.508) (-792.381) * (-794.426) [-795.619] (-794.394) (-792.878) -- 0:00:53
Average standard deviation of split frequencies: 0.017358
85500 -- [-792.454] (-792.535) (-792.727) (-793.907) * (-795.400) (-793.571) [-793.872] (-792.803) -- 0:00:53
86000 -- (-792.064) [-791.641] (-799.523) (-793.018) * (-792.515) [-793.914] (-792.249) (-793.429) -- 0:00:53
86500 -- [-792.049] (-791.662) (-795.207) (-793.783) * (-794.346) (-794.726) [-792.853] (-792.677) -- 0:00:52
87000 -- (-792.070) [-792.244] (-794.294) (-791.932) * [-791.786] (-792.763) (-791.882) (-794.572) -- 0:00:52
87500 -- [-793.898] (-796.847) (-794.019) (-791.805) * [-792.220] (-793.174) (-791.564) (-791.435) -- 0:00:52
88000 -- [-793.561] (-793.684) (-791.492) (-792.191) * [-791.592] (-791.496) (-795.341) (-791.901) -- 0:00:51
88500 -- [-794.075] (-793.598) (-795.840) (-792.757) * [-791.605] (-792.111) (-791.836) (-792.295) -- 0:00:51
89000 -- (-792.668) (-793.712) (-793.252) [-794.579] * (-791.949) (-792.422) (-794.685) [-792.295] -- 0:00:51
89500 -- (-792.786) [-793.322] (-792.325) (-795.534) * (-794.965) (-793.015) (-792.285) [-791.755] -- 0:00:50
90000 -- (-796.734) [-791.996] (-794.682) (-793.087) * (-791.609) (-793.677) [-792.121] (-791.881) -- 0:00:50
Average standard deviation of split frequencies: 0.015020
90500 -- (-793.170) (-791.921) (-793.769) [-792.393] * (-793.090) [-792.656] (-792.115) (-792.985) -- 0:01:00
91000 -- (-794.453) [-792.288] (-795.508) (-792.726) * (-794.222) (-793.936) [-793.901] (-797.845) -- 0:00:59
91500 -- (-793.133) (-793.708) (-795.215) [-792.838] * (-795.165) (-793.738) [-792.346] (-794.077) -- 0:00:59
92000 -- (-794.307) (-792.782) [-793.603] (-791.694) * (-795.039) (-793.909) [-792.985] (-792.286) -- 0:00:59
92500 -- [-792.535] (-795.939) (-793.357) (-795.782) * (-793.120) (-793.136) [-792.329] (-791.959) -- 0:00:58
93000 -- (-793.155) (-796.418) [-796.933] (-795.480) * (-791.945) (-794.947) (-792.239) [-793.245] -- 0:00:58
93500 -- (-792.297) [-791.780] (-792.829) (-793.668) * (-792.981) (-799.161) (-791.650) [-792.382] -- 0:00:58
94000 -- (-792.764) (-793.023) (-794.704) [-791.552] * (-794.898) (-793.738) (-794.602) [-792.652] -- 0:00:57
94500 -- [-792.237] (-792.950) (-795.374) (-792.407) * (-793.872) (-795.648) [-799.439] (-793.867) -- 0:00:57
95000 -- (-792.577) [-791.628] (-797.375) (-792.861) * [-792.113] (-794.977) (-791.854) (-791.989) -- 0:00:57
Average standard deviation of split frequencies: 0.017042
95500 -- (-793.799) [-791.950] (-794.841) (-793.287) * (-793.310) [-796.572] (-793.465) (-793.274) -- 0:00:56
96000 -- (-796.513) [-791.811] (-793.220) (-800.179) * (-794.164) (-795.451) [-793.662] (-791.830) -- 0:00:56
96500 -- (-796.624) [-795.226] (-796.736) (-794.832) * (-796.955) (-794.078) [-792.647] (-792.445) -- 0:00:56
97000 -- (-792.516) [-794.175] (-796.499) (-793.232) * (-792.302) [-793.081] (-793.310) (-792.262) -- 0:00:55
97500 -- (-793.004) (-797.576) [-796.271] (-793.975) * (-792.098) (-791.779) (-795.022) [-791.969] -- 0:00:55
98000 -- (-793.358) (-801.051) [-792.822] (-793.238) * (-793.377) (-792.149) [-793.107] (-797.510) -- 0:00:55
98500 -- (-793.608) [-792.441] (-795.165) (-795.292) * (-794.228) [-792.180] (-794.640) (-795.931) -- 0:00:54
99000 -- [-794.375] (-791.572) (-795.002) (-792.698) * (-795.077) [-795.600] (-792.036) (-792.137) -- 0:00:54
99500 -- [-793.214] (-791.979) (-794.177) (-793.505) * (-795.169) (-791.803) [-792.309] (-795.395) -- 0:00:54
100000 -- [-791.779] (-791.772) (-792.300) (-792.485) * (-794.244) (-792.558) [-792.633] (-794.896) -- 0:00:54
Average standard deviation of split frequencies: 0.017354
100500 -- (-792.599) [-794.849] (-795.292) (-795.368) * (-797.993) (-792.318) [-791.922] (-792.806) -- 0:00:53
101000 -- (-794.745) [-797.596] (-795.164) (-795.583) * (-795.164) (-793.572) [-795.851] (-793.088) -- 0:00:53
101500 -- (-791.499) (-795.516) [-792.524] (-792.367) * (-792.813) (-792.837) [-794.033] (-794.590) -- 0:00:53
102000 -- (-793.145) (-795.512) [-792.897] (-793.917) * (-792.264) (-792.837) [-791.990] (-795.396) -- 0:00:52
102500 -- (-792.327) (-794.520) [-795.320] (-792.976) * (-794.789) (-793.504) [-793.134] (-791.912) -- 0:00:52
103000 -- (-791.698) (-792.055) [-791.336] (-792.788) * [-793.323] (-793.252) (-793.214) (-792.301) -- 0:00:52
103500 -- (-793.011) [-792.780] (-796.919) (-794.176) * (-792.590) (-791.661) [-793.688] (-793.671) -- 0:00:51
104000 -- (-794.094) [-793.520] (-795.260) (-792.834) * (-792.897) (-794.761) (-795.472) [-793.401] -- 0:00:51
104500 -- (-791.445) (-797.723) [-793.988] (-793.696) * [-794.529] (-793.870) (-797.854) (-792.180) -- 0:00:51
105000 -- [-791.826] (-797.516) (-792.937) (-794.929) * (-793.389) (-793.166) [-793.190] (-795.026) -- 0:00:51
Average standard deviation of split frequencies: 0.016306
105500 -- (-792.798) (-793.176) [-792.657] (-792.307) * (-793.628) [-793.986] (-793.665) (-792.867) -- 0:00:50
106000 -- (-793.101) [-793.062] (-792.480) (-793.539) * (-792.548) (-794.524) (-797.917) [-794.071] -- 0:00:50
106500 -- [-793.450] (-794.180) (-794.141) (-792.853) * [-794.064] (-792.687) (-798.067) (-793.213) -- 0:00:50
107000 -- (-792.967) (-791.769) (-795.863) [-791.916] * (-792.124) [-792.964] (-794.760) (-793.915) -- 0:00:58
107500 -- [-793.241] (-792.530) (-791.569) (-792.118) * (-797.185) (-792.326) (-793.065) [-793.463] -- 0:00:58
108000 -- [-793.240] (-793.721) (-792.419) (-791.623) * (-797.364) (-792.133) (-798.194) [-794.481] -- 0:00:57
108500 -- (-795.524) [-792.911] (-793.361) (-792.416) * (-792.601) (-793.877) [-795.825] (-794.954) -- 0:00:57
109000 -- (-794.073) (-798.482) (-792.952) [-792.408] * (-795.409) (-792.541) [-795.842] (-794.636) -- 0:00:57
109500 -- (-791.894) (-796.935) (-792.938) [-792.167] * (-795.537) (-792.289) [-792.297] (-796.187) -- 0:00:56
110000 -- (-793.238) [-791.674] (-792.878) (-793.927) * (-799.053) (-792.999) (-794.092) [-793.432] -- 0:00:56
Average standard deviation of split frequencies: 0.016287
110500 -- (-791.624) [-796.194] (-796.788) (-793.520) * (-794.101) (-792.851) [-792.607] (-795.308) -- 0:00:56
111000 -- (-793.142) (-793.960) [-794.403] (-792.665) * (-794.659) (-792.933) [-793.241] (-794.446) -- 0:00:56
111500 -- (-796.219) [-792.960] (-794.504) (-796.345) * (-794.548) [-792.533] (-793.040) (-794.897) -- 0:00:55
112000 -- (-793.044) (-796.246) (-794.572) [-800.960] * [-794.006] (-793.672) (-797.004) (-792.636) -- 0:00:55
112500 -- (-793.969) [-794.126] (-793.632) (-795.859) * (-797.861) (-796.904) (-792.427) [-794.606] -- 0:00:55
113000 -- (-792.495) (-792.741) [-794.946] (-793.056) * (-793.644) (-795.515) (-793.517) [-794.784] -- 0:00:54
113500 -- (-797.820) [-792.122] (-795.224) (-791.494) * (-791.991) (-792.892) (-793.893) [-797.440] -- 0:00:54
114000 -- (-794.138) (-792.936) (-795.244) [-791.455] * [-791.771] (-795.747) (-793.631) (-799.298) -- 0:00:54
114500 -- (-793.659) (-798.079) [-793.640] (-793.077) * [-792.917] (-794.055) (-794.132) (-799.485) -- 0:00:54
115000 -- (-792.875) (-794.861) [-792.555] (-794.174) * [-793.545] (-792.441) (-794.342) (-798.024) -- 0:00:53
Average standard deviation of split frequencies: 0.015352
115500 -- (-793.028) (-793.426) (-793.749) [-795.032] * [-795.662] (-793.711) (-793.857) (-793.241) -- 0:00:53
116000 -- (-792.238) [-794.071] (-792.809) (-795.825) * (-793.691) (-792.991) (-793.018) [-794.657] -- 0:00:53
116500 -- [-792.951] (-792.488) (-794.605) (-796.219) * [-793.268] (-793.279) (-793.410) (-797.203) -- 0:00:53
117000 -- (-793.150) (-793.959) (-794.973) [-791.607] * [-794.137] (-792.244) (-792.409) (-793.877) -- 0:00:52
117500 -- (-792.032) (-794.596) (-793.316) [-794.264] * [-796.945] (-793.206) (-791.938) (-792.747) -- 0:00:52
118000 -- (-793.397) (-797.235) [-793.647] (-794.681) * (-793.119) (-793.824) (-792.893) [-793.296] -- 0:00:52
118500 -- (-796.335) (-792.914) [-795.541] (-793.304) * (-792.928) (-794.472) [-794.324] (-793.958) -- 0:00:52
119000 -- (-791.886) (-797.275) (-793.653) [-794.229] * [-792.775] (-799.349) (-794.003) (-796.958) -- 0:00:51
119500 -- (-793.716) (-793.759) [-793.845] (-796.110) * (-795.468) (-795.457) (-798.402) [-795.130] -- 0:00:51
120000 -- [-795.140] (-793.467) (-794.398) (-793.713) * (-797.216) (-800.967) [-798.992] (-793.586) -- 0:00:51
Average standard deviation of split frequencies: 0.011260
120500 -- (-795.079) (-792.098) [-793.230] (-794.223) * (-793.730) [-792.601] (-798.342) (-793.896) -- 0:00:51
121000 -- (-793.098) (-793.850) [-793.158] (-795.316) * [-796.126] (-793.013) (-794.139) (-792.901) -- 0:00:50
121500 -- (-793.011) (-791.792) [-794.195] (-793.076) * (-794.560) [-792.315] (-792.407) (-793.378) -- 0:00:50
122000 -- (-791.726) [-792.801] (-792.363) (-794.308) * [-794.829] (-793.742) (-792.990) (-797.346) -- 0:00:50
122500 -- [-791.681] (-794.049) (-794.068) (-797.946) * (-794.642) (-792.489) (-794.416) [-798.572] -- 0:00:50
123000 -- (-794.811) (-794.359) (-792.694) [-797.995] * (-792.778) (-793.428) [-795.439] (-794.855) -- 0:00:49
123500 -- [-792.461] (-792.445) (-796.130) (-798.850) * [-792.848] (-794.631) (-795.884) (-793.346) -- 0:00:56
124000 -- (-794.922) (-793.231) [-794.542] (-798.118) * (-793.837) (-797.695) [-795.289] (-796.054) -- 0:00:56
124500 -- (-791.985) (-794.037) (-791.472) [-792.310] * [-795.445] (-793.132) (-795.138) (-795.515) -- 0:00:56
125000 -- (-795.943) (-794.399) [-794.473] (-794.859) * [-793.542] (-795.281) (-793.560) (-794.612) -- 0:00:56
Average standard deviation of split frequencies: 0.014178
125500 -- [-796.195] (-793.419) (-792.311) (-792.597) * (-793.759) (-796.450) [-795.680] (-793.818) -- 0:00:55
126000 -- (-794.738) (-793.536) [-793.826] (-793.473) * [-795.795] (-793.587) (-793.541) (-797.437) -- 0:00:55
126500 -- (-794.679) (-793.517) (-792.046) [-796.621] * (-795.400) (-794.775) (-793.257) [-794.220] -- 0:00:55
127000 -- (-792.602) (-795.325) [-794.397] (-793.785) * (-795.518) (-794.547) [-792.593] (-791.773) -- 0:00:54
127500 -- [-796.235] (-793.228) (-793.603) (-794.417) * (-792.974) [-791.960] (-796.436) (-792.018) -- 0:00:54
128000 -- (-796.197) (-797.364) [-792.253] (-796.485) * [-792.689] (-795.110) (-800.030) (-792.092) -- 0:00:54
128500 -- [-792.898] (-796.474) (-793.063) (-798.006) * [-792.679] (-793.982) (-800.072) (-792.885) -- 0:00:54
129000 -- (-797.321) (-795.983) (-794.700) [-792.783] * (-794.906) (-792.984) (-799.026) [-794.743] -- 0:00:54
129500 -- (-795.208) (-792.129) (-795.580) [-793.502] * [-794.127] (-797.539) (-792.691) (-794.834) -- 0:00:53
130000 -- (-792.426) (-792.910) (-796.050) [-793.234] * (-794.561) (-793.271) (-794.270) [-797.137] -- 0:00:53
Average standard deviation of split frequencies: 0.014621
130500 -- [-794.318] (-792.526) (-793.049) (-795.561) * [-793.579] (-794.146) (-796.091) (-792.364) -- 0:00:53
131000 -- (-794.361) [-792.223] (-792.100) (-793.896) * (-793.209) [-792.574] (-793.513) (-791.943) -- 0:00:53
131500 -- (-793.525) [-793.876] (-794.976) (-791.782) * (-797.332) [-792.678] (-793.969) (-793.057) -- 0:00:52
132000 -- (-794.865) [-792.849] (-793.730) (-793.234) * (-796.129) [-794.072] (-794.830) (-795.900) -- 0:00:52
132500 -- [-793.076] (-791.611) (-793.730) (-792.188) * [-792.530] (-791.334) (-794.395) (-792.785) -- 0:00:52
133000 -- (-796.658) (-798.995) (-793.085) [-795.370] * (-794.398) (-793.938) [-798.330] (-797.549) -- 0:00:52
133500 -- (-794.929) (-794.634) (-791.717) [-792.199] * (-794.252) [-792.045] (-791.620) (-793.263) -- 0:00:51
134000 -- [-793.116] (-795.049) (-795.739) (-791.370) * (-794.797) (-798.921) (-793.730) [-795.637] -- 0:00:51
134500 -- (-793.971) (-795.034) (-791.950) [-792.759] * [-793.275] (-795.743) (-796.827) (-796.685) -- 0:00:51
135000 -- (-792.156) [-795.046] (-794.493) (-793.932) * [-794.557] (-796.114) (-794.980) (-794.704) -- 0:00:51
Average standard deviation of split frequencies: 0.016108
135500 -- (-797.205) (-796.450) [-795.255] (-795.770) * (-795.826) (-792.205) [-792.715] (-797.077) -- 0:00:51
136000 -- (-793.895) [-796.359] (-794.663) (-793.434) * (-796.348) (-793.304) (-792.473) [-795.201] -- 0:00:50
136500 -- [-792.986] (-795.686) (-796.255) (-792.222) * (-798.226) [-795.517] (-792.968) (-795.193) -- 0:00:50
137000 -- (-792.396) (-794.350) [-793.771] (-792.916) * (-796.763) (-794.693) [-793.093] (-792.683) -- 0:00:50
137500 -- (-795.250) (-792.786) [-795.122] (-795.148) * [-794.034] (-794.683) (-792.953) (-796.848) -- 0:00:50
138000 -- (-794.074) [-792.773] (-793.903) (-796.096) * [-794.665] (-792.999) (-792.953) (-792.828) -- 0:00:49
138500 -- (-798.148) (-792.744) (-792.433) [-793.177] * [-792.744] (-793.176) (-791.832) (-793.265) -- 0:00:49
139000 -- [-792.697] (-791.833) (-793.694) (-793.173) * [-794.109] (-797.346) (-792.513) (-793.519) -- 0:00:49
139500 -- (-792.947) [-794.198] (-794.483) (-792.372) * [-793.021] (-793.316) (-791.404) (-793.216) -- 0:00:49
140000 -- (-792.382) (-793.322) (-792.420) [-794.143] * (-794.788) (-796.550) (-794.284) [-792.530] -- 0:00:49
Average standard deviation of split frequencies: 0.015290
140500 -- (-794.214) (-797.558) (-792.950) [-794.960] * [-792.769] (-795.124) (-791.506) (-793.945) -- 0:00:55
141000 -- (-794.555) (-793.953) (-795.216) [-795.926] * (-794.937) (-794.149) [-794.585] (-793.684) -- 0:00:54
141500 -- (-792.891) (-793.497) (-791.827) [-794.812] * (-794.605) [-796.618] (-795.396) (-795.134) -- 0:00:54
142000 -- [-791.736] (-792.896) (-792.997) (-792.183) * [-792.740] (-794.568) (-792.667) (-797.178) -- 0:00:54
142500 -- (-793.985) (-793.884) [-793.555] (-796.957) * (-791.794) [-792.547] (-796.768) (-793.117) -- 0:00:54
143000 -- (-793.465) (-791.815) [-794.684] (-795.470) * (-792.902) (-791.991) [-793.090] (-792.332) -- 0:00:53
143500 -- (-794.299) (-792.853) [-792.873] (-796.952) * (-794.801) (-792.582) (-795.505) [-798.155] -- 0:00:53
144000 -- (-795.174) [-793.855] (-794.247) (-797.603) * (-792.964) [-794.022] (-791.839) (-792.059) -- 0:00:53
144500 -- (-796.208) (-794.711) (-792.974) [-792.520] * (-792.789) [-792.265] (-791.437) (-792.060) -- 0:00:53
145000 -- (-794.832) (-794.346) (-798.039) [-793.310] * (-792.604) (-793.963) (-794.950) [-793.539] -- 0:00:53
Average standard deviation of split frequencies: 0.014055
145500 -- (-798.644) (-792.323) [-793.101] (-792.484) * (-791.882) (-793.617) (-792.658) [-792.939] -- 0:00:52
146000 -- (-798.960) [-793.307] (-791.889) (-794.744) * [-791.442] (-792.331) (-793.584) (-792.732) -- 0:00:52
146500 -- [-795.437] (-795.955) (-795.771) (-795.601) * (-795.002) [-792.059] (-793.938) (-795.344) -- 0:00:52
147000 -- (-794.175) [-794.881] (-796.635) (-791.866) * (-795.540) (-793.398) [-793.268] (-794.926) -- 0:00:52
147500 -- (-794.025) [-798.332] (-795.163) (-792.638) * (-792.681) (-792.366) (-793.013) [-794.035] -- 0:00:52
148000 -- [-791.432] (-794.204) (-798.028) (-793.551) * (-795.830) (-792.166) (-792.485) [-794.027] -- 0:00:51
148500 -- (-793.690) (-795.172) (-792.268) [-795.379] * (-793.381) [-793.246] (-795.266) (-794.168) -- 0:00:51
149000 -- [-793.729] (-796.027) (-791.952) (-794.609) * [-793.936] (-791.283) (-793.961) (-792.571) -- 0:00:51
149500 -- (-796.816) (-797.824) [-792.006] (-793.530) * (-794.634) [-794.184] (-793.143) (-794.702) -- 0:00:51
150000 -- [-794.094] (-793.563) (-792.006) (-796.233) * [-796.197] (-795.581) (-793.292) (-792.524) -- 0:00:51
Average standard deviation of split frequencies: 0.014172
150500 -- (-792.752) [-792.261] (-793.999) (-796.816) * (-791.951) (-796.602) (-795.927) [-791.624] -- 0:00:50
151000 -- (-792.767) (-792.335) [-793.962] (-797.193) * [-792.448] (-794.727) (-796.470) (-794.223) -- 0:00:50
151500 -- (-793.150) [-795.160] (-792.427) (-797.501) * (-793.871) (-797.089) (-798.638) [-792.508] -- 0:00:50
152000 -- (-794.314) [-793.379] (-794.335) (-793.895) * [-793.553] (-792.943) (-794.687) (-791.864) -- 0:00:50
152500 -- (-792.077) [-792.351] (-793.083) (-794.041) * [-791.734] (-792.968) (-791.741) (-796.186) -- 0:00:50
153000 -- [-792.201] (-792.169) (-793.712) (-795.967) * (-795.732) (-792.257) (-793.624) [-791.903] -- 0:00:49
153500 -- [-792.407] (-793.807) (-792.568) (-796.361) * (-792.460) (-795.537) [-794.468] (-792.206) -- 0:00:49
154000 -- (-792.680) (-793.243) [-791.864] (-793.750) * (-793.919) [-793.784] (-792.982) (-796.951) -- 0:00:49
154500 -- (-793.562) (-793.377) [-791.742] (-791.683) * [-793.749] (-796.034) (-791.506) (-796.950) -- 0:00:49
155000 -- (-794.088) [-792.413] (-792.008) (-793.686) * (-793.702) [-793.160] (-796.786) (-796.610) -- 0:00:49
Average standard deviation of split frequencies: 0.013687
155500 -- (-795.016) (-792.247) [-792.448] (-793.693) * (-792.667) (-794.132) [-794.992] (-795.303) -- 0:00:48
156000 -- (-792.223) (-797.799) [-792.301] (-792.637) * (-793.144) (-793.998) [-794.445] (-793.452) -- 0:00:48
156500 -- (-795.236) (-795.915) [-792.913] (-791.618) * (-795.079) (-795.085) [-792.964] (-797.455) -- 0:00:48
157000 -- (-794.741) [-793.610] (-792.106) (-791.665) * (-792.051) (-796.427) [-793.496] (-793.808) -- 0:00:48
157500 -- (-791.955) (-795.680) [-791.740] (-793.409) * (-793.509) (-796.539) [-791.532] (-793.143) -- 0:00:53
158000 -- (-791.828) (-797.068) [-791.848] (-792.251) * (-794.272) [-793.749] (-793.025) (-792.404) -- 0:00:53
158500 -- (-795.078) (-792.899) [-793.439] (-792.313) * (-793.756) [-794.641] (-792.358) (-793.040) -- 0:00:53
159000 -- (-798.754) (-792.347) [-793.678] (-792.994) * (-794.551) [-794.040] (-792.098) (-791.802) -- 0:00:52
159500 -- (-792.675) (-794.535) (-792.508) [-793.258] * (-792.784) (-793.361) [-793.832] (-793.966) -- 0:00:52
160000 -- (-797.008) [-791.980] (-793.658) (-797.581) * [-792.178] (-793.610) (-792.473) (-793.239) -- 0:00:52
Average standard deviation of split frequencies: 0.016741
160500 -- [-792.360] (-792.999) (-798.067) (-798.679) * (-791.677) (-796.152) (-792.254) [-795.121] -- 0:00:52
161000 -- (-791.719) (-793.341) (-802.258) [-795.161] * [-792.426] (-795.057) (-792.016) (-793.781) -- 0:00:52
161500 -- [-793.276] (-793.815) (-795.152) (-795.727) * (-791.979) [-792.415] (-795.521) (-793.527) -- 0:00:51
162000 -- (-793.543) (-793.851) [-794.105] (-793.481) * (-792.382) (-791.987) [-801.204] (-800.137) -- 0:00:51
162500 -- (-792.557) (-798.514) [-793.747] (-791.711) * (-791.444) [-792.174] (-798.744) (-796.710) -- 0:00:51
163000 -- [-792.919] (-794.515) (-793.668) (-794.332) * (-792.862) (-795.924) (-800.285) [-796.936] -- 0:00:51
163500 -- (-792.394) (-791.794) [-792.074] (-792.395) * (-796.402) (-796.508) [-795.432] (-793.260) -- 0:00:51
164000 -- [-792.908] (-792.957) (-792.596) (-793.199) * [-792.384] (-795.411) (-795.161) (-798.153) -- 0:00:50
164500 -- [-795.696] (-797.800) (-797.876) (-795.554) * [-795.263] (-797.265) (-793.790) (-792.656) -- 0:00:50
165000 -- [-799.198] (-795.479) (-791.777) (-794.712) * (-795.183) [-794.575] (-792.770) (-792.890) -- 0:00:50
Average standard deviation of split frequencies: 0.014647
165500 -- (-796.835) (-795.837) (-795.442) [-793.929] * (-794.930) (-794.643) (-793.498) [-792.330] -- 0:00:50
166000 -- (-794.499) (-792.416) [-794.962] (-796.771) * [-792.187] (-794.017) (-793.386) (-792.166) -- 0:00:50
166500 -- [-793.122] (-792.425) (-794.089) (-795.980) * (-794.829) (-794.766) (-799.411) [-792.195] -- 0:00:50
167000 -- [-793.743] (-792.597) (-793.725) (-795.512) * (-795.033) (-793.959) (-793.359) [-792.645] -- 0:00:49
167500 -- (-793.380) [-791.830] (-797.565) (-795.095) * (-795.614) (-793.156) [-794.769] (-792.026) -- 0:00:49
168000 -- (-792.345) (-791.838) (-793.575) [-791.716] * (-794.216) (-791.843) [-792.935] (-792.545) -- 0:00:49
168500 -- (-793.887) (-792.593) [-793.711] (-796.461) * (-799.909) [-793.831] (-794.884) (-797.363) -- 0:00:49
169000 -- (-793.413) (-796.205) (-794.297) [-793.326] * (-793.285) (-794.033) [-794.315] (-791.674) -- 0:00:49
169500 -- (-792.546) (-796.139) [-794.716] (-795.993) * [-792.453] (-792.981) (-792.675) (-792.599) -- 0:00:48
170000 -- (-792.324) (-795.083) [-795.268] (-793.945) * (-792.491) [-793.533] (-792.475) (-792.736) -- 0:00:48
Average standard deviation of split frequencies: 0.016573
170500 -- (-792.689) (-797.154) [-794.817] (-793.084) * (-792.565) (-791.465) [-792.028] (-791.746) -- 0:00:48
171000 -- [-792.315] (-795.075) (-796.508) (-793.801) * (-792.229) (-793.714) [-792.088] (-791.751) -- 0:00:48
171500 -- (-793.934) (-792.976) (-792.850) [-792.006] * (-792.138) (-792.451) [-791.975] (-793.795) -- 0:00:48
172000 -- [-794.392] (-792.167) (-792.713) (-791.609) * (-792.844) (-794.864) [-792.229] (-794.957) -- 0:00:48
172500 -- [-795.563] (-793.060) (-793.764) (-792.002) * [-798.584] (-794.578) (-791.422) (-798.804) -- 0:00:47
173000 -- (-792.935) [-793.083] (-793.953) (-795.019) * (-795.837) (-794.553) [-792.764] (-797.350) -- 0:00:47
173500 -- [-793.829] (-793.648) (-794.024) (-796.776) * (-796.207) (-792.662) [-797.480] (-795.308) -- 0:00:47
174000 -- (-792.277) (-797.811) (-794.585) [-793.861] * (-798.073) [-793.332] (-796.940) (-794.641) -- 0:00:52
174500 -- [-793.167] (-793.822) (-793.715) (-794.051) * (-795.640) (-792.844) (-795.613) [-792.159] -- 0:00:52
175000 -- (-793.673) (-792.510) (-792.814) [-792.785] * (-793.133) [-793.902] (-800.107) (-796.098) -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- [-793.611] (-792.622) (-793.405) (-795.343) * (-794.257) (-793.142) (-793.251) [-796.621] -- 0:00:51
176000 -- (-791.860) [-792.350] (-794.921) (-792.978) * (-793.880) (-793.232) [-793.119] (-798.058) -- 0:00:51
176500 -- (-792.104) [-793.028] (-793.098) (-794.221) * (-799.837) (-793.689) (-792.834) [-793.510] -- 0:00:51
177000 -- [-791.984] (-792.861) (-793.315) (-797.754) * (-796.683) (-792.597) (-792.033) [-794.704] -- 0:00:51
177500 -- (-800.191) [-793.205] (-792.494) (-793.805) * (-793.888) (-795.216) (-793.345) [-793.875] -- 0:00:50
178000 -- (-799.710) (-794.352) [-793.439] (-795.131) * (-792.514) (-793.968) (-793.656) [-792.888] -- 0:00:50
178500 -- [-797.788] (-791.446) (-795.968) (-793.937) * [-793.409] (-793.595) (-793.737) (-799.776) -- 0:00:50
179000 -- (-796.387) (-794.161) (-792.548) [-797.130] * (-791.704) [-792.943] (-793.296) (-797.927) -- 0:00:50
179500 -- (-794.764) [-795.044] (-793.543) (-798.116) * (-796.135) [-793.147] (-792.972) (-794.612) -- 0:00:50
180000 -- (-795.817) (-795.804) (-792.001) [-796.418] * (-795.431) [-792.887] (-796.213) (-792.973) -- 0:00:50
Average standard deviation of split frequencies: 0.014888
180500 -- (-794.584) (-792.902) [-791.986] (-798.259) * (-797.614) (-793.837) [-797.470] (-793.163) -- 0:00:49
181000 -- (-796.129) [-795.180] (-793.506) (-792.966) * (-793.462) [-792.903] (-795.164) (-792.449) -- 0:00:49
181500 -- (-792.953) (-792.998) [-792.054] (-792.514) * (-792.259) (-796.499) [-796.013] (-794.066) -- 0:00:49
182000 -- (-795.023) (-791.673) [-792.150] (-793.545) * [-792.088] (-793.286) (-791.855) (-794.118) -- 0:00:49
182500 -- (-793.161) (-792.085) (-795.343) [-792.273] * (-794.329) (-792.021) [-793.993] (-793.614) -- 0:00:49
183000 -- (-792.556) (-793.008) [-792.697] (-793.753) * [-793.627] (-792.709) (-794.970) (-792.302) -- 0:00:49
183500 -- [-796.504] (-794.935) (-791.941) (-796.330) * (-793.625) (-794.751) [-792.507] (-794.856) -- 0:00:48
184000 -- (-792.857) (-792.811) (-798.160) [-793.822] * (-794.410) (-797.505) [-794.375] (-794.284) -- 0:00:48
184500 -- [-793.872] (-792.729) (-793.296) (-795.522) * (-793.272) (-795.406) (-794.104) [-794.380] -- 0:00:48
185000 -- (-791.949) (-793.345) [-793.950] (-793.440) * (-796.357) [-792.210] (-796.885) (-793.562) -- 0:00:48
Average standard deviation of split frequencies: 0.013473
185500 -- [-792.533] (-794.363) (-792.914) (-794.182) * [-792.674] (-794.728) (-793.681) (-792.614) -- 0:00:48
186000 -- (-792.395) (-793.767) (-795.678) [-794.111] * (-794.239) (-794.046) (-794.270) [-792.105] -- 0:00:48
186500 -- (-793.924) [-792.284] (-795.217) (-799.245) * (-794.084) (-794.523) [-793.605] (-792.262) -- 0:00:47
187000 -- [-792.315] (-795.440) (-792.974) (-795.974) * (-794.810) [-792.114] (-792.789) (-795.457) -- 0:00:47
187500 -- (-794.178) [-793.438] (-793.171) (-796.879) * (-794.012) [-791.753] (-792.942) (-794.708) -- 0:00:47
188000 -- (-792.343) (-796.051) [-793.594] (-793.760) * (-796.819) (-797.440) (-793.501) [-793.695] -- 0:00:47
188500 -- (-792.704) (-793.327) [-791.487] (-797.562) * (-795.462) [-793.161] (-793.176) (-793.976) -- 0:00:47
189000 -- [-792.015] (-791.529) (-792.040) (-795.831) * (-794.583) (-795.607) (-792.651) [-793.980] -- 0:00:47
189500 -- [-792.118] (-797.697) (-791.651) (-792.625) * (-798.053) [-795.118] (-794.502) (-795.855) -- 0:00:47
190000 -- (-792.770) [-796.927] (-792.366) (-794.888) * (-796.471) (-794.803) (-794.707) [-794.469] -- 0:00:46
Average standard deviation of split frequencies: 0.014704
190500 -- (-794.076) (-794.938) (-791.634) [-793.473] * [-797.898] (-798.629) (-793.778) (-794.496) -- 0:00:50
191000 -- (-793.239) [-793.444] (-794.579) (-793.082) * (-792.154) (-796.415) [-793.067] (-792.300) -- 0:00:50
191500 -- (-798.207) (-794.980) [-793.702] (-792.924) * (-793.363) (-794.573) (-792.694) [-796.581] -- 0:00:50
192000 -- [-792.669] (-796.938) (-792.460) (-793.719) * (-792.205) [-792.371] (-792.783) (-792.821) -- 0:00:50
192500 -- [-792.822] (-794.020) (-792.460) (-792.469) * [-796.513] (-792.633) (-792.637) (-794.916) -- 0:00:50
193000 -- [-793.289] (-792.498) (-794.630) (-791.975) * (-797.700) [-793.144] (-793.328) (-793.522) -- 0:00:50
193500 -- (-793.063) (-792.384) (-793.679) [-792.167] * (-794.650) (-792.991) (-794.861) [-793.210] -- 0:00:50
194000 -- [-792.427] (-792.289) (-794.340) (-794.253) * (-797.111) [-795.089] (-796.129) (-794.017) -- 0:00:49
194500 -- (-792.306) [-791.627] (-794.172) (-795.613) * (-792.070) (-795.008) [-795.497] (-795.243) -- 0:00:49
195000 -- (-794.470) (-792.816) (-791.825) [-794.879] * (-793.742) (-794.866) [-793.593] (-795.553) -- 0:00:49
Average standard deviation of split frequencies: 0.016034
195500 -- (-795.214) [-791.345] (-793.246) (-795.725) * (-795.664) [-792.629] (-792.673) (-793.626) -- 0:00:49
196000 -- (-792.855) (-792.205) (-795.978) [-792.064] * [-793.428] (-792.170) (-793.508) (-795.386) -- 0:00:49
196500 -- [-794.285] (-791.378) (-792.215) (-791.936) * (-792.396) (-791.280) [-791.773] (-794.543) -- 0:00:49
197000 -- (-794.610) (-792.433) [-792.305] (-792.810) * (-793.153) (-794.027) [-793.955] (-792.928) -- 0:00:48
197500 -- (-791.875) [-792.102] (-792.229) (-795.911) * [-797.781] (-792.678) (-793.336) (-794.449) -- 0:00:48
198000 -- (-795.829) [-792.477] (-792.250) (-794.318) * (-793.161) [-792.799] (-796.645) (-795.487) -- 0:00:48
198500 -- [-795.235] (-792.286) (-796.012) (-794.873) * [-794.610] (-792.669) (-793.535) (-795.648) -- 0:00:48
199000 -- (-794.073) [-792.482] (-792.557) (-794.910) * (-795.087) [-795.432] (-794.423) (-795.926) -- 0:00:48
199500 -- (-798.121) (-793.063) [-791.775] (-795.102) * (-795.461) (-796.769) (-798.429) [-796.431] -- 0:00:48
200000 -- [-793.604] (-795.523) (-794.449) (-795.047) * [-791.686] (-794.131) (-793.822) (-793.084) -- 0:00:48
Average standard deviation of split frequencies: 0.018103
200500 -- (-794.242) (-795.677) [-799.789] (-793.607) * [-793.300] (-797.038) (-794.733) (-793.150) -- 0:00:47
201000 -- (-794.600) [-798.284] (-798.376) (-794.147) * (-792.699) [-796.271] (-794.359) (-792.523) -- 0:00:47
201500 -- (-792.958) (-794.827) [-791.967] (-794.963) * (-792.864) (-793.781) [-794.030] (-793.090) -- 0:00:47
202000 -- (-792.145) (-794.254) (-795.207) [-792.843] * (-795.146) (-795.514) [-793.861] (-796.887) -- 0:00:47
202500 -- (-791.651) (-792.098) [-793.932] (-792.990) * (-791.925) (-796.933) [-792.561] (-797.580) -- 0:00:47
203000 -- (-792.088) (-793.382) [-793.588] (-792.624) * (-793.310) [-792.953] (-795.534) (-793.320) -- 0:00:47
203500 -- [-794.337] (-792.552) (-794.485) (-792.709) * (-791.614) (-792.476) [-792.399] (-795.206) -- 0:00:46
204000 -- (-794.996) (-793.306) [-795.208] (-792.114) * [-793.268] (-792.044) (-792.290) (-796.905) -- 0:00:46
204500 -- (-794.569) (-792.748) [-791.922] (-794.058) * (-798.030) (-793.080) (-794.572) [-796.178] -- 0:00:46
205000 -- (-792.682) (-795.331) [-791.635] (-791.984) * (-792.502) [-793.893] (-795.320) (-791.917) -- 0:00:46
Average standard deviation of split frequencies: 0.016019
205500 -- (-794.256) (-795.230) [-792.700] (-792.944) * (-794.653) (-792.061) (-794.873) [-792.197] -- 0:00:46
206000 -- (-794.840) (-794.236) [-795.702] (-793.111) * (-792.506) [-793.002] (-792.433) (-795.305) -- 0:00:46
206500 -- (-794.091) (-793.841) (-792.246) [-792.180] * (-793.701) (-793.391) [-792.123] (-793.977) -- 0:00:49
207000 -- (-793.567) (-794.573) [-793.963] (-793.867) * (-793.669) [-793.823] (-795.637) (-794.673) -- 0:00:49
207500 -- [-795.111] (-791.664) (-799.398) (-795.270) * (-791.725) [-791.731] (-794.646) (-798.158) -- 0:00:49
208000 -- (-794.565) [-792.501] (-794.398) (-796.326) * (-792.200) (-795.666) [-793.065] (-794.055) -- 0:00:49
208500 -- (-794.352) (-796.485) [-796.829] (-793.013) * (-792.752) (-793.835) (-795.211) [-792.470] -- 0:00:49
209000 -- [-793.795] (-793.051) (-793.787) (-792.892) * (-792.814) (-795.842) (-792.733) [-792.636] -- 0:00:49
209500 -- (-792.481) (-795.356) [-792.835] (-792.419) * (-791.896) [-792.743] (-795.268) (-796.284) -- 0:00:49
210000 -- (-792.629) [-792.149] (-792.722) (-796.051) * (-797.643) (-793.035) [-792.727] (-794.481) -- 0:00:48
Average standard deviation of split frequencies: 0.016841
210500 -- (-792.430) [-793.641] (-793.194) (-794.573) * (-794.366) (-794.791) (-795.614) [-791.427] -- 0:00:48
211000 -- [-793.881] (-795.418) (-791.747) (-793.067) * (-800.499) [-796.137] (-795.976) (-793.984) -- 0:00:48
211500 -- (-793.910) [-795.199] (-796.528) (-793.113) * [-793.796] (-794.891) (-797.888) (-793.304) -- 0:00:48
212000 -- (-794.119) (-792.585) [-792.630] (-796.107) * (-792.130) (-792.264) (-792.956) [-795.114] -- 0:00:48
212500 -- (-793.039) (-794.754) [-792.181] (-792.210) * (-791.350) (-792.478) [-792.815] (-796.065) -- 0:00:48
213000 -- (-795.676) (-794.897) [-794.237] (-792.530) * (-793.439) [-791.828] (-791.682) (-794.880) -- 0:00:48
213500 -- (-793.980) [-792.945] (-795.043) (-792.571) * (-793.336) (-793.102) [-791.841] (-797.874) -- 0:00:47
214000 -- (-793.245) (-794.305) (-793.996) [-792.168] * (-794.111) (-793.929) [-794.036] (-795.301) -- 0:00:47
214500 -- (-793.076) (-794.472) (-792.577) [-792.195] * (-793.855) (-801.149) [-795.894] (-797.359) -- 0:00:47
215000 -- [-796.981] (-792.021) (-792.136) (-793.599) * [-793.011] (-794.893) (-796.724) (-793.182) -- 0:00:47
Average standard deviation of split frequencies: 0.020127
215500 -- (-795.006) (-793.515) (-792.479) [-793.904] * (-792.589) (-794.018) (-796.631) [-792.140] -- 0:00:47
216000 -- [-796.825] (-793.808) (-792.489) (-793.212) * (-792.917) (-798.580) [-795.986] (-791.776) -- 0:00:47
216500 -- (-793.516) (-791.620) (-791.721) [-792.999] * (-792.312) [-792.791] (-795.198) (-792.390) -- 0:00:47
217000 -- (-794.252) (-792.526) (-792.445) [-793.953] * (-794.648) (-792.576) (-793.558) [-792.533] -- 0:00:46
217500 -- (-793.098) (-793.219) [-793.213] (-793.137) * (-794.402) [-792.090] (-791.617) (-793.340) -- 0:00:46
218000 -- (-792.494) (-791.585) (-793.061) [-793.117] * (-794.306) [-792.949] (-794.150) (-796.125) -- 0:00:46
218500 -- (-795.571) (-791.368) [-792.194] (-793.988) * (-795.549) (-794.427) [-791.626] (-794.086) -- 0:00:46
219000 -- (-795.280) (-799.253) [-793.022] (-792.802) * (-797.057) [-795.592] (-792.019) (-793.755) -- 0:00:46
219500 -- (-796.681) (-794.634) [-793.711] (-795.448) * [-792.868] (-791.806) (-794.730) (-794.592) -- 0:00:46
220000 -- [-794.650] (-795.993) (-792.794) (-793.818) * [-792.979] (-796.374) (-794.196) (-794.521) -- 0:00:46
Average standard deviation of split frequencies: 0.020532
220500 -- (-799.872) (-799.434) [-792.120] (-793.393) * (-795.238) [-794.058] (-794.218) (-791.750) -- 0:00:45
221000 -- (-799.849) [-793.862] (-792.707) (-792.037) * [-791.729] (-793.824) (-794.830) (-792.879) -- 0:00:45
221500 -- [-794.279] (-793.330) (-792.532) (-792.912) * (-793.127) (-793.202) (-795.728) [-795.321] -- 0:00:45
222000 -- (-796.963) (-795.994) (-792.551) [-792.541] * [-792.383] (-793.437) (-793.408) (-791.829) -- 0:00:45
222500 -- (-794.195) [-794.396] (-794.295) (-792.455) * (-794.967) [-793.143] (-791.780) (-796.968) -- 0:00:45
223000 -- (-793.680) (-798.048) (-795.873) [-792.763] * (-794.024) [-791.447] (-795.412) (-797.366) -- 0:00:45
223500 -- (-793.259) (-798.609) (-792.373) [-792.546] * (-796.717) (-793.410) (-795.521) [-791.758] -- 0:00:48
224000 -- [-794.323] (-800.485) (-793.305) (-794.773) * (-793.849) [-793.378] (-792.279) (-792.159) -- 0:00:48
224500 -- (-794.648) (-794.217) [-793.024] (-803.097) * (-795.047) (-795.525) [-793.259] (-795.792) -- 0:00:48
225000 -- (-793.402) [-795.935] (-795.076) (-792.767) * (-796.994) [-796.038] (-791.602) (-793.792) -- 0:00:48
Average standard deviation of split frequencies: 0.019816
225500 -- (-793.288) (-791.793) [-793.218] (-796.465) * (-797.000) [-793.067] (-794.572) (-792.692) -- 0:00:48
226000 -- (-792.304) (-792.199) (-800.326) [-797.774] * (-796.112) (-792.194) (-794.043) [-793.383] -- 0:00:47
226500 -- (-793.812) (-792.275) (-796.335) [-795.926] * (-795.014) [-792.816] (-792.268) (-793.134) -- 0:00:47
227000 -- (-798.049) [-791.777] (-792.636) (-796.189) * (-796.764) [-792.484] (-793.493) (-793.345) -- 0:00:47
227500 -- [-792.822] (-794.158) (-792.660) (-797.259) * (-794.443) (-796.752) [-792.902] (-795.760) -- 0:00:47
228000 -- (-794.919) (-794.167) [-792.106] (-796.362) * (-794.363) [-792.562] (-794.813) (-797.672) -- 0:00:47
228500 -- (-794.784) (-794.589) [-792.309] (-792.420) * (-792.982) (-792.093) (-794.836) [-792.823] -- 0:00:47
229000 -- (-798.766) (-793.748) [-792.688] (-793.295) * (-792.356) (-794.335) [-791.903] (-794.403) -- 0:00:47
229500 -- (-793.112) [-793.312] (-792.987) (-795.571) * [-794.667] (-794.517) (-791.861) (-795.087) -- 0:00:47
230000 -- (-792.521) (-793.293) [-794.101] (-795.377) * (-795.337) (-793.127) (-792.921) [-794.710] -- 0:00:46
Average standard deviation of split frequencies: 0.019982
230500 -- (-801.475) (-795.234) (-795.749) [-792.353] * (-794.762) (-796.447) [-792.902] (-795.244) -- 0:00:46
231000 -- (-802.368) [-797.546] (-793.243) (-792.192) * (-795.062) (-797.761) (-795.939) [-793.184] -- 0:00:46
231500 -- (-792.257) (-796.644) [-792.994] (-792.162) * (-795.105) [-795.730] (-792.760) (-792.281) -- 0:00:46
232000 -- [-800.369] (-794.746) (-795.240) (-797.111) * (-793.430) (-801.271) (-793.297) [-794.814] -- 0:00:46
232500 -- (-794.539) (-792.729) (-795.481) [-792.311] * (-792.555) (-798.298) (-795.062) [-792.686] -- 0:00:46
233000 -- (-795.702) [-792.343] (-796.083) (-792.479) * [-793.013] (-792.110) (-793.594) (-796.045) -- 0:00:46
233500 -- (-796.219) [-794.193] (-796.616) (-793.033) * (-792.289) (-791.628) (-793.615) [-792.522] -- 0:00:45
234000 -- (-794.609) (-794.082) [-791.917] (-792.260) * [-792.169] (-792.126) (-794.436) (-793.571) -- 0:00:45
234500 -- (-796.164) (-799.610) [-793.898] (-793.293) * (-794.974) (-792.025) [-792.550] (-792.972) -- 0:00:45
235000 -- (-796.838) (-793.744) (-797.780) [-794.275] * [-793.395] (-793.356) (-795.001) (-796.322) -- 0:00:45
Average standard deviation of split frequencies: 0.019642
235500 -- (-793.943) (-793.535) (-792.919) [-793.056] * (-794.856) (-792.649) (-795.057) [-793.518] -- 0:00:45
236000 -- (-796.477) (-792.817) [-792.333] (-794.707) * (-793.020) (-792.214) (-795.126) [-793.079] -- 0:00:45
236500 -- [-791.916] (-795.290) (-797.400) (-795.441) * (-793.313) [-792.006] (-794.839) (-793.676) -- 0:00:45
237000 -- (-791.913) (-795.858) [-797.839] (-795.355) * (-792.757) (-796.601) [-796.954] (-793.504) -- 0:00:45
237500 -- [-793.803] (-794.722) (-795.870) (-793.943) * (-796.341) (-792.893) (-794.137) [-792.387] -- 0:00:44
238000 -- [-796.192] (-792.750) (-797.041) (-795.177) * (-795.248) (-792.828) [-794.188] (-793.431) -- 0:00:44
238500 -- (-797.815) [-791.944] (-793.308) (-795.115) * (-793.203) (-793.416) (-792.280) [-792.154] -- 0:00:44
239000 -- (-793.855) (-792.364) [-792.205] (-794.036) * (-795.020) (-792.189) (-794.079) [-792.397] -- 0:00:44
239500 -- (-792.642) (-794.788) [-792.905] (-792.429) * (-793.388) [-793.827] (-791.830) (-792.922) -- 0:00:44
240000 -- [-794.446] (-792.120) (-793.831) (-794.112) * (-794.838) (-791.486) (-793.192) [-793.050] -- 0:00:47
Average standard deviation of split frequencies: 0.019703
240500 -- (-794.623) (-793.308) [-794.851] (-792.405) * [-793.994] (-793.459) (-798.207) (-792.418) -- 0:00:47
241000 -- (-794.126) [-794.625] (-796.054) (-793.351) * (-793.062) (-793.310) [-793.459] (-792.385) -- 0:00:47
241500 -- (-794.126) (-794.458) [-792.885] (-793.007) * [-795.209] (-796.846) (-793.335) (-794.401) -- 0:00:47
242000 -- (-794.856) (-793.769) (-794.044) [-793.550] * (-792.553) (-792.441) [-793.233] (-791.707) -- 0:00:46
242500 -- [-793.485] (-797.032) (-792.616) (-792.307) * (-792.556) (-792.176) (-793.118) [-794.142] -- 0:00:46
243000 -- (-792.798) (-793.345) [-791.614] (-795.442) * (-798.300) [-794.864] (-793.022) (-792.585) -- 0:00:46
243500 -- [-793.364] (-792.663) (-792.463) (-794.244) * (-794.610) (-793.990) [-797.076] (-802.785) -- 0:00:46
244000 -- (-793.316) (-792.958) (-797.854) [-794.852] * (-794.637) (-792.988) [-792.026] (-793.132) -- 0:00:46
244500 -- (-795.548) (-794.800) (-792.191) [-791.806] * (-792.480) (-792.508) [-792.746] (-792.380) -- 0:00:46
245000 -- (-794.972) (-793.584) (-791.713) [-791.521] * (-795.055) (-796.575) (-794.562) [-793.284] -- 0:00:46
Average standard deviation of split frequencies: 0.019388
245500 -- (-794.409) [-791.607] (-791.349) (-793.150) * (-793.539) (-793.883) [-793.316] (-793.609) -- 0:00:46
246000 -- (-793.910) [-792.400] (-796.257) (-794.004) * (-793.261) (-792.728) [-794.948] (-798.410) -- 0:00:45
246500 -- (-791.876) (-794.626) [-799.443] (-795.700) * (-796.242) (-792.750) [-794.014] (-793.112) -- 0:00:45
247000 -- [-797.511] (-794.534) (-792.605) (-793.893) * (-794.013) (-794.054) [-793.632] (-796.516) -- 0:00:45
247500 -- [-792.915] (-795.756) (-792.985) (-792.300) * (-792.973) (-792.471) (-794.541) [-794.953] -- 0:00:45
248000 -- (-794.763) (-794.680) (-792.342) [-791.740] * (-793.202) (-797.128) (-793.625) [-792.015] -- 0:00:45
248500 -- [-795.382] (-794.402) (-793.323) (-793.842) * (-792.021) (-794.378) (-795.852) [-793.216] -- 0:00:45
249000 -- (-797.437) (-792.603) (-793.266) [-794.354] * (-794.905) [-792.739] (-796.520) (-793.530) -- 0:00:45
249500 -- [-794.718] (-793.121) (-792.143) (-793.976) * [-792.429] (-793.476) (-794.029) (-797.432) -- 0:00:45
250000 -- (-795.898) [-792.585] (-794.350) (-799.749) * (-792.913) [-793.909] (-793.196) (-795.811) -- 0:00:45
Average standard deviation of split frequencies: 0.018905
250500 -- (-797.430) [-792.301] (-791.589) (-798.166) * (-793.097) [-793.090] (-792.235) (-794.600) -- 0:00:44
251000 -- [-798.604] (-796.440) (-794.806) (-793.347) * (-794.169) (-792.107) [-791.827] (-798.900) -- 0:00:44
251500 -- [-794.751] (-793.625) (-792.485) (-794.632) * (-792.134) [-793.312] (-794.349) (-793.100) -- 0:00:44
252000 -- [-792.550] (-797.073) (-793.450) (-800.647) * (-793.307) (-794.041) (-793.072) [-793.566] -- 0:00:44
252500 -- (-792.549) (-792.082) [-793.342] (-797.609) * (-791.788) (-792.990) (-795.658) [-795.732] -- 0:00:44
253000 -- (-793.894) (-792.132) [-793.661] (-796.822) * (-792.117) (-791.272) [-798.881] (-794.517) -- 0:00:44
253500 -- [-794.949] (-792.256) (-795.063) (-794.846) * [-794.592] (-792.344) (-798.228) (-794.471) -- 0:00:44
254000 -- (-795.156) (-791.680) (-794.025) [-793.527] * (-797.612) (-794.082) (-797.420) [-792.307] -- 0:00:44
254500 -- (-795.671) (-792.507) (-793.056) [-792.895] * (-794.774) (-796.406) [-795.320] (-792.511) -- 0:00:43
255000 -- (-797.712) (-792.444) [-794.095] (-795.069) * [-795.477] (-791.993) (-796.408) (-797.780) -- 0:00:43
Average standard deviation of split frequencies: 0.020051
255500 -- (-795.348) (-797.653) [-796.370] (-796.095) * (-794.891) (-793.241) [-794.683] (-794.162) -- 0:00:43
256000 -- (-795.893) (-794.854) [-793.954] (-798.567) * (-794.946) (-791.793) [-796.991] (-792.919) -- 0:00:43
256500 -- (-791.528) [-792.669] (-793.685) (-792.768) * [-793.268] (-792.977) (-792.241) (-792.352) -- 0:00:43
257000 -- (-794.079) (-791.962) [-794.357] (-794.625) * [-792.420] (-793.664) (-791.851) (-791.675) -- 0:00:46
257500 -- (-798.157) [-794.307] (-795.666) (-798.073) * (-794.409) (-796.374) [-793.452] (-792.176) -- 0:00:46
258000 -- (-794.184) (-791.597) [-794.339] (-794.073) * (-793.856) [-792.787] (-797.353) (-792.260) -- 0:00:46
258500 -- (-793.769) [-793.914] (-792.676) (-795.562) * [-793.711] (-791.633) (-793.851) (-792.958) -- 0:00:45
259000 -- [-792.165] (-792.275) (-794.605) (-793.345) * [-793.167] (-792.136) (-792.430) (-791.964) -- 0:00:45
259500 -- (-792.746) (-792.765) (-793.739) [-794.029] * (-794.634) (-797.650) [-791.686] (-792.193) -- 0:00:45
260000 -- (-791.509) (-793.761) [-792.664] (-794.707) * [-791.489] (-794.403) (-791.646) (-794.888) -- 0:00:45
Average standard deviation of split frequencies: 0.018587
260500 -- (-794.912) [-792.672] (-792.343) (-792.245) * [-792.916] (-793.478) (-791.724) (-794.857) -- 0:00:45
261000 -- (-794.805) (-793.748) [-792.792] (-793.159) * (-792.256) [-791.793] (-792.414) (-795.508) -- 0:00:45
261500 -- [-793.794] (-794.694) (-794.075) (-792.433) * (-794.545) (-791.723) (-795.671) [-793.988] -- 0:00:45
262000 -- (-794.078) (-794.517) (-793.978) [-791.829] * (-795.115) (-793.981) (-793.027) [-795.300] -- 0:00:45
262500 -- (-793.860) (-799.269) (-793.573) [-792.898] * (-796.088) (-794.075) (-795.530) [-793.720] -- 0:00:44
263000 -- (-792.434) (-795.045) (-794.003) [-793.936] * [-793.177] (-793.867) (-795.168) (-791.817) -- 0:00:44
263500 -- (-797.009) (-792.788) (-794.090) [-795.351] * [-796.028] (-798.376) (-795.342) (-793.778) -- 0:00:44
264000 -- (-797.323) (-794.387) (-792.904) [-793.225] * [-793.815] (-801.222) (-795.161) (-791.987) -- 0:00:44
264500 -- [-792.352] (-794.828) (-792.854) (-795.342) * (-791.768) (-795.789) (-794.067) [-793.736] -- 0:00:44
265000 -- (-794.376) (-795.654) (-794.121) [-795.409] * [-795.753] (-796.589) (-794.209) (-791.855) -- 0:00:44
Average standard deviation of split frequencies: 0.017033
265500 -- (-794.289) (-796.778) (-793.732) [-794.710] * (-794.518) (-793.714) (-794.853) [-792.751] -- 0:00:44
266000 -- (-797.255) (-793.664) (-794.791) [-792.928] * [-794.774] (-795.802) (-795.779) (-792.750) -- 0:00:44
266500 -- (-794.546) (-795.954) [-792.987] (-793.187) * (-793.940) [-793.365] (-794.006) (-794.426) -- 0:00:44
267000 -- (-794.004) [-792.825] (-792.362) (-793.793) * [-793.250] (-792.811) (-794.927) (-792.174) -- 0:00:43
267500 -- (-793.270) (-795.679) [-793.884] (-794.713) * (-793.195) (-791.796) [-796.262] (-792.399) -- 0:00:43
268000 -- (-794.387) (-793.488) (-792.461) [-793.790] * (-791.897) (-792.582) [-792.422] (-792.222) -- 0:00:43
268500 -- (-794.909) (-793.057) [-794.825] (-796.053) * (-792.689) (-793.889) (-792.633) [-791.833] -- 0:00:43
269000 -- (-794.077) (-794.296) (-793.980) [-793.229] * [-794.062] (-791.650) (-799.373) (-796.354) -- 0:00:43
269500 -- [-797.422] (-794.372) (-798.506) (-793.836) * (-792.370) [-792.574] (-793.722) (-792.515) -- 0:00:43
270000 -- (-792.246) [-795.027] (-792.607) (-795.451) * (-792.882) (-791.382) (-794.044) [-792.317] -- 0:00:43
Average standard deviation of split frequencies: 0.018674
270500 -- (-793.072) (-792.344) (-793.720) [-797.761] * (-793.700) [-791.385] (-791.427) (-792.089) -- 0:00:43
271000 -- [-792.699] (-795.156) (-796.735) (-793.449) * (-793.966) [-791.531] (-791.257) (-793.940) -- 0:00:43
271500 -- (-796.291) [-791.733] (-793.684) (-794.596) * (-800.164) [-791.685] (-791.273) (-792.356) -- 0:00:42
272000 -- (-793.856) (-792.604) (-792.326) [-795.856] * (-796.884) (-794.928) (-795.994) [-791.641] -- 0:00:42
272500 -- (-793.043) [-792.500] (-792.477) (-792.966) * [-794.832] (-795.474) (-793.081) (-791.771) -- 0:00:42
273000 -- (-793.854) (-791.533) [-792.447] (-794.255) * (-797.223) (-794.359) (-795.524) [-793.728] -- 0:00:42
273500 -- (-791.615) (-793.274) (-792.219) [-794.076] * (-791.927) (-796.644) [-793.256] (-793.726) -- 0:00:45
274000 -- (-791.396) (-793.053) (-794.046) [-793.401] * [-792.369] (-793.259) (-793.468) (-791.622) -- 0:00:45
274500 -- (-793.683) (-793.795) (-793.110) [-791.938] * (-796.220) (-794.217) [-791.550] (-792.745) -- 0:00:44
275000 -- [-794.875] (-794.757) (-794.011) (-792.992) * (-796.655) [-796.017] (-792.560) (-797.165) -- 0:00:44
Average standard deviation of split frequencies: 0.017649
275500 -- (-793.272) (-793.195) [-795.618] (-793.660) * (-794.247) (-794.700) [-792.327] (-794.030) -- 0:00:44
276000 -- (-792.264) [-793.065] (-798.266) (-792.657) * (-797.172) (-792.438) [-793.100] (-796.931) -- 0:00:44
276500 -- (-793.890) (-794.534) [-792.381] (-792.696) * (-793.157) [-792.662] (-797.924) (-796.736) -- 0:00:44
277000 -- [-793.805] (-797.002) (-794.163) (-793.158) * (-795.303) (-792.533) (-797.070) [-792.960] -- 0:00:44
277500 -- (-793.230) (-794.758) [-795.084] (-796.008) * [-792.573] (-792.386) (-794.281) (-794.613) -- 0:00:44
278000 -- (-791.652) (-796.304) [-796.707] (-793.855) * (-792.284) (-793.041) [-795.489] (-800.143) -- 0:00:44
278500 -- (-798.023) [-796.079] (-791.834) (-793.823) * [-794.820] (-793.507) (-798.272) (-796.039) -- 0:00:44
279000 -- [-794.529] (-793.064) (-792.895) (-794.383) * (-795.065) [-794.115] (-794.879) (-794.505) -- 0:00:43
279500 -- (-793.764) (-794.275) (-791.342) [-791.945] * (-794.975) [-793.798] (-797.031) (-793.012) -- 0:00:43
280000 -- [-792.226] (-792.104) (-795.831) (-793.731) * (-797.050) (-792.404) (-793.992) [-792.742] -- 0:00:43
Average standard deviation of split frequencies: 0.017591
280500 -- (-794.152) (-797.730) [-796.673] (-798.892) * (-796.481) (-794.033) (-793.339) [-795.681] -- 0:00:43
281000 -- (-791.777) [-796.834] (-792.418) (-796.286) * [-793.891] (-796.287) (-794.472) (-803.022) -- 0:00:43
281500 -- (-791.953) (-793.997) [-794.423] (-801.662) * (-797.143) (-796.448) (-794.244) [-793.337] -- 0:00:43
282000 -- [-791.943] (-793.299) (-795.256) (-795.672) * (-794.274) (-794.728) (-792.005) [-794.220] -- 0:00:43
282500 -- (-791.746) [-796.631] (-791.601) (-796.436) * (-793.932) [-792.020] (-795.155) (-791.906) -- 0:00:43
283000 -- (-791.684) (-794.963) (-791.488) [-795.039] * (-793.385) (-796.451) [-793.552] (-793.526) -- 0:00:43
283500 -- (-792.091) [-793.759] (-794.490) (-792.918) * (-797.777) (-791.428) (-793.669) [-797.777] -- 0:00:42
284000 -- (-792.048) (-793.688) (-795.519) [-791.615] * (-797.196) (-794.969) [-792.351] (-794.604) -- 0:00:42
284500 -- (-792.193) (-793.171) (-794.295) [-791.762] * (-793.395) [-792.721] (-794.458) (-792.112) -- 0:00:42
285000 -- (-794.946) [-791.981] (-791.824) (-792.750) * (-794.839) [-794.601] (-793.527) (-793.259) -- 0:00:42
Average standard deviation of split frequencies: 0.017003
285500 -- (-796.518) (-794.463) [-792.242] (-796.045) * (-795.049) [-792.123] (-796.656) (-792.068) -- 0:00:42
286000 -- (-793.597) (-796.697) (-793.281) [-792.245] * [-792.597] (-793.321) (-796.701) (-795.618) -- 0:00:42
286500 -- (-792.621) [-792.749] (-794.849) (-791.831) * (-793.369) (-794.828) [-795.109] (-794.450) -- 0:00:42
287000 -- (-792.684) (-793.200) [-796.222] (-795.136) * (-793.130) (-792.864) (-794.243) [-802.335] -- 0:00:42
287500 -- (-794.823) [-794.731] (-795.523) (-792.583) * (-793.554) (-793.145) (-795.710) [-801.462] -- 0:00:42
288000 -- (-794.359) [-793.325] (-793.088) (-796.041) * (-795.577) (-791.337) [-793.655] (-794.312) -- 0:00:42
288500 -- (-793.084) (-794.174) [-794.282] (-793.127) * (-792.718) [-792.565] (-794.768) (-792.107) -- 0:00:41
289000 -- (-796.320) [-793.266] (-796.307) (-795.922) * (-791.772) [-794.171] (-794.775) (-792.133) -- 0:00:41
289500 -- (-794.415) (-795.344) (-795.419) [-792.890] * (-795.379) (-793.051) (-795.533) [-791.757] -- 0:00:41
290000 -- (-793.076) (-795.712) (-792.403) [-794.297] * (-797.484) [-796.037] (-794.980) (-796.243) -- 0:00:44
Average standard deviation of split frequencies: 0.016645
290500 -- (-792.994) [-795.985] (-795.569) (-794.863) * (-795.523) (-793.501) (-795.410) [-791.875] -- 0:00:43
291000 -- (-791.707) (-796.140) [-794.025] (-792.766) * (-792.511) (-792.161) [-792.205] (-793.128) -- 0:00:43
291500 -- (-795.994) (-793.620) (-791.878) [-798.062] * [-792.825] (-792.843) (-794.199) (-796.631) -- 0:00:43
292000 -- (-793.266) (-793.472) (-793.333) [-794.504] * (-792.374) [-792.868] (-795.421) (-796.258) -- 0:00:43
292500 -- (-795.816) [-795.133] (-792.442) (-796.244) * (-791.817) [-797.048] (-792.980) (-798.689) -- 0:00:43
293000 -- (-794.009) [-793.729] (-795.766) (-792.153) * [-794.472] (-792.416) (-797.082) (-797.113) -- 0:00:43
293500 -- (-793.013) (-793.267) (-794.760) [-793.569] * [-792.413] (-791.841) (-797.948) (-792.216) -- 0:00:43
294000 -- (-794.323) (-796.313) [-796.382] (-795.344) * (-792.327) (-793.119) (-792.771) [-795.770] -- 0:00:43
294500 -- (-794.484) (-794.667) [-792.300] (-792.108) * (-793.120) (-794.187) [-792.668] (-792.379) -- 0:00:43
295000 -- (-792.853) (-795.163) (-792.357) [-792.234] * (-792.970) (-792.795) [-794.545] (-792.522) -- 0:00:43
Average standard deviation of split frequencies: 0.016563
295500 -- (-792.910) (-794.009) [-791.277] (-794.933) * (-793.332) (-792.852) (-796.032) [-793.514] -- 0:00:42
296000 -- [-794.350] (-793.067) (-795.045) (-794.919) * (-795.377) (-792.229) [-793.913] (-796.659) -- 0:00:42
296500 -- (-794.363) (-793.293) (-794.116) [-794.124] * (-795.570) (-793.196) (-797.011) [-791.682] -- 0:00:42
297000 -- (-792.810) [-792.319] (-795.552) (-794.346) * (-794.110) (-793.548) [-797.981] (-792.983) -- 0:00:42
297500 -- [-794.312] (-792.694) (-792.978) (-792.081) * (-791.988) (-792.751) [-794.588] (-794.280) -- 0:00:42
298000 -- (-792.653) [-795.970] (-794.804) (-793.215) * (-793.833) (-793.071) (-793.106) [-792.954] -- 0:00:42
298500 -- (-798.334) [-794.420] (-792.093) (-792.631) * (-793.462) [-791.374] (-794.410) (-792.636) -- 0:00:42
299000 -- (-793.836) (-796.465) (-793.160) [-792.311] * (-795.088) (-792.475) (-796.837) [-793.922] -- 0:00:42
299500 -- (-794.617) (-794.447) [-791.901] (-792.893) * (-794.163) (-796.128) (-795.272) [-797.994] -- 0:00:42
300000 -- (-794.345) [-794.127] (-792.233) (-793.313) * [-792.788] (-795.708) (-797.017) (-793.562) -- 0:00:42
Average standard deviation of split frequencies: 0.017164
300500 -- (-793.777) (-793.521) (-795.058) [-793.968] * (-797.413) (-793.947) (-794.902) [-792.788] -- 0:00:41
301000 -- (-793.727) (-794.447) [-793.608] (-792.489) * (-797.850) (-795.801) (-799.931) [-794.962] -- 0:00:41
301500 -- [-791.705] (-797.380) (-792.981) (-793.692) * (-792.972) (-794.115) [-793.168] (-792.181) -- 0:00:41
302000 -- (-792.868) [-797.134] (-792.750) (-795.451) * [-794.832] (-793.302) (-793.779) (-794.966) -- 0:00:41
302500 -- (-792.368) (-797.167) [-792.317] (-794.456) * (-792.284) (-794.800) [-793.852] (-795.134) -- 0:00:41
303000 -- [-792.234] (-797.689) (-792.720) (-796.473) * (-801.934) (-794.308) [-794.952] (-797.692) -- 0:00:41
303500 -- (-792.183) [-796.534] (-793.008) (-797.233) * (-798.224) (-792.954) (-793.181) [-796.824] -- 0:00:41
304000 -- [-793.540] (-798.742) (-792.311) (-791.514) * (-801.800) (-792.089) (-792.495) [-793.643] -- 0:00:41
304500 -- (-796.344) (-793.364) [-792.037] (-792.744) * [-792.965] (-794.410) (-793.360) (-792.575) -- 0:00:41
305000 -- [-793.211] (-791.495) (-791.656) (-792.160) * (-796.877) (-794.351) (-794.812) [-793.494] -- 0:00:41
Average standard deviation of split frequencies: 0.017100
305500 -- (-795.017) (-794.373) [-792.609] (-795.628) * (-793.014) (-796.047) (-794.151) [-792.224] -- 0:00:40
306000 -- [-795.215] (-793.903) (-791.932) (-793.660) * (-804.332) (-797.927) (-792.965) [-794.036] -- 0:00:40
306500 -- [-796.219] (-794.580) (-795.508) (-794.454) * (-795.692) (-795.605) [-794.511] (-796.441) -- 0:00:42
307000 -- (-792.084) (-792.582) (-795.809) [-794.321] * [-792.016] (-792.760) (-794.845) (-793.438) -- 0:00:42
307500 -- (-793.324) (-792.670) (-797.109) [-792.526] * (-792.258) [-795.497] (-791.901) (-791.776) -- 0:00:42
308000 -- (-793.390) (-797.353) (-800.950) [-793.525] * (-792.001) (-796.015) (-792.797) [-791.836] -- 0:00:42
308500 -- (-792.083) (-793.868) (-792.040) [-792.677] * (-793.107) (-794.382) (-792.036) [-791.929] -- 0:00:42
309000 -- (-792.083) [-791.963] (-793.786) (-793.173) * [-793.134] (-794.242) (-792.482) (-793.985) -- 0:00:42
309500 -- (-793.436) (-794.106) (-793.517) [-793.153] * (-794.392) (-792.452) (-794.187) [-794.170] -- 0:00:42
310000 -- (-799.775) [-792.212] (-792.741) (-796.199) * (-794.445) (-792.889) [-792.781] (-791.982) -- 0:00:42
Average standard deviation of split frequencies: 0.017298
310500 -- (-792.871) (-792.516) [-792.652] (-793.573) * (-796.778) (-794.102) (-792.729) [-791.828] -- 0:00:42
311000 -- [-792.097] (-793.050) (-791.233) (-794.433) * (-796.057) [-794.756] (-793.344) (-795.535) -- 0:00:42
311500 -- (-794.171) (-795.349) (-792.328) [-793.189] * (-792.769) (-796.176) (-792.611) [-793.308] -- 0:00:41
312000 -- (-793.075) [-799.775] (-794.518) (-794.236) * (-793.028) [-791.944] (-792.668) (-791.945) -- 0:00:41
312500 -- [-793.952] (-791.676) (-792.090) (-792.147) * (-796.151) [-791.878] (-792.918) (-794.483) -- 0:00:41
313000 -- (-797.015) (-793.587) [-791.991] (-791.576) * [-792.633] (-795.157) (-792.836) (-792.688) -- 0:00:41
313500 -- (-795.053) [-792.090] (-792.066) (-793.113) * [-792.991] (-793.607) (-792.254) (-793.067) -- 0:00:41
314000 -- (-793.899) (-796.022) [-791.863] (-797.487) * (-791.857) (-793.687) [-791.724] (-793.854) -- 0:00:41
314500 -- [-791.833] (-795.336) (-793.229) (-794.040) * [-795.707] (-792.665) (-792.395) (-792.054) -- 0:00:41
315000 -- (-794.389) (-793.624) (-792.722) [-791.831] * (-797.325) (-793.736) (-791.811) [-791.811] -- 0:00:41
Average standard deviation of split frequencies: 0.017976
315500 -- (-797.893) (-795.008) (-794.639) [-791.683] * [-793.262] (-795.331) (-793.526) (-791.813) -- 0:00:41
316000 -- [-794.419] (-795.248) (-794.295) (-791.846) * (-793.577) [-794.351] (-792.807) (-795.454) -- 0:00:41
316500 -- (-792.739) (-792.642) [-797.226] (-791.718) * [-793.624] (-795.502) (-793.000) (-794.991) -- 0:00:41
317000 -- (-793.129) [-792.043] (-791.892) (-791.580) * (-791.819) (-792.390) [-793.317] (-794.616) -- 0:00:40
317500 -- (-793.615) (-793.504) [-794.434] (-791.748) * [-792.538] (-792.651) (-793.971) (-794.245) -- 0:00:40
318000 -- (-792.266) (-793.231) (-800.711) [-792.829] * [-793.572] (-792.837) (-798.096) (-795.794) -- 0:00:40
318500 -- [-795.754] (-792.980) (-794.297) (-792.682) * (-793.785) (-795.529) (-792.135) [-793.795] -- 0:00:40
319000 -- (-795.759) (-795.285) [-793.650] (-792.303) * (-794.586) [-794.213] (-792.555) (-792.798) -- 0:00:40
319500 -- (-792.522) (-799.779) [-793.471] (-795.771) * (-795.558) [-794.282] (-792.367) (-797.719) -- 0:00:40
320000 -- (-794.021) [-797.264] (-794.102) (-793.217) * (-794.480) (-794.861) (-791.793) [-792.887] -- 0:00:40
Average standard deviation of split frequencies: 0.018049
320500 -- (-795.933) (-798.349) (-800.105) [-792.062] * (-795.774) (-793.843) (-791.436) [-793.161] -- 0:00:40
321000 -- (-794.268) (-793.271) [-794.710] (-792.149) * [-791.900] (-793.585) (-792.853) (-795.345) -- 0:00:40
321500 -- (-792.168) (-792.749) [-793.312] (-792.843) * (-793.328) (-796.402) [-793.271] (-794.860) -- 0:00:40
322000 -- (-793.438) (-792.012) [-793.510] (-798.045) * (-794.606) (-795.567) (-792.860) [-792.476] -- 0:00:40
322500 -- [-792.724] (-795.110) (-795.668) (-792.415) * (-793.900) (-792.076) (-792.270) [-794.053] -- 0:00:39
323000 -- (-792.955) (-800.115) (-793.241) [-794.411] * [-793.672] (-792.479) (-792.325) (-801.400) -- 0:00:41
323500 -- (-794.757) (-792.517) (-794.609) [-793.511] * [-791.730] (-797.056) (-794.065) (-795.727) -- 0:00:41
324000 -- (-799.561) (-796.365) [-792.399] (-793.827) * (-793.335) [-797.781] (-794.387) (-798.076) -- 0:00:41
324500 -- [-798.945] (-792.229) (-793.669) (-793.912) * (-797.361) (-794.360) [-795.952] (-793.853) -- 0:00:41
325000 -- (-796.749) [-793.879] (-793.620) (-793.858) * [-793.952] (-796.098) (-794.732) (-792.187) -- 0:00:41
Average standard deviation of split frequencies: 0.017276
325500 -- (-791.741) (-792.731) (-793.671) [-795.047] * (-791.401) [-797.618] (-795.530) (-795.647) -- 0:00:41
326000 -- (-796.776) [-794.133] (-793.090) (-792.033) * (-793.900) (-794.575) (-791.927) [-792.751] -- 0:00:41
326500 -- (-796.050) (-792.403) (-794.444) [-793.379] * (-792.263) [-792.240] (-791.634) (-795.373) -- 0:00:41
327000 -- (-793.926) (-796.218) (-792.331) [-793.329] * (-794.079) [-792.729] (-797.071) (-794.176) -- 0:00:41
327500 -- [-792.347] (-793.417) (-795.219) (-792.737) * (-794.196) (-794.412) (-792.459) [-793.438] -- 0:00:41
328000 -- (-792.573) (-792.671) [-792.554] (-792.305) * (-797.974) (-797.573) (-795.649) [-793.175] -- 0:00:40
328500 -- (-791.593) (-793.128) (-792.295) [-794.277] * [-794.674] (-794.150) (-793.530) (-792.233) -- 0:00:40
329000 -- (-793.747) [-792.926] (-792.894) (-792.788) * (-793.543) (-792.741) (-795.864) [-793.503] -- 0:00:40
329500 -- (-793.291) (-793.773) [-792.777] (-796.254) * (-791.619) [-793.305] (-793.962) (-794.672) -- 0:00:40
330000 -- (-791.970) (-795.523) (-793.080) [-795.504] * (-792.681) [-793.019] (-793.435) (-793.311) -- 0:00:40
Average standard deviation of split frequencies: 0.017899
330500 -- (-792.374) (-793.762) (-797.389) [-793.285] * (-791.961) [-791.963] (-795.466) (-793.389) -- 0:00:40
331000 -- (-792.959) [-793.312] (-795.960) (-798.351) * (-793.854) (-792.218) [-797.930] (-793.708) -- 0:00:40
331500 -- (-792.854) (-792.771) (-792.753) [-794.155] * [-792.434] (-794.927) (-797.207) (-793.389) -- 0:00:40
332000 -- [-795.275] (-793.934) (-794.842) (-793.403) * (-793.086) (-794.810) (-791.641) [-791.751] -- 0:00:40
332500 -- (-795.337) (-797.993) [-793.908] (-793.020) * (-793.613) [-791.855] (-797.512) (-794.759) -- 0:00:40
333000 -- (-793.805) (-794.927) [-792.862] (-793.771) * (-794.863) (-792.841) (-796.577) [-793.202] -- 0:00:40
333500 -- (-792.556) (-797.608) [-792.181] (-793.087) * (-795.278) (-793.133) [-792.925] (-793.329) -- 0:00:39
334000 -- (-793.251) [-795.303] (-792.445) (-795.860) * [-793.149] (-791.426) (-793.294) (-800.206) -- 0:00:39
334500 -- (-795.825) (-794.411) (-793.051) [-796.173] * [-793.888] (-793.609) (-793.378) (-795.245) -- 0:00:39
335000 -- [-792.050] (-796.377) (-796.213) (-795.065) * (-799.145) (-793.606) [-794.318] (-792.778) -- 0:00:39
Average standard deviation of split frequencies: 0.018151
335500 -- [-792.047] (-792.799) (-793.994) (-794.104) * (-804.574) [-798.482] (-793.934) (-797.078) -- 0:00:39
336000 -- (-792.588) (-792.475) (-793.465) [-792.721] * (-794.093) [-793.679] (-795.994) (-795.476) -- 0:00:39
336500 -- [-791.468] (-792.546) (-794.826) (-793.287) * (-794.017) (-797.065) (-792.439) [-793.487] -- 0:00:39
337000 -- (-800.126) [-794.525] (-795.160) (-793.569) * [-792.385] (-794.252) (-791.793) (-792.899) -- 0:00:39
337500 -- (-795.986) (-794.523) [-791.467] (-793.602) * [-794.492] (-793.987) (-793.689) (-794.339) -- 0:00:39
338000 -- [-792.767] (-793.099) (-794.352) (-794.119) * (-793.953) [-797.066] (-797.387) (-796.342) -- 0:00:39
338500 -- (-791.930) [-793.320] (-792.657) (-792.448) * (-792.421) (-792.226) (-793.147) [-792.318] -- 0:00:39
339000 -- (-791.894) [-792.703] (-792.833) (-796.900) * (-792.198) (-792.720) (-792.423) [-792.045] -- 0:00:38
339500 -- [-792.938] (-792.510) (-792.892) (-798.581) * (-796.217) (-793.151) [-792.980] (-793.709) -- 0:00:38
340000 -- (-792.285) [-792.837] (-794.840) (-796.093) * (-792.959) [-793.233] (-793.381) (-793.590) -- 0:00:40
Average standard deviation of split frequencies: 0.018335
340500 -- (-794.227) (-793.636) (-796.733) [-798.596] * (-794.641) (-795.256) (-791.839) [-794.716] -- 0:00:40
341000 -- (-796.776) [-793.183] (-794.631) (-792.567) * (-793.419) (-801.051) (-799.420) [-793.409] -- 0:00:40
341500 -- [-791.514] (-793.228) (-792.425) (-796.825) * (-792.561) (-793.471) [-791.688] (-793.584) -- 0:00:40
342000 -- [-793.264] (-792.985) (-792.438) (-795.966) * (-791.362) (-797.488) (-794.782) [-793.269] -- 0:00:40
342500 -- (-793.210) (-794.649) [-794.311] (-796.307) * (-791.444) (-795.030) (-797.716) [-792.066] -- 0:00:40
343000 -- [-794.061] (-793.534) (-795.608) (-796.914) * (-792.560) (-792.921) [-797.319] (-792.439) -- 0:00:40
343500 -- (-793.749) (-791.912) [-793.577] (-792.788) * (-796.364) [-792.931] (-792.033) (-795.243) -- 0:00:40
344000 -- (-793.044) (-792.957) (-795.776) [-792.530] * (-793.931) [-792.936] (-791.869) (-793.936) -- 0:00:40
344500 -- (-797.961) (-792.813) [-793.964] (-792.829) * (-797.324) [-791.860] (-791.854) (-794.266) -- 0:00:39
345000 -- (-793.678) (-792.978) (-797.415) [-801.357] * [-794.723] (-792.961) (-794.458) (-793.918) -- 0:00:39
Average standard deviation of split frequencies: 0.016830
345500 -- (-795.046) (-795.293) [-793.118] (-793.079) * [-795.361] (-793.042) (-798.337) (-792.987) -- 0:00:39
346000 -- (-794.009) [-795.383] (-793.186) (-792.916) * (-794.786) [-792.227] (-792.345) (-794.675) -- 0:00:39
346500 -- [-795.085] (-795.221) (-794.229) (-798.215) * (-793.537) [-794.526] (-795.792) (-792.660) -- 0:00:39
347000 -- (-794.033) (-797.494) (-794.241) [-793.583] * [-794.526] (-794.491) (-798.076) (-792.487) -- 0:00:39
347500 -- [-797.145] (-795.167) (-792.263) (-792.154) * (-792.857) [-792.567] (-793.011) (-794.946) -- 0:00:39
348000 -- [-796.292] (-792.039) (-792.275) (-792.123) * (-793.899) (-792.057) (-792.778) [-792.852] -- 0:00:39
348500 -- (-796.474) (-791.851) (-791.652) [-791.795] * (-794.981) [-792.293] (-797.665) (-791.981) -- 0:00:39
349000 -- [-794.054] (-795.600) (-793.664) (-793.773) * (-791.970) (-794.058) (-793.667) [-794.289] -- 0:00:39
349500 -- (-797.265) (-795.161) [-793.766] (-794.419) * [-793.062] (-796.294) (-793.382) (-795.782) -- 0:00:39
350000 -- (-795.007) [-794.900] (-796.310) (-794.796) * (-791.869) (-799.356) [-794.040] (-791.835) -- 0:00:39
Average standard deviation of split frequencies: 0.017551
350500 -- (-793.535) [-791.980] (-797.274) (-796.779) * (-798.445) [-794.087] (-795.759) (-792.337) -- 0:00:38
351000 -- (-792.786) (-793.568) [-796.835] (-794.505) * [-794.434] (-794.148) (-796.453) (-794.745) -- 0:00:38
351500 -- (-791.630) (-793.348) (-794.257) [-793.114] * [-793.755] (-793.745) (-793.891) (-795.076) -- 0:00:38
352000 -- (-795.936) [-793.308] (-794.364) (-792.918) * (-795.685) (-793.374) [-793.634] (-792.157) -- 0:00:38
352500 -- (-793.254) (-793.989) (-792.008) [-793.336] * (-792.600) [-791.561] (-793.055) (-793.695) -- 0:00:38
353000 -- (-792.135) (-793.126) (-800.102) [-793.514] * [-796.374] (-794.347) (-792.992) (-798.623) -- 0:00:38
353500 -- (-791.949) (-792.474) (-796.467) [-794.806] * (-794.685) (-794.408) (-793.305) [-792.977] -- 0:00:38
354000 -- [-793.300] (-793.947) (-791.547) (-794.924) * (-794.546) (-792.112) (-794.870) [-793.709] -- 0:00:38
354500 -- (-792.457) (-794.393) [-792.110] (-793.751) * [-792.367] (-797.860) (-792.996) (-794.750) -- 0:00:38
355000 -- [-791.678] (-797.928) (-792.790) (-795.811) * (-794.683) [-793.624] (-791.500) (-796.548) -- 0:00:38
Average standard deviation of split frequencies: 0.017803
355500 -- (-791.918) (-792.862) (-793.180) [-794.877] * (-793.388) [-794.226] (-793.552) (-794.525) -- 0:00:38
356000 -- (-795.624) (-794.216) (-794.424) [-793.784] * (-795.171) [-792.673] (-794.934) (-793.091) -- 0:00:37
356500 -- (-793.065) (-792.941) (-794.238) [-797.001] * (-794.565) [-793.952] (-795.770) (-792.837) -- 0:00:37
357000 -- (-793.926) (-793.365) [-792.456] (-796.088) * (-798.999) [-794.129] (-793.044) (-795.220) -- 0:00:39
357500 -- [-792.206] (-795.953) (-794.820) (-794.744) * (-799.919) (-793.447) [-796.054] (-792.005) -- 0:00:39
358000 -- (-792.479) [-791.561] (-793.801) (-792.845) * (-793.667) (-794.188) (-794.146) [-793.813] -- 0:00:39
358500 -- (-792.450) (-795.413) (-793.801) [-791.945] * (-797.759) (-795.541) (-793.140) [-794.829] -- 0:00:39
359000 -- (-792.373) (-795.107) (-799.131) [-794.103] * [-796.511] (-793.922) (-794.321) (-793.814) -- 0:00:39
359500 -- [-793.426] (-792.965) (-791.656) (-793.300) * (-792.171) (-796.802) [-791.787] (-792.765) -- 0:00:39
360000 -- (-794.715) (-793.599) (-791.664) [-792.709] * (-792.107) (-792.523) (-792.425) [-792.443] -- 0:00:39
Average standard deviation of split frequencies: 0.018153
360500 -- [-796.029] (-792.914) (-793.921) (-791.419) * (-792.295) (-796.959) (-794.607) [-794.153] -- 0:00:39
361000 -- (-792.101) (-792.251) (-794.238) [-792.665] * (-792.315) (-797.968) (-794.966) [-798.000] -- 0:00:38
361500 -- (-792.591) (-793.652) (-793.287) [-792.095] * (-793.095) (-798.487) (-793.848) [-791.757] -- 0:00:38
362000 -- (-795.440) (-793.940) [-791.955] (-793.961) * [-794.338] (-794.072) (-791.268) (-794.382) -- 0:00:38
362500 -- (-791.957) [-791.882] (-793.986) (-793.794) * (-796.932) (-793.126) (-797.575) [-796.258] -- 0:00:38
363000 -- (-793.490) (-791.460) [-792.127] (-791.934) * (-796.684) (-794.127) [-796.666] (-797.014) -- 0:00:38
363500 -- (-795.181) (-791.460) [-793.597] (-793.651) * (-796.674) [-794.762] (-801.036) (-792.340) -- 0:00:38
364000 -- (-793.202) (-791.930) (-791.261) [-793.577] * (-792.756) (-798.552) [-793.067] (-794.349) -- 0:00:38
364500 -- (-793.728) (-793.790) (-791.685) [-792.820] * (-792.303) (-796.962) [-792.184] (-794.134) -- 0:00:38
365000 -- (-791.647) (-793.470) (-794.454) [-792.571] * (-792.684) (-796.524) (-794.996) [-799.709] -- 0:00:38
Average standard deviation of split frequencies: 0.017245
365500 -- (-793.339) (-796.540) (-796.712) [-795.056] * (-794.846) [-797.657] (-796.100) (-800.552) -- 0:00:38
366000 -- (-794.629) [-795.341] (-794.646) (-794.638) * [-793.393] (-794.613) (-794.064) (-796.181) -- 0:00:38
366500 -- (-793.534) [-793.403] (-792.777) (-797.423) * (-793.728) [-796.230] (-792.265) (-797.060) -- 0:00:38
367000 -- (-796.063) (-792.613) (-795.144) [-795.462] * (-795.553) (-792.041) (-794.076) [-794.217] -- 0:00:37
367500 -- [-795.265] (-791.862) (-794.441) (-793.989) * (-799.636) [-794.217] (-793.370) (-796.039) -- 0:00:37
368000 -- (-792.387) (-791.659) (-792.551) [-794.660] * [-793.188] (-791.806) (-793.796) (-794.568) -- 0:00:37
368500 -- (-792.834) (-791.775) [-792.814] (-792.091) * [-792.878] (-792.898) (-791.682) (-796.079) -- 0:00:37
369000 -- (-791.922) (-792.488) [-792.074] (-793.364) * (-800.330) [-791.755] (-792.937) (-795.786) -- 0:00:37
369500 -- [-792.309] (-795.071) (-793.705) (-792.816) * [-792.553] (-791.875) (-792.926) (-792.742) -- 0:00:37
370000 -- (-794.717) [-794.598] (-792.103) (-796.680) * (-794.740) (-793.179) (-792.663) [-796.773] -- 0:00:37
Average standard deviation of split frequencies: 0.017381
370500 -- (-794.858) (-795.560) (-792.088) [-794.166] * (-793.967) (-792.894) (-792.521) [-793.958] -- 0:00:37
371000 -- (-793.158) (-794.249) (-792.084) [-791.389] * (-793.154) (-793.745) [-791.836] (-793.095) -- 0:00:37
371500 -- (-791.913) (-794.130) (-793.770) [-793.151] * (-791.591) (-793.132) (-793.781) [-792.797] -- 0:00:37
372000 -- [-794.603] (-793.448) (-792.668) (-796.422) * (-793.518) [-794.490] (-793.968) (-792.662) -- 0:00:37
372500 -- (-795.207) (-792.193) [-793.164] (-797.241) * (-798.253) [-795.329] (-791.757) (-792.706) -- 0:00:37
373000 -- [-797.267] (-792.474) (-793.579) (-793.995) * (-794.502) [-794.820] (-792.420) (-792.446) -- 0:00:36
373500 -- [-794.726] (-794.997) (-792.549) (-794.821) * (-794.339) (-794.865) [-795.861] (-794.710) -- 0:00:38
374000 -- (-794.654) [-794.337] (-796.266) (-793.929) * (-792.105) (-792.598) (-792.928) [-792.930] -- 0:00:38
374500 -- (-796.991) (-792.026) [-793.081] (-792.443) * (-793.501) [-792.446] (-793.208) (-792.760) -- 0:00:38
375000 -- (-794.563) (-796.059) [-792.762] (-792.512) * [-794.280] (-794.254) (-797.806) (-793.876) -- 0:00:38
Average standard deviation of split frequencies: 0.017204
375500 -- (-794.170) (-795.143) (-792.354) [-798.242] * (-794.289) [-793.060] (-794.669) (-794.889) -- 0:00:38
376000 -- (-799.558) (-798.489) [-791.812] (-792.332) * (-794.594) (-793.624) (-793.962) [-794.512] -- 0:00:38
376500 -- (-796.978) (-794.086) [-793.074] (-793.306) * (-791.584) (-792.841) (-793.401) [-792.253] -- 0:00:38
377000 -- (-798.207) (-795.028) [-792.126] (-794.722) * (-795.784) (-797.466) (-795.228) [-794.666] -- 0:00:38
377500 -- (-795.013) (-795.464) [-794.431] (-800.540) * (-795.663) (-795.156) (-792.960) [-796.479] -- 0:00:37
378000 -- (-793.259) (-793.694) (-794.939) [-792.512] * [-794.780] (-797.021) (-794.119) (-792.822) -- 0:00:37
378500 -- (-795.273) (-793.697) (-794.702) [-793.994] * (-798.932) (-794.571) (-793.404) [-792.408] -- 0:00:37
379000 -- (-793.381) (-794.752) (-792.482) [-791.699] * (-798.704) (-794.491) (-794.641) [-793.296] -- 0:00:37
379500 -- [-794.319] (-792.283) (-793.256) (-792.630) * (-796.751) [-793.232] (-794.173) (-793.008) -- 0:00:37
380000 -- (-792.154) (-793.181) [-793.386] (-792.805) * (-794.761) (-791.400) [-795.087] (-791.709) -- 0:00:37
Average standard deviation of split frequencies: 0.017062
380500 -- [-792.391] (-794.555) (-793.663) (-792.860) * [-795.777] (-792.804) (-795.189) (-791.729) -- 0:00:37
381000 -- [-793.876] (-794.001) (-792.382) (-797.544) * (-792.028) (-792.013) (-792.980) [-792.805] -- 0:00:37
381500 -- (-794.005) (-794.337) (-793.067) [-793.348] * (-796.289) [-792.930] (-793.851) (-792.111) -- 0:00:37
382000 -- (-795.894) (-794.838) [-796.916] (-793.593) * [-793.282] (-793.230) (-792.045) (-795.243) -- 0:00:37
382500 -- [-792.227] (-794.148) (-793.471) (-795.257) * [-793.952] (-793.334) (-793.813) (-799.663) -- 0:00:37
383000 -- (-792.971) (-796.160) (-792.608) [-795.392] * (-792.210) (-792.411) [-797.287] (-794.046) -- 0:00:37
383500 -- [-792.679] (-802.872) (-796.471) (-796.444) * [-792.264] (-793.380) (-795.355) (-794.330) -- 0:00:36
384000 -- [-793.001] (-792.615) (-794.588) (-795.384) * (-792.469) (-795.234) (-795.608) [-796.028] -- 0:00:36
384500 -- (-793.275) [-794.372] (-795.252) (-798.875) * (-796.027) [-795.765] (-795.288) (-794.626) -- 0:00:36
385000 -- (-792.750) (-796.966) [-796.099] (-792.448) * (-793.047) [-791.955] (-792.590) (-795.574) -- 0:00:36
Average standard deviation of split frequencies: 0.016623
385500 -- (-793.394) (-793.927) (-795.862) [-792.884] * (-792.435) (-793.639) [-793.398] (-795.794) -- 0:00:36
386000 -- (-794.410) [-792.393] (-791.565) (-792.245) * (-792.216) [-796.578] (-794.442) (-792.571) -- 0:00:36
386500 -- (-794.953) [-791.689] (-791.665) (-792.826) * (-791.984) (-791.721) (-800.277) [-793.594] -- 0:00:36
387000 -- (-794.876) [-792.113] (-794.976) (-793.014) * [-793.157] (-792.182) (-793.539) (-795.895) -- 0:00:36
387500 -- (-792.640) (-792.250) [-795.824] (-792.807) * (-792.562) (-792.610) [-795.145] (-795.761) -- 0:00:36
388000 -- [-794.267] (-793.496) (-792.724) (-794.674) * (-793.258) [-791.564] (-797.502) (-792.771) -- 0:00:36
388500 -- [-791.599] (-792.031) (-795.453) (-796.238) * (-795.085) (-794.012) (-793.270) [-792.906] -- 0:00:36
389000 -- [-793.143] (-792.072) (-792.461) (-791.951) * (-793.393) (-795.612) (-795.688) [-792.174] -- 0:00:36
389500 -- (-793.617) [-795.076] (-798.957) (-796.739) * [-795.416] (-794.957) (-794.366) (-794.459) -- 0:00:36
390000 -- (-793.090) (-793.577) [-792.391] (-792.802) * (-793.493) (-793.286) (-794.225) [-791.726] -- 0:00:35
Average standard deviation of split frequencies: 0.015419
390500 -- (-793.053) (-794.107) (-796.950) [-791.662] * [-793.163] (-791.333) (-795.381) (-795.232) -- 0:00:37
391000 -- (-792.976) (-792.155) [-793.082] (-795.153) * (-794.869) [-792.891] (-793.412) (-794.824) -- 0:00:37
391500 -- [-796.192] (-792.152) (-796.327) (-797.906) * [-793.125] (-794.111) (-794.242) (-792.697) -- 0:00:37
392000 -- (-794.309) (-793.013) [-795.455] (-793.774) * (-791.837) [-794.163] (-794.728) (-791.667) -- 0:00:37
392500 -- (-795.023) (-792.456) (-799.506) [-793.170] * (-795.028) [-794.074] (-799.021) (-791.735) -- 0:00:37
393000 -- [-795.252] (-794.832) (-792.747) (-794.056) * [-799.794] (-794.689) (-794.336) (-793.092) -- 0:00:37
393500 -- (-797.108) (-794.305) [-791.624] (-794.850) * (-799.830) [-792.963] (-792.507) (-796.563) -- 0:00:36
394000 -- (-795.668) (-793.198) (-797.652) [-793.868] * (-792.868) (-794.196) (-795.792) [-794.350] -- 0:00:36
394500 -- (-793.323) (-795.615) (-799.933) [-794.860] * [-796.664] (-793.329) (-794.969) (-796.263) -- 0:00:36
395000 -- [-794.851] (-796.509) (-795.458) (-791.880) * (-793.045) (-797.077) [-792.047] (-794.465) -- 0:00:36
Average standard deviation of split frequencies: 0.015740
395500 -- [-796.499] (-794.475) (-791.921) (-791.502) * (-795.156) (-793.918) (-791.998) [-793.557] -- 0:00:36
396000 -- [-794.028] (-795.499) (-795.053) (-792.553) * (-791.925) [-793.934] (-793.274) (-794.428) -- 0:00:36
396500 -- [-793.390] (-794.723) (-793.741) (-794.474) * [-796.262] (-793.260) (-792.196) (-797.465) -- 0:00:36
397000 -- (-792.319) [-793.498] (-792.146) (-798.466) * (-793.438) [-792.145] (-793.113) (-799.702) -- 0:00:36
397500 -- (-796.264) [-792.147] (-795.348) (-794.575) * (-793.604) (-791.938) (-794.259) [-793.207] -- 0:00:36
398000 -- (-792.800) [-792.072] (-799.329) (-795.960) * (-796.146) [-793.839] (-796.087) (-795.655) -- 0:00:36
398500 -- (-792.006) (-793.512) (-795.913) [-794.214] * (-794.680) [-792.955] (-792.260) (-794.078) -- 0:00:36
399000 -- (-792.047) (-792.519) [-795.363] (-794.635) * (-794.691) (-792.755) (-795.372) [-792.246] -- 0:00:36
399500 -- (-794.550) [-792.520] (-794.787) (-792.433) * [-792.876] (-793.396) (-792.985) (-794.272) -- 0:00:36
400000 -- (-793.024) [-795.136] (-795.956) (-795.520) * (-793.682) [-792.906] (-798.703) (-799.212) -- 0:00:36
Average standard deviation of split frequencies: 0.014188
400500 -- (-794.138) (-795.657) [-792.380] (-792.405) * [-792.493] (-795.956) (-796.770) (-792.072) -- 0:00:35
401000 -- (-794.181) (-793.556) [-797.623] (-792.445) * (-794.737) (-798.375) [-793.812] (-791.997) -- 0:00:35
401500 -- (-795.821) [-792.006] (-798.223) (-796.315) * (-793.675) (-796.329) (-792.291) [-793.927] -- 0:00:35
402000 -- (-792.079) [-792.897] (-793.375) (-794.398) * (-799.301) (-794.306) [-794.861] (-794.260) -- 0:00:35
402500 -- [-794.206] (-795.867) (-792.269) (-794.713) * [-796.190] (-796.458) (-796.310) (-796.961) -- 0:00:35
403000 -- (-794.827) [-792.019] (-792.131) (-793.919) * (-794.213) (-792.024) (-795.045) [-794.970] -- 0:00:35
403500 -- (-793.641) [-792.203] (-795.352) (-793.822) * (-793.021) (-791.883) [-793.612] (-794.154) -- 0:00:35
404000 -- (-792.864) (-797.557) (-795.597) [-793.392] * (-799.958) [-792.339] (-794.454) (-794.647) -- 0:00:35
404500 -- (-793.081) (-793.813) [-791.949] (-799.230) * [-793.078] (-798.801) (-792.023) (-795.029) -- 0:00:35
405000 -- [-795.702] (-792.629) (-793.991) (-793.680) * (-796.469) (-793.586) (-792.525) [-792.342] -- 0:00:35
Average standard deviation of split frequencies: 0.013387
405500 -- [-793.779] (-793.269) (-793.474) (-793.623) * (-794.561) (-795.477) [-792.400] (-794.898) -- 0:00:35
406000 -- [-793.565] (-795.202) (-792.956) (-793.133) * (-794.134) [-792.671] (-793.799) (-793.382) -- 0:00:35
406500 -- (-792.870) (-793.850) [-794.419] (-794.749) * (-794.021) [-796.321] (-792.482) (-795.930) -- 0:00:35
407000 -- (-792.378) (-795.154) [-791.585] (-794.029) * (-793.545) (-793.983) [-792.772] (-794.004) -- 0:00:36
407500 -- (-793.978) (-798.703) [-796.038] (-793.279) * (-793.711) (-793.717) (-793.823) [-793.327] -- 0:00:36
408000 -- (-794.539) [-792.682] (-794.414) (-794.791) * (-791.531) (-792.064) [-795.202] (-793.789) -- 0:00:36
408500 -- (-793.098) [-795.768] (-794.128) (-793.240) * [-791.581] (-793.169) (-794.296) (-795.432) -- 0:00:36
409000 -- (-792.740) [-791.895] (-793.443) (-793.756) * [-791.567] (-791.544) (-792.926) (-796.626) -- 0:00:36
409500 -- (-792.163) (-792.628) [-794.022] (-793.489) * [-792.099] (-792.341) (-793.571) (-796.069) -- 0:00:36
410000 -- (-793.533) [-794.504] (-796.213) (-793.150) * (-791.410) (-794.479) [-792.363] (-792.862) -- 0:00:35
Average standard deviation of split frequencies: 0.012762
410500 -- [-793.905] (-793.720) (-792.587) (-791.888) * (-793.422) (-793.705) (-794.026) [-795.366] -- 0:00:35
411000 -- (-796.048) (-796.478) (-794.035) [-791.840] * (-792.974) (-794.138) [-791.899] (-798.819) -- 0:00:35
411500 -- [-793.005] (-795.750) (-793.612) (-793.555) * (-793.455) (-793.279) [-792.275] (-796.296) -- 0:00:35
412000 -- [-793.351] (-796.263) (-792.664) (-795.767) * [-792.822] (-791.743) (-793.429) (-794.210) -- 0:00:35
412500 -- (-793.632) (-791.869) [-793.693] (-792.458) * (-792.323) (-793.021) [-793.335] (-792.558) -- 0:00:35
413000 -- (-792.582) [-793.391] (-795.139) (-796.195) * [-792.643] (-792.912) (-792.859) (-794.258) -- 0:00:35
413500 -- [-793.340] (-794.711) (-795.119) (-793.402) * [-794.930] (-792.641) (-792.343) (-796.997) -- 0:00:35
414000 -- (-797.052) (-793.331) (-793.461) [-792.119] * [-793.156] (-791.960) (-791.665) (-794.405) -- 0:00:35
414500 -- [-794.537] (-793.463) (-794.060) (-794.533) * (-793.021) (-792.835) (-794.609) [-798.085] -- 0:00:35
415000 -- (-795.152) [-793.602] (-794.010) (-792.304) * (-794.122) [-792.141] (-793.607) (-796.311) -- 0:00:35
Average standard deviation of split frequencies: 0.012932
415500 -- (-792.766) [-793.162] (-797.539) (-793.199) * (-795.268) [-794.627] (-792.755) (-793.800) -- 0:00:35
416000 -- [-793.414] (-792.672) (-794.197) (-793.578) * (-794.532) (-794.277) [-793.504] (-795.239) -- 0:00:35
416500 -- (-796.638) (-792.905) [-793.601] (-792.154) * (-792.821) (-795.112) [-794.041] (-798.266) -- 0:00:35
417000 -- (-793.557) (-795.277) [-792.598] (-795.226) * (-793.330) (-794.038) (-796.300) [-794.593] -- 0:00:34
417500 -- (-792.265) [-792.523] (-795.010) (-794.171) * (-796.313) [-792.846] (-794.614) (-795.377) -- 0:00:34
418000 -- (-793.308) [-794.373] (-795.864) (-793.254) * (-796.967) [-792.799] (-795.266) (-797.057) -- 0:00:34
418500 -- (-794.896) [-794.260] (-794.107) (-792.643) * (-796.548) (-794.629) (-792.510) [-792.892] -- 0:00:34
419000 -- (-793.377) (-794.830) (-794.828) [-792.552] * (-793.359) (-797.959) [-793.148] (-799.128) -- 0:00:34
419500 -- [-793.864] (-796.477) (-793.847) (-792.291) * [-793.356] (-794.109) (-798.458) (-795.833) -- 0:00:34
420000 -- (-792.791) (-792.549) [-791.953] (-794.039) * (-795.700) [-791.827] (-794.063) (-796.356) -- 0:00:34
Average standard deviation of split frequencies: 0.013447
420500 -- (-794.453) (-794.636) (-793.860) [-793.729] * (-795.799) [-792.554] (-794.520) (-792.372) -- 0:00:34
421000 -- (-792.153) (-793.237) [-793.841] (-791.966) * (-796.522) (-792.456) [-795.372] (-792.182) -- 0:00:34
421500 -- [-793.163] (-792.119) (-795.080) (-791.688) * (-793.822) (-792.732) [-796.577] (-792.124) -- 0:00:34
422000 -- (-793.046) (-793.169) (-797.173) [-794.191] * (-791.877) [-794.534] (-800.688) (-792.365) -- 0:00:34
422500 -- [-797.337] (-793.069) (-793.259) (-795.222) * (-794.326) [-793.677] (-793.638) (-792.819) -- 0:00:34
423000 -- (-793.744) (-792.211) [-793.815] (-794.971) * [-791.553] (-794.928) (-797.110) (-793.026) -- 0:00:34
423500 -- (-794.070) (-793.402) [-794.529] (-792.851) * (-793.071) (-793.367) (-796.315) [-793.518] -- 0:00:35
424000 -- (-795.085) (-796.445) [-795.065] (-796.248) * [-791.932] (-798.591) (-793.751) (-792.702) -- 0:00:35
424500 -- (-792.253) [-793.637] (-795.075) (-793.014) * (-793.087) [-795.667] (-796.432) (-793.678) -- 0:00:35
425000 -- (-797.174) (-792.918) [-794.536] (-793.750) * [-792.341] (-795.096) (-794.947) (-794.210) -- 0:00:35
Average standard deviation of split frequencies: 0.013214
425500 -- (-795.418) [-792.346] (-794.085) (-793.208) * [-793.735] (-793.919) (-794.391) (-793.171) -- 0:00:35
426000 -- (-798.084) [-794.238] (-798.417) (-792.935) * [-792.366] (-793.484) (-799.189) (-793.881) -- 0:00:35
426500 -- (-795.826) (-792.366) (-794.264) [-799.440] * (-792.507) (-793.013) (-795.848) [-792.240] -- 0:00:34
427000 -- (-792.527) (-794.132) [-792.888] (-794.136) * [-795.081] (-793.755) (-793.929) (-794.738) -- 0:00:34
427500 -- (-793.822) [-794.237] (-795.217) (-795.289) * (-793.798) [-792.000] (-793.057) (-800.240) -- 0:00:34
428000 -- [-794.226] (-792.773) (-792.982) (-793.889) * (-792.942) (-791.695) [-794.352] (-793.798) -- 0:00:34
428500 -- (-798.905) (-792.595) [-793.412] (-794.385) * [-793.133] (-794.918) (-794.848) (-794.044) -- 0:00:34
429000 -- (-792.794) (-791.938) [-793.582] (-794.418) * [-792.758] (-792.612) (-794.515) (-794.557) -- 0:00:34
429500 -- (-793.700) (-792.935) [-792.992] (-793.082) * (-798.779) [-791.986] (-795.720) (-792.032) -- 0:00:34
430000 -- (-793.405) (-793.601) (-794.492) [-794.571] * (-795.073) (-791.820) (-791.846) [-794.136] -- 0:00:34
Average standard deviation of split frequencies: 0.012588
430500 -- (-795.171) (-797.154) [-794.151] (-795.980) * (-794.920) [-796.728] (-793.481) (-795.823) -- 0:00:34
431000 -- [-797.438] (-794.755) (-792.818) (-792.374) * (-795.088) [-792.654] (-796.008) (-793.442) -- 0:00:34
431500 -- (-796.500) [-796.425] (-791.903) (-794.587) * (-796.842) [-793.156] (-793.316) (-795.259) -- 0:00:34
432000 -- [-795.712] (-793.647) (-794.941) (-793.155) * (-792.511) (-793.180) (-792.005) [-791.328] -- 0:00:34
432500 -- (-798.381) [-797.352] (-798.449) (-796.517) * (-794.398) (-799.276) [-791.942] (-795.504) -- 0:00:34
433000 -- (-793.596) [-793.653] (-797.508) (-793.986) * (-795.234) [-794.732] (-793.952) (-793.098) -- 0:00:34
433500 -- (-793.999) (-793.521) (-793.620) [-792.361] * [-796.575] (-794.651) (-793.690) (-796.602) -- 0:00:33
434000 -- (-793.661) [-795.325] (-794.135) (-791.893) * (-791.841) (-792.623) [-791.787] (-793.962) -- 0:00:33
434500 -- (-793.756) (-793.603) (-794.273) [-793.042] * (-793.304) (-794.941) [-792.310] (-792.371) -- 0:00:33
435000 -- (-793.901) (-794.935) [-793.233] (-792.402) * (-795.654) (-794.195) [-794.815] (-792.482) -- 0:00:33
Average standard deviation of split frequencies: 0.012637
435500 -- (-792.565) (-794.400) [-792.562] (-794.788) * (-793.356) [-795.992] (-795.568) (-792.884) -- 0:00:33
436000 -- (-793.639) (-794.220) (-792.785) [-794.686] * (-797.791) (-795.531) [-792.830] (-792.244) -- 0:00:33
436500 -- [-794.431] (-799.560) (-792.116) (-792.024) * (-795.325) [-795.733] (-793.140) (-793.895) -- 0:00:33
437000 -- (-794.854) (-794.620) (-794.981) [-792.454] * (-794.793) [-794.974] (-793.693) (-795.450) -- 0:00:33
437500 -- [-794.468] (-794.449) (-792.641) (-796.113) * (-794.922) (-794.556) (-794.480) [-794.028] -- 0:00:33
438000 -- (-792.217) (-793.589) [-793.101] (-793.549) * (-792.115) [-794.076] (-793.442) (-793.705) -- 0:00:33
438500 -- [-793.258] (-792.593) (-792.544) (-794.856) * (-793.684) (-795.878) [-793.411] (-794.891) -- 0:00:33
439000 -- (-793.473) (-793.985) [-792.878] (-794.211) * (-793.349) [-795.018] (-793.130) (-793.461) -- 0:00:33
439500 -- (-796.567) (-794.773) [-792.826] (-792.745) * [-794.323] (-792.264) (-792.105) (-792.993) -- 0:00:33
440000 -- (-797.646) (-794.985) [-791.733] (-798.354) * [-793.547] (-792.951) (-791.642) (-793.000) -- 0:00:34
Average standard deviation of split frequencies: 0.013026
440500 -- [-792.398] (-793.395) (-795.294) (-797.407) * (-792.537) (-792.035) [-791.716] (-795.100) -- 0:00:34
441000 -- (-793.789) (-792.156) [-794.696] (-798.794) * [-793.805] (-794.477) (-793.601) (-794.489) -- 0:00:34
441500 -- (-793.290) (-792.553) (-795.817) [-794.417] * (-791.966) (-794.614) [-793.982] (-793.997) -- 0:00:34
442000 -- [-793.339] (-793.216) (-797.690) (-791.725) * [-792.562] (-793.262) (-794.799) (-796.689) -- 0:00:34
442500 -- (-794.042) (-792.788) [-792.212] (-791.829) * [-791.973] (-795.863) (-797.899) (-794.038) -- 0:00:34
443000 -- (-793.060) (-792.924) (-796.352) [-792.224] * (-796.744) (-793.136) [-793.174] (-793.735) -- 0:00:33
443500 -- (-795.928) (-792.377) (-794.066) [-795.008] * (-795.823) (-795.802) [-793.714] (-793.683) -- 0:00:33
444000 -- (-791.553) (-798.011) [-791.778] (-793.956) * (-792.372) [-792.097] (-792.687) (-793.027) -- 0:00:33
444500 -- (-792.344) (-797.542) (-795.563) [-792.674] * (-794.015) (-792.443) [-792.350] (-792.391) -- 0:00:33
445000 -- (-792.509) (-792.382) (-792.657) [-792.541] * (-793.681) (-795.356) [-794.075] (-793.098) -- 0:00:33
Average standard deviation of split frequencies: 0.012684
445500 -- [-798.244] (-793.906) (-792.897) (-792.748) * [-793.217] (-794.087) (-793.699) (-793.876) -- 0:00:33
446000 -- [-797.939] (-795.705) (-792.741) (-793.902) * (-792.363) (-799.284) [-794.312] (-791.556) -- 0:00:33
446500 -- (-794.281) [-793.129] (-795.739) (-796.160) * [-793.009] (-793.118) (-796.388) (-792.683) -- 0:00:33
447000 -- [-795.807] (-793.948) (-793.338) (-793.637) * [-794.617] (-792.374) (-798.625) (-794.011) -- 0:00:33
447500 -- (-792.661) (-795.279) [-793.638] (-792.970) * (-794.449) (-793.476) [-797.011] (-795.072) -- 0:00:33
448000 -- (-791.827) (-792.315) (-797.109) [-792.080] * (-795.072) [-792.935] (-794.119) (-792.554) -- 0:00:33
448500 -- [-794.096] (-795.801) (-792.803) (-792.247) * (-795.505) [-792.651] (-793.037) (-798.545) -- 0:00:33
449000 -- (-793.820) (-792.254) [-793.096] (-794.761) * (-798.096) (-797.169) (-792.783) [-793.004] -- 0:00:33
449500 -- [-791.872] (-792.287) (-792.987) (-794.473) * (-791.587) (-793.045) (-792.012) [-793.488] -- 0:00:33
450000 -- (-792.171) (-792.952) [-792.895] (-794.891) * (-792.432) (-793.416) [-791.641] (-792.854) -- 0:00:33
Average standard deviation of split frequencies: 0.013206
450500 -- (-792.613) [-793.210] (-791.989) (-793.205) * (-793.154) (-792.300) (-792.973) [-794.121] -- 0:00:32
451000 -- [-793.989] (-794.212) (-795.442) (-794.385) * (-792.697) (-794.903) (-793.365) [-792.189] -- 0:00:32
451500 -- [-796.944] (-795.991) (-793.916) (-794.631) * [-793.854] (-797.347) (-793.339) (-793.080) -- 0:00:32
452000 -- (-797.125) (-792.272) (-791.901) [-797.592] * (-793.906) (-794.101) (-794.307) [-798.104] -- 0:00:32
452500 -- [-793.061] (-797.377) (-793.351) (-795.009) * [-795.686] (-793.627) (-794.619) (-793.744) -- 0:00:32
453000 -- (-794.788) (-791.600) [-792.406] (-794.032) * [-793.850] (-793.906) (-796.095) (-792.594) -- 0:00:32
453500 -- (-793.802) (-792.778) (-792.064) [-792.118] * [-792.698] (-794.107) (-793.954) (-792.645) -- 0:00:32
454000 -- (-795.666) [-795.724] (-793.212) (-791.864) * (-792.741) [-793.047] (-792.283) (-791.955) -- 0:00:32
454500 -- (-794.566) [-793.531] (-792.254) (-791.870) * (-793.861) (-793.946) (-792.302) [-794.954] -- 0:00:32
455000 -- [-793.625] (-795.233) (-791.267) (-794.038) * (-793.048) (-793.246) (-792.699) [-791.788] -- 0:00:32
Average standard deviation of split frequencies: 0.012599
455500 -- (-795.620) [-792.191] (-793.373) (-794.705) * (-794.702) (-793.448) [-791.675] (-793.436) -- 0:00:33
456000 -- (-795.196) (-791.885) (-793.017) [-792.643] * [-793.747] (-793.595) (-791.761) (-795.509) -- 0:00:33
456500 -- (-791.961) [-794.827] (-792.126) (-791.767) * (-792.960) (-794.445) (-791.821) [-792.521] -- 0:00:33
457000 -- (-792.053) (-794.108) (-792.347) [-793.463] * (-793.242) [-792.339] (-792.998) (-793.623) -- 0:00:33
457500 -- (-795.179) (-793.982) (-792.358) [-794.245] * (-793.942) (-794.501) [-791.606] (-795.570) -- 0:00:33
458000 -- [-795.595] (-796.647) (-792.336) (-799.675) * (-792.297) [-793.172] (-792.340) (-792.553) -- 0:00:33
458500 -- (-797.046) [-791.840] (-795.353) (-801.102) * [-794.965] (-792.686) (-791.855) (-792.995) -- 0:00:33
459000 -- (-800.949) (-791.534) (-794.930) [-792.253] * (-793.886) [-793.414] (-793.297) (-792.508) -- 0:00:33
459500 -- (-795.344) (-797.380) [-793.828] (-792.896) * (-795.066) [-792.288] (-796.642) (-794.937) -- 0:00:32
460000 -- (-794.247) (-793.369) [-794.247] (-792.257) * (-794.348) [-794.668] (-794.055) (-794.872) -- 0:00:32
Average standard deviation of split frequencies: 0.011896
460500 -- (-793.012) [-792.905] (-794.517) (-792.070) * (-793.166) (-799.215) (-793.650) [-794.306] -- 0:00:32
461000 -- (-792.978) (-793.413) [-793.300] (-795.888) * [-794.611] (-793.791) (-795.184) (-794.391) -- 0:00:32
461500 -- (-792.339) (-796.451) [-792.439] (-792.460) * (-791.610) (-793.990) (-794.612) [-794.036] -- 0:00:32
462000 -- [-793.515] (-793.782) (-794.628) (-792.005) * [-791.907] (-794.828) (-793.368) (-795.226) -- 0:00:32
462500 -- [-794.562] (-795.359) (-792.788) (-792.028) * (-791.965) (-792.600) [-794.710] (-793.642) -- 0:00:32
463000 -- (-794.345) (-795.814) [-795.172] (-792.823) * (-792.497) (-791.676) [-797.164] (-792.338) -- 0:00:32
463500 -- (-794.112) [-794.523] (-795.571) (-794.006) * [-794.652] (-795.027) (-794.178) (-791.576) -- 0:00:32
464000 -- (-793.135) (-796.005) [-793.729] (-792.713) * [-791.898] (-792.211) (-792.544) (-793.912) -- 0:00:32
464500 -- [-793.058] (-792.544) (-792.535) (-795.028) * (-792.932) (-793.848) (-793.370) [-791.712] -- 0:00:32
465000 -- (-794.708) (-794.703) (-792.740) [-792.894] * (-798.500) [-792.621] (-792.956) (-792.566) -- 0:00:32
Average standard deviation of split frequencies: 0.012329
465500 -- (-794.382) (-792.544) [-792.665] (-795.357) * [-792.792] (-792.079) (-793.715) (-792.718) -- 0:00:32
466000 -- (-792.213) (-792.427) (-798.302) [-793.065] * (-793.874) (-794.627) (-794.321) [-794.509] -- 0:00:32
466500 -- (-793.250) (-794.455) [-796.412] (-792.011) * [-793.977] (-793.088) (-795.849) (-793.041) -- 0:00:32
467000 -- [-793.491] (-792.510) (-796.050) (-796.248) * (-792.282) (-796.089) (-792.840) [-792.153] -- 0:00:31
467500 -- (-793.887) (-793.602) (-798.245) [-796.225] * [-792.335] (-794.611) (-793.328) (-792.631) -- 0:00:31
468000 -- (-796.959) [-793.287] (-793.874) (-800.182) * [-793.116] (-794.215) (-792.929) (-791.884) -- 0:00:31
468500 -- [-794.163] (-795.752) (-794.151) (-796.790) * (-793.454) [-795.260] (-793.304) (-793.024) -- 0:00:31
469000 -- (-791.661) [-794.889] (-792.046) (-794.236) * (-792.208) (-792.898) [-792.083] (-793.397) -- 0:00:31
469500 -- [-793.610] (-796.997) (-793.534) (-794.581) * (-793.232) (-796.666) [-792.367] (-793.301) -- 0:00:31
470000 -- (-796.634) (-794.613) [-794.117] (-792.133) * (-793.621) [-793.224] (-792.515) (-794.239) -- 0:00:31
Average standard deviation of split frequencies: 0.012520
470500 -- (-792.782) (-797.920) (-797.784) [-793.061] * (-795.917) (-792.650) (-791.724) [-794.644] -- 0:00:31
471000 -- (-794.083) (-792.759) (-796.666) [-792.522] * (-794.598) [-797.405] (-793.938) (-793.591) -- 0:00:31
471500 -- [-793.765] (-793.048) (-794.837) (-793.339) * [-793.441] (-793.760) (-791.609) (-793.826) -- 0:00:31
472000 -- [-795.020] (-794.319) (-793.444) (-793.243) * [-792.594] (-794.961) (-795.381) (-792.242) -- 0:00:32
472500 -- [-795.360] (-797.019) (-794.509) (-793.429) * [-793.835] (-794.487) (-795.183) (-794.738) -- 0:00:32
473000 -- [-793.279] (-792.521) (-794.900) (-795.097) * (-794.317) (-800.171) (-793.236) [-796.582] -- 0:00:32
473500 -- (-795.557) [-793.937] (-800.043) (-792.656) * (-795.555) (-795.724) (-791.460) [-792.463] -- 0:00:32
474000 -- [-793.793] (-791.826) (-798.059) (-791.825) * [-793.607] (-792.600) (-794.445) (-793.442) -- 0:00:32
474500 -- (-794.278) (-791.826) (-797.147) [-791.717] * (-795.685) [-792.212] (-794.538) (-797.385) -- 0:00:32
475000 -- [-795.316] (-793.438) (-793.051) (-792.869) * (-793.989) (-793.114) [-793.919] (-794.386) -- 0:00:32
Average standard deviation of split frequencies: 0.011946
475500 -- (-792.569) [-797.283] (-791.966) (-797.648) * [-796.277] (-799.768) (-794.294) (-792.203) -- 0:00:31
476000 -- (-792.774) [-793.638] (-792.056) (-792.050) * (-794.088) [-795.393] (-796.523) (-793.459) -- 0:00:31
476500 -- (-793.335) [-801.163] (-794.395) (-792.834) * (-793.231) [-794.145] (-792.815) (-794.181) -- 0:00:31
477000 -- (-794.576) (-806.821) [-792.687] (-793.581) * (-794.904) (-794.543) [-793.752] (-791.813) -- 0:00:31
477500 -- [-794.707] (-792.344) (-794.455) (-795.450) * (-794.560) [-796.914] (-798.640) (-793.715) -- 0:00:31
478000 -- [-793.281] (-791.510) (-792.830) (-794.009) * (-795.255) (-796.385) [-792.070] (-793.663) -- 0:00:31
478500 -- (-798.369) (-791.633) [-792.636] (-791.676) * (-794.321) [-791.488] (-791.771) (-793.473) -- 0:00:31
479000 -- [-797.989] (-797.874) (-796.328) (-793.019) * (-791.836) (-792.348) (-792.447) [-792.561] -- 0:00:31
479500 -- (-793.912) (-791.834) [-791.447] (-794.844) * (-796.441) (-794.456) [-793.206] (-792.968) -- 0:00:31
480000 -- [-795.771] (-794.163) (-795.969) (-791.865) * (-797.304) (-799.259) [-791.644] (-792.064) -- 0:00:31
Average standard deviation of split frequencies: 0.011638
480500 -- (-792.067) (-792.655) (-793.572) [-793.004] * (-793.547) (-792.746) [-792.290] (-796.387) -- 0:00:31
481000 -- (-794.522) (-792.118) [-793.313] (-792.271) * (-794.368) [-794.283] (-793.142) (-791.423) -- 0:00:31
481500 -- (-794.700) [-792.179] (-795.349) (-791.793) * (-796.283) [-795.329] (-793.370) (-792.627) -- 0:00:31
482000 -- (-794.706) (-794.508) [-795.568] (-795.187) * (-795.299) [-794.163] (-793.391) (-792.446) -- 0:00:31
482500 -- (-793.237) (-792.610) (-798.216) [-793.521] * [-794.861] (-794.297) (-791.742) (-798.517) -- 0:00:31
483000 -- (-792.039) [-792.388] (-792.139) (-791.958) * (-792.659) (-794.102) (-791.562) [-793.844] -- 0:00:31
483500 -- (-792.831) [-794.664] (-791.540) (-798.549) * (-793.484) [-792.643] (-792.049) (-795.266) -- 0:00:30
484000 -- (-793.235) (-794.574) [-793.758] (-797.950) * (-794.071) [-792.582] (-791.904) (-792.400) -- 0:00:30
484500 -- (-794.190) (-793.722) (-793.400) [-794.336] * (-793.033) (-794.685) [-791.785] (-792.911) -- 0:00:30
485000 -- (-793.432) (-796.025) [-791.583] (-792.926) * (-796.985) [-795.523] (-793.647) (-796.059) -- 0:00:30
Average standard deviation of split frequencies: 0.011510
485500 -- (-797.172) (-794.546) (-794.087) [-793.684] * (-793.152) (-795.298) [-794.212] (-796.481) -- 0:00:30
486000 -- (-797.069) (-797.640) [-797.242] (-793.573) * (-793.347) [-795.700] (-793.972) (-795.624) -- 0:00:30
486500 -- (-794.180) (-794.963) [-793.859] (-797.933) * (-793.630) (-792.934) (-794.082) [-794.947] -- 0:00:30
487000 -- (-793.301) (-792.859) [-792.855] (-793.165) * (-793.508) (-794.947) (-794.933) [-792.185] -- 0:00:30
487500 -- (-792.732) (-793.460) [-793.297] (-797.683) * (-792.863) (-792.024) (-796.327) [-792.888] -- 0:00:30
488000 -- (-794.092) (-793.333) (-793.876) [-791.857] * (-793.710) [-794.430] (-793.668) (-792.473) -- 0:00:30
488500 -- (-793.037) (-796.742) [-791.293] (-792.077) * (-794.606) (-791.387) [-792.775] (-793.795) -- 0:00:30
489000 -- (-793.855) [-795.090] (-791.844) (-792.391) * (-795.479) (-792.737) (-794.726) [-794.685] -- 0:00:31
489500 -- [-792.730] (-791.758) (-794.506) (-793.252) * [-792.044] (-793.991) (-795.816) (-793.161) -- 0:00:31
490000 -- (-793.226) (-792.767) (-796.278) [-793.672] * [-794.095] (-794.133) (-792.201) (-794.456) -- 0:00:31
Average standard deviation of split frequencies: 0.011081
490500 -- [-793.706] (-794.374) (-793.046) (-794.735) * [-800.635] (-794.255) (-794.395) (-801.195) -- 0:00:31
491000 -- (-798.442) (-794.765) [-795.507] (-793.707) * (-795.336) [-792.283] (-792.950) (-801.007) -- 0:00:31
491500 -- (-794.110) (-795.603) (-793.287) [-792.579] * [-792.849] (-793.028) (-794.730) (-801.210) -- 0:00:31
492000 -- (-793.843) [-792.864] (-792.791) (-797.646) * (-793.176) [-793.175] (-793.266) (-796.792) -- 0:00:30
492500 -- (-794.786) (-796.388) (-794.002) [-795.372] * [-792.661] (-793.394) (-794.083) (-795.240) -- 0:00:30
493000 -- (-796.601) (-795.688) [-793.007] (-794.073) * (-792.741) (-792.720) [-793.166] (-797.871) -- 0:00:30
493500 -- (-796.532) (-794.490) [-798.594] (-798.053) * [-792.764] (-793.631) (-793.443) (-795.002) -- 0:00:30
494000 -- (-792.696) [-793.727] (-798.775) (-792.066) * (-793.022) (-792.650) [-792.192] (-792.930) -- 0:00:30
494500 -- (-793.224) [-796.177] (-793.904) (-792.732) * (-797.402) [-791.812] (-795.106) (-793.075) -- 0:00:30
495000 -- (-796.604) (-794.971) [-793.443] (-792.992) * (-792.402) (-791.534) [-795.168] (-795.232) -- 0:00:30
Average standard deviation of split frequencies: 0.010835
495500 -- (-795.446) (-792.569) (-794.537) [-793.320] * (-794.803) (-793.082) (-792.101) [-794.098] -- 0:00:30
496000 -- (-795.516) [-793.493] (-791.746) (-793.813) * (-793.314) [-794.903] (-793.406) (-793.137) -- 0:00:30
496500 -- [-795.511] (-793.325) (-792.828) (-792.416) * [-794.766] (-793.180) (-795.156) (-793.057) -- 0:00:30
497000 -- (-791.723) [-792.183] (-793.216) (-792.168) * [-793.570] (-795.559) (-795.596) (-794.766) -- 0:00:30
497500 -- (-794.316) (-792.254) [-796.132] (-791.872) * [-794.640] (-793.010) (-799.451) (-795.496) -- 0:00:30
498000 -- (-794.515) (-793.055) (-792.869) [-791.930] * [-793.611] (-792.409) (-796.975) (-794.690) -- 0:00:30
498500 -- (-793.786) (-791.675) (-793.532) [-794.711] * (-792.953) [-792.996] (-797.456) (-792.103) -- 0:00:30
499000 -- (-795.325) (-792.668) (-792.909) [-791.617] * (-793.792) [-792.293] (-792.309) (-792.586) -- 0:00:30
499500 -- (-793.518) [-792.891] (-792.161) (-791.868) * (-791.430) (-792.058) (-793.706) [-793.148] -- 0:00:30
500000 -- (-792.013) (-792.875) (-792.224) [-794.220] * (-794.782) [-793.579] (-797.285) (-796.262) -- 0:00:30
Average standard deviation of split frequencies: 0.011048
500500 -- (-793.965) (-792.248) [-794.445] (-792.860) * (-791.369) (-794.503) [-792.000] (-792.716) -- 0:00:29
501000 -- (-796.984) (-797.073) [-794.864] (-791.485) * (-792.777) [-794.876] (-792.390) (-793.439) -- 0:00:29
501500 -- (-794.648) (-792.388) (-796.740) [-792.255] * (-795.814) (-796.853) [-791.518] (-796.123) -- 0:00:29
502000 -- (-797.346) (-795.132) [-795.778] (-794.396) * (-793.683) (-792.187) [-792.060] (-793.002) -- 0:00:29
502500 -- (-799.093) (-792.098) (-796.115) [-793.241] * (-792.549) [-793.643] (-791.546) (-796.687) -- 0:00:29
503000 -- (-794.867) [-792.933] (-792.103) (-792.835) * (-794.509) [-792.860] (-791.550) (-800.646) -- 0:00:29
503500 -- (-792.117) (-796.754) [-793.366] (-794.781) * (-793.059) (-796.773) (-793.430) [-796.083] -- 0:00:29
504000 -- (-793.773) (-797.965) (-792.711) [-795.078] * (-792.258) (-792.320) (-794.126) [-796.325] -- 0:00:29
504500 -- (-791.825) [-796.193] (-791.966) (-794.575) * (-792.836) [-796.397] (-792.429) (-794.834) -- 0:00:29
505000 -- [-795.762] (-801.889) (-791.875) (-798.056) * (-793.289) [-793.232] (-796.640) (-793.366) -- 0:00:29
Average standard deviation of split frequencies: 0.010496
505500 -- [-793.055] (-794.070) (-791.749) (-792.974) * (-795.662) [-793.192] (-792.926) (-793.286) -- 0:00:30
506000 -- (-794.538) [-795.062] (-793.398) (-793.123) * (-792.749) (-792.601) (-791.881) [-793.882] -- 0:00:30
506500 -- (-793.814) [-792.006] (-794.100) (-793.370) * (-795.560) (-793.077) [-793.690] (-794.282) -- 0:00:30
507000 -- (-793.385) (-793.269) (-793.590) [-793.518] * (-794.575) [-797.465] (-796.428) (-792.425) -- 0:00:30
507500 -- (-791.990) [-797.534] (-794.924) (-793.813) * (-793.807) (-794.302) [-791.661] (-792.689) -- 0:00:30
508000 -- (-794.301) (-793.674) [-794.032] (-795.728) * (-798.227) (-793.233) (-795.884) [-792.548] -- 0:00:30
508500 -- (-791.942) (-795.408) (-795.945) [-798.007] * (-795.187) (-793.465) (-797.296) [-794.235] -- 0:00:29
509000 -- (-792.069) [-792.192] (-795.968) (-795.924) * (-793.369) (-794.581) [-793.215] (-793.330) -- 0:00:29
509500 -- (-793.500) [-793.662] (-793.801) (-793.388) * (-793.976) (-794.033) [-792.519] (-792.724) -- 0:00:29
510000 -- (-793.791) (-793.806) (-793.646) [-793.160] * [-793.328] (-792.953) (-798.963) (-792.545) -- 0:00:29
Average standard deviation of split frequencies: 0.010154
510500 -- (-792.818) [-794.747] (-793.210) (-791.531) * [-794.236] (-794.198) (-791.515) (-792.748) -- 0:00:29
511000 -- (-794.378) (-792.767) [-792.240] (-792.238) * (-792.060) [-791.453] (-792.256) (-793.418) -- 0:00:29
511500 -- [-792.883] (-793.111) (-795.230) (-797.416) * (-792.730) (-793.483) [-791.646] (-794.525) -- 0:00:29
512000 -- (-792.359) (-796.040) [-792.872] (-793.455) * (-792.703) (-794.450) (-795.374) [-794.697] -- 0:00:29
512500 -- [-793.584] (-792.947) (-795.434) (-793.888) * (-793.805) (-791.419) (-794.071) [-795.039] -- 0:00:29
513000 -- [-794.086] (-795.097) (-793.869) (-793.043) * (-793.019) (-791.877) [-793.102] (-792.765) -- 0:00:29
513500 -- [-793.365] (-795.502) (-794.056) (-793.584) * [-792.554] (-791.714) (-796.034) (-792.540) -- 0:00:29
514000 -- (-794.656) (-793.378) [-794.272] (-796.938) * (-792.105) (-791.603) (-793.589) [-795.560] -- 0:00:29
514500 -- [-792.073] (-797.274) (-795.196) (-795.118) * [-794.191] (-792.447) (-793.218) (-793.571) -- 0:00:29
515000 -- (-792.390) [-793.359] (-795.177) (-793.504) * (-795.362) (-791.887) [-794.468] (-792.407) -- 0:00:29
Average standard deviation of split frequencies: 0.009928
515500 -- (-792.468) [-795.304] (-794.428) (-793.192) * [-794.494] (-797.357) (-794.281) (-794.505) -- 0:00:29
516000 -- [-792.497] (-797.296) (-793.908) (-793.520) * (-797.475) (-795.117) [-793.135] (-799.828) -- 0:00:29
516500 -- [-794.680] (-792.976) (-792.670) (-793.213) * (-796.191) (-797.504) (-791.890) [-794.459] -- 0:00:29
517000 -- (-794.348) (-792.241) (-794.416) [-794.290] * (-794.663) [-794.704] (-793.846) (-793.322) -- 0:00:28
517500 -- [-794.016] (-793.975) (-792.420) (-794.760) * (-792.528) (-794.024) [-792.091] (-791.514) -- 0:00:28
518000 -- [-794.716] (-793.199) (-794.946) (-792.680) * (-791.335) [-795.278] (-792.693) (-795.314) -- 0:00:28
518500 -- (-791.791) (-794.065) (-794.040) [-799.077] * [-792.073] (-792.663) (-796.260) (-792.064) -- 0:00:28
519000 -- (-793.487) (-792.695) (-792.253) [-791.998] * (-792.892) (-793.302) [-793.244] (-795.730) -- 0:00:28
519500 -- (-794.578) (-792.566) (-796.773) [-799.078] * (-794.677) (-793.840) (-793.459) [-794.013] -- 0:00:28
520000 -- (-798.286) (-802.091) [-794.614] (-794.550) * (-795.819) (-795.448) [-795.023] (-793.294) -- 0:00:28
Average standard deviation of split frequencies: 0.009899
520500 -- (-792.228) (-801.701) (-796.612) [-796.019] * (-794.023) (-797.581) [-793.900] (-794.125) -- 0:00:28
521000 -- (-792.734) (-792.904) [-793.441] (-792.326) * (-794.596) (-795.065) (-793.055) [-793.277] -- 0:00:28
521500 -- (-794.711) [-794.866] (-792.407) (-793.519) * (-794.615) (-794.727) [-794.621] (-793.483) -- 0:00:28
522000 -- (-794.772) [-792.545] (-795.805) (-794.972) * (-792.826) (-795.210) (-792.374) [-791.752] -- 0:00:28
522500 -- (-792.797) (-795.639) [-794.108] (-796.101) * (-794.741) [-791.451] (-792.999) (-793.083) -- 0:00:29
523000 -- (-793.453) [-793.726] (-794.670) (-792.280) * (-794.183) (-791.515) [-792.441] (-793.101) -- 0:00:29
523500 -- (-794.288) [-792.738] (-793.798) (-794.715) * [-793.483] (-795.064) (-792.172) (-794.118) -- 0:00:29
524000 -- (-796.071) (-792.920) [-792.646] (-793.085) * (-795.386) (-793.877) [-792.378] (-793.362) -- 0:00:29
524500 -- [-791.679] (-793.102) (-791.569) (-793.370) * (-792.564) [-792.977] (-792.207) (-794.539) -- 0:00:29
525000 -- (-791.537) (-792.208) [-791.759] (-798.202) * (-792.025) [-794.192] (-791.647) (-793.201) -- 0:00:28
Average standard deviation of split frequencies: 0.009918
525500 -- (-792.916) (-791.710) (-794.087) [-794.668] * (-794.658) (-794.625) (-792.644) [-795.351] -- 0:00:28
526000 -- [-791.942] (-792.590) (-792.157) (-794.931) * [-792.662] (-796.426) (-792.965) (-793.522) -- 0:00:28
526500 -- (-798.231) (-795.946) [-792.157] (-794.586) * (-792.901) [-792.340] (-793.008) (-793.543) -- 0:00:28
527000 -- (-796.706) [-794.414] (-797.416) (-792.686) * [-792.482] (-795.663) (-792.279) (-798.571) -- 0:00:28
527500 -- (-796.714) [-793.666] (-796.417) (-794.291) * (-793.769) [-795.533] (-792.045) (-796.015) -- 0:00:28
528000 -- (-795.968) [-792.581] (-796.044) (-792.425) * (-793.477) (-798.123) [-794.662] (-795.137) -- 0:00:28
528500 -- (-793.877) (-793.438) (-794.320) [-792.848] * [-792.230] (-792.414) (-792.150) (-795.618) -- 0:00:28
529000 -- (-794.020) (-795.233) [-792.152] (-795.457) * [-792.780] (-792.321) (-793.174) (-793.474) -- 0:00:28
529500 -- (-796.860) [-792.025] (-793.226) (-794.876) * (-792.665) (-796.219) [-795.333] (-792.002) -- 0:00:28
530000 -- [-794.010] (-791.518) (-793.820) (-793.814) * (-793.053) (-794.673) [-793.632] (-791.605) -- 0:00:28
Average standard deviation of split frequencies: 0.009772
530500 -- (-793.759) [-793.319] (-794.032) (-796.223) * [-794.521] (-792.135) (-794.763) (-795.305) -- 0:00:28
531000 -- (-795.591) (-794.617) [-792.595] (-793.935) * (-791.820) [-791.541] (-794.084) (-797.839) -- 0:00:28
531500 -- (-793.984) [-792.354] (-793.235) (-797.689) * (-793.233) [-794.749] (-792.498) (-793.279) -- 0:00:28
532000 -- [-794.402] (-793.928) (-794.730) (-793.662) * (-795.370) (-793.457) [-797.229] (-797.212) -- 0:00:28
532500 -- [-793.528] (-794.318) (-792.110) (-795.968) * [-791.935] (-793.408) (-793.848) (-793.705) -- 0:00:28
533000 -- [-793.891] (-794.564) (-794.358) (-794.377) * (-795.116) (-793.195) (-793.328) [-792.425] -- 0:00:28
533500 -- (-793.099) (-791.659) (-795.567) [-794.770] * (-791.863) (-798.036) [-794.817] (-795.284) -- 0:00:27
534000 -- [-793.390] (-792.331) (-792.852) (-797.237) * [-792.689] (-792.666) (-793.549) (-794.443) -- 0:00:27
534500 -- [-794.853] (-793.264) (-792.202) (-796.837) * [-793.336] (-795.153) (-792.884) (-796.009) -- 0:00:27
535000 -- (-795.009) [-793.321] (-793.592) (-794.181) * (-796.729) [-791.960] (-792.258) (-794.983) -- 0:00:27
Average standard deviation of split frequencies: 0.009029
535500 -- (-795.010) (-797.631) (-795.297) [-791.829] * [-792.144] (-795.159) (-791.900) (-794.674) -- 0:00:27
536000 -- (-793.856) [-791.976] (-793.079) (-795.956) * (-796.584) (-798.064) (-793.788) [-794.418] -- 0:00:27
536500 -- [-798.221] (-793.242) (-799.766) (-795.283) * (-796.629) (-796.858) (-792.905) [-795.483] -- 0:00:27
537000 -- (-796.263) [-791.816] (-793.544) (-793.336) * (-794.978) [-793.328] (-797.606) (-793.499) -- 0:00:27
537500 -- (-796.785) [-794.896] (-794.645) (-792.847) * (-796.718) (-794.045) [-796.578] (-793.510) -- 0:00:27
538000 -- (-793.306) (-792.227) [-795.187] (-792.323) * (-797.907) (-793.667) [-793.925] (-792.435) -- 0:00:27
538500 -- (-794.934) (-792.767) (-793.319) [-793.289] * [-798.223] (-791.836) (-797.754) (-792.601) -- 0:00:27
539000 -- (-793.659) (-795.447) [-793.277] (-794.481) * [-792.199] (-793.203) (-795.254) (-793.201) -- 0:00:28
539500 -- (-793.711) [-793.828] (-794.521) (-794.058) * (-794.901) (-796.916) (-793.224) [-793.933] -- 0:00:28
540000 -- (-793.652) (-793.695) (-794.537) [-794.278] * (-796.927) (-792.905) (-792.961) [-795.983] -- 0:00:28
Average standard deviation of split frequencies: 0.008428
540500 -- [-797.604] (-791.829) (-794.868) (-794.051) * (-795.912) (-793.842) (-794.460) [-795.216] -- 0:00:28
541000 -- [-796.572] (-796.084) (-793.258) (-794.598) * (-796.919) [-794.884] (-795.867) (-796.332) -- 0:00:27
541500 -- (-797.354) (-798.175) [-792.369] (-792.254) * [-794.492] (-793.953) (-793.474) (-791.432) -- 0:00:27
542000 -- (-793.277) (-793.679) [-796.111] (-793.335) * [-793.439] (-795.601) (-792.633) (-793.109) -- 0:00:27
542500 -- (-793.113) (-793.800) [-795.709] (-799.602) * (-798.443) (-794.519) [-791.860] (-792.856) -- 0:00:27
543000 -- [-793.274] (-793.412) (-797.551) (-792.344) * (-801.080) (-795.356) (-795.368) [-794.617] -- 0:00:27
543500 -- (-797.602) (-792.673) (-792.246) [-792.972] * [-795.732] (-793.560) (-793.735) (-792.181) -- 0:00:27
544000 -- (-797.693) (-794.682) (-795.533) [-793.754] * [-794.668] (-796.244) (-797.488) (-793.300) -- 0:00:27
544500 -- (-795.240) (-792.972) [-798.097] (-796.573) * (-795.209) (-793.265) [-794.610] (-797.651) -- 0:00:27
545000 -- (-792.215) (-793.125) (-793.810) [-794.106] * (-793.158) (-794.523) [-792.955] (-793.571) -- 0:00:27
Average standard deviation of split frequencies: 0.008864
545500 -- [-797.160] (-792.184) (-794.999) (-792.559) * (-795.010) (-792.626) [-792.980] (-793.922) -- 0:00:27
546000 -- (-800.043) (-795.444) [-792.934] (-792.317) * (-793.106) [-794.604] (-792.852) (-793.425) -- 0:00:27
546500 -- (-795.845) (-791.313) (-797.144) [-791.720] * [-793.433] (-794.096) (-793.329) (-791.862) -- 0:00:27
547000 -- [-792.406] (-791.321) (-797.536) (-793.488) * (-793.059) (-795.204) (-794.959) [-793.490] -- 0:00:27
547500 -- (-793.345) [-794.064] (-797.612) (-796.180) * (-796.562) [-793.313] (-794.846) (-793.384) -- 0:00:27
548000 -- [-792.483] (-794.823) (-794.328) (-792.874) * (-792.586) (-795.698) [-792.684] (-795.463) -- 0:00:27
548500 -- (-793.648) (-796.721) [-794.721] (-792.181) * (-792.449) (-795.493) [-794.298] (-800.397) -- 0:00:27
549000 -- (-793.306) (-793.237) (-795.462) [-792.295] * (-792.177) (-795.174) [-794.153] (-803.873) -- 0:00:27
549500 -- (-792.481) [-791.888] (-792.926) (-793.601) * (-792.717) (-791.721) [-797.024] (-794.422) -- 0:00:27
550000 -- (-793.262) (-794.684) [-793.776] (-795.527) * (-794.592) (-793.281) (-794.676) [-795.368] -- 0:00:27
Average standard deviation of split frequencies: 0.009417
550500 -- (-794.354) [-794.596] (-793.367) (-791.911) * (-793.878) (-794.095) (-795.438) [-793.533] -- 0:00:26
551000 -- (-794.721) (-793.805) [-794.836] (-793.128) * (-795.713) (-792.090) [-793.171] (-793.886) -- 0:00:26
551500 -- (-795.049) (-792.158) [-795.135] (-792.640) * (-795.807) (-792.663) [-795.255] (-793.895) -- 0:00:26
552000 -- (-793.144) [-793.285] (-794.502) (-792.990) * [-795.679] (-793.597) (-792.580) (-794.349) -- 0:00:26
552500 -- (-793.984) (-795.203) [-795.603] (-796.514) * (-794.911) [-793.184] (-791.712) (-796.916) -- 0:00:26
553000 -- (-793.842) [-793.453] (-794.384) (-792.551) * (-795.210) (-796.308) [-791.743] (-794.606) -- 0:00:26
553500 -- (-793.543) (-793.164) (-795.844) [-791.626] * (-793.396) (-793.770) (-792.629) [-792.888] -- 0:00:26
554000 -- (-792.193) [-792.636] (-792.212) (-794.522) * (-792.725) (-793.916) (-797.558) [-793.815] -- 0:00:26
554500 -- (-796.531) (-793.358) (-794.636) [-792.101] * (-791.907) [-792.553] (-795.045) (-791.728) -- 0:00:26
555000 -- (-795.309) [-794.120] (-795.024) (-795.265) * [-792.644] (-794.911) (-794.847) (-794.148) -- 0:00:26
Average standard deviation of split frequencies: 0.009496
555500 -- [-792.853] (-794.713) (-797.982) (-797.823) * (-798.214) (-795.737) (-795.214) [-793.740] -- 0:00:26
556000 -- (-792.466) [-792.476] (-793.024) (-796.095) * (-794.867) (-795.170) (-793.843) [-794.048] -- 0:00:27
556500 -- (-794.538) [-792.512] (-793.232) (-792.869) * (-796.588) (-795.290) [-793.010] (-793.176) -- 0:00:27
557000 -- [-794.150] (-796.365) (-793.141) (-792.289) * (-795.869) [-792.350] (-795.062) (-794.626) -- 0:00:27
557500 -- (-792.452) [-796.012] (-795.975) (-794.089) * (-794.724) [-792.301] (-794.158) (-799.422) -- 0:00:26
558000 -- (-795.608) [-792.060] (-801.948) (-793.282) * (-793.248) [-791.893] (-793.674) (-792.654) -- 0:00:26
558500 -- (-792.213) (-792.001) (-795.575) [-793.197] * (-794.208) [-793.122] (-792.984) (-793.054) -- 0:00:26
559000 -- (-792.341) (-794.713) (-792.538) [-792.387] * (-792.656) (-796.292) (-794.762) [-792.428] -- 0:00:26
559500 -- [-792.656] (-793.087) (-792.354) (-792.860) * (-794.617) (-793.029) (-795.675) [-797.504] -- 0:00:26
560000 -- [-793.697] (-796.069) (-797.577) (-799.910) * (-792.477) [-793.053] (-796.672) (-793.310) -- 0:00:26
Average standard deviation of split frequencies: 0.009921
560500 -- [-796.345] (-797.131) (-792.924) (-795.814) * (-795.742) (-793.420) (-799.589) [-792.550] -- 0:00:26
561000 -- (-795.294) (-793.996) [-792.849] (-792.731) * (-797.905) (-792.764) [-797.090] (-794.839) -- 0:00:26
561500 -- [-797.327] (-793.157) (-791.778) (-795.369) * (-793.500) [-792.800] (-793.349) (-796.909) -- 0:00:26
562000 -- (-793.706) [-793.829] (-792.852) (-793.417) * (-796.909) (-792.219) (-794.035) [-798.382] -- 0:00:26
562500 -- (-793.329) [-793.991] (-791.904) (-796.255) * (-793.875) (-792.067) (-801.139) [-793.078] -- 0:00:26
563000 -- (-793.012) (-796.032) [-792.485] (-798.779) * (-792.552) (-793.641) [-795.970] (-795.204) -- 0:00:26
563500 -- (-793.934) [-793.691] (-792.661) (-797.190) * [-793.834] (-792.180) (-796.918) (-794.270) -- 0:00:26
564000 -- (-792.495) [-794.215] (-792.688) (-795.886) * (-795.299) (-792.953) (-794.891) [-792.354] -- 0:00:26
564500 -- (-793.116) (-793.238) (-793.000) [-794.512] * (-793.816) (-794.231) (-795.650) [-792.064] -- 0:00:26
565000 -- (-792.837) (-795.714) (-794.447) [-793.082] * (-793.062) [-794.508] (-793.321) (-792.434) -- 0:00:26
Average standard deviation of split frequencies: 0.009942
565500 -- (-792.144) (-799.725) (-795.061) [-792.582] * (-791.767) [-793.819] (-792.715) (-794.922) -- 0:00:26
566000 -- (-792.489) (-797.529) (-792.638) [-792.323] * [-794.227] (-794.680) (-792.573) (-797.878) -- 0:00:26
566500 -- (-794.230) [-795.775] (-793.758) (-792.623) * (-796.203) (-792.757) (-798.297) [-796.852] -- 0:00:26
567000 -- [-792.315] (-794.232) (-792.033) (-796.429) * (-795.549) (-791.975) [-799.167] (-794.227) -- 0:00:25
567500 -- (-793.144) (-794.962) (-797.071) [-794.068] * (-795.323) (-792.236) [-794.036] (-793.895) -- 0:00:25
568000 -- (-791.783) (-793.463) (-794.669) [-791.976] * (-798.951) (-795.457) (-792.190) [-795.248] -- 0:00:25
568500 -- [-791.756] (-793.137) (-792.376) (-792.198) * (-793.363) (-792.488) (-791.906) [-793.723] -- 0:00:25
569000 -- (-793.601) (-794.766) (-795.495) [-793.183] * (-793.714) [-792.475] (-791.939) (-793.263) -- 0:00:25
569500 -- (-793.823) (-791.459) (-795.987) [-792.532] * (-794.741) [-791.876] (-792.029) (-794.283) -- 0:00:25
570000 -- (-791.637) [-793.658] (-792.641) (-792.556) * (-796.338) (-795.642) (-791.427) [-792.406] -- 0:00:25
Average standard deviation of split frequencies: 0.010119
570500 -- [-792.812] (-794.843) (-792.975) (-793.771) * (-799.991) (-795.565) (-792.234) [-793.353] -- 0:00:25
571000 -- (-797.558) (-792.816) [-794.319] (-793.437) * [-798.772] (-795.683) (-795.537) (-794.591) -- 0:00:25
571500 -- [-797.954] (-794.896) (-791.857) (-793.763) * [-801.076] (-795.931) (-792.488) (-793.801) -- 0:00:25
572000 -- (-792.439) [-792.231] (-799.055) (-792.400) * (-795.814) [-791.411] (-794.338) (-791.645) -- 0:00:25
572500 -- (-792.424) (-800.314) (-795.973) [-794.136] * (-793.288) [-794.585] (-800.083) (-792.041) -- 0:00:26
573000 -- (-792.479) (-799.039) (-797.284) [-793.023] * [-793.954] (-792.990) (-798.116) (-793.833) -- 0:00:26
573500 -- (-794.452) (-800.306) (-801.352) [-794.094] * (-793.251) (-795.014) [-794.333] (-794.452) -- 0:00:26
574000 -- (-798.967) (-798.645) [-796.248] (-795.678) * [-792.791] (-793.925) (-795.453) (-795.329) -- 0:00:25
574500 -- (-795.307) (-798.682) (-791.897) [-794.526] * (-795.980) [-794.750] (-793.574) (-792.851) -- 0:00:25
575000 -- (-794.953) (-792.907) (-794.193) [-791.839] * (-805.292) (-794.576) [-792.832] (-797.282) -- 0:00:25
Average standard deviation of split frequencies: 0.010384
575500 -- (-793.337) (-794.621) [-793.893] (-792.698) * (-796.528) [-794.852] (-795.704) (-796.220) -- 0:00:25
576000 -- [-793.838] (-795.435) (-795.970) (-794.242) * (-796.187) (-795.062) [-797.610] (-795.874) -- 0:00:25
576500 -- (-794.367) (-794.253) [-793.563] (-795.719) * (-793.548) (-792.867) (-798.932) [-793.023] -- 0:00:25
577000 -- [-793.579] (-793.779) (-794.822) (-793.750) * (-793.333) (-791.989) [-796.275] (-791.957) -- 0:00:25
577500 -- [-793.920] (-794.141) (-794.169) (-792.772) * (-794.507) (-794.961) (-793.129) [-794.694] -- 0:00:25
578000 -- (-793.731) (-801.059) (-793.477) [-796.948] * (-793.481) (-795.934) (-792.762) [-793.307] -- 0:00:25
578500 -- (-792.950) (-793.390) [-791.308] (-794.162) * (-794.508) (-793.113) [-793.937] (-792.420) -- 0:00:25
579000 -- (-795.345) (-798.068) (-794.088) [-794.162] * [-792.269] (-792.739) (-794.614) (-793.238) -- 0:00:25
579500 -- (-793.157) (-793.513) [-791.674] (-792.335) * [-792.885] (-792.110) (-796.530) (-792.986) -- 0:00:25
580000 -- (-791.806) [-793.583] (-794.345) (-793.768) * (-794.264) (-791.969) (-792.799) [-793.674] -- 0:00:25
Average standard deviation of split frequencies: 0.010605
580500 -- [-792.909] (-793.863) (-794.462) (-793.527) * (-798.329) (-792.888) (-793.087) [-793.061] -- 0:00:25
581000 -- [-793.095] (-794.446) (-791.818) (-794.491) * [-792.443] (-794.828) (-797.296) (-792.732) -- 0:00:25
581500 -- (-794.866) (-796.431) (-795.159) [-796.510] * (-794.061) [-794.113] (-792.131) (-795.222) -- 0:00:25
582000 -- (-795.007) (-796.000) (-795.725) [-792.785] * (-794.565) (-794.184) [-791.747] (-791.696) -- 0:00:25
582500 -- (-792.625) (-793.942) [-792.321] (-795.137) * (-794.117) (-792.698) [-791.930] (-793.516) -- 0:00:25
583000 -- (-794.074) (-793.947) [-793.458] (-798.968) * (-794.881) (-792.444) [-795.168] (-794.648) -- 0:00:25
583500 -- (-793.638) (-794.807) (-792.767) [-797.218] * (-796.562) [-795.169] (-793.094) (-794.950) -- 0:00:24
584000 -- (-793.966) (-791.606) (-791.866) [-794.425] * [-794.922] (-794.796) (-791.939) (-796.743) -- 0:00:24
584500 -- (-793.722) (-791.647) (-796.697) [-793.804] * [-794.574] (-791.716) (-792.362) (-793.020) -- 0:00:24
585000 -- (-792.697) (-793.822) (-794.617) [-793.536] * (-797.101) (-791.886) [-794.291] (-795.514) -- 0:00:24
Average standard deviation of split frequencies: 0.010005
585500 -- (-793.545) (-795.830) (-794.964) [-793.506] * [-794.387] (-792.993) (-800.005) (-794.140) -- 0:00:24
586000 -- (-792.479) [-797.523] (-792.336) (-792.267) * (-792.472) [-793.164] (-794.085) (-796.314) -- 0:00:24
586500 -- (-796.726) [-794.320] (-796.684) (-792.178) * (-794.199) (-792.909) [-796.463] (-796.481) -- 0:00:24
587000 -- (-792.548) (-792.964) (-793.875) [-792.151] * (-795.149) (-792.984) (-797.945) [-793.981] -- 0:00:24
587500 -- (-794.616) (-792.401) [-791.851] (-794.510) * (-792.531) (-793.251) [-794.113] (-796.503) -- 0:00:24
588000 -- (-794.238) (-792.842) [-793.805] (-797.018) * [-791.629] (-792.246) (-795.044) (-797.333) -- 0:00:24
588500 -- (-792.623) (-799.248) [-793.887] (-792.764) * (-792.729) (-798.632) [-791.785] (-796.642) -- 0:00:24
589000 -- (-793.355) [-793.633] (-794.954) (-794.860) * (-794.702) (-793.764) [-794.232] (-795.933) -- 0:00:24
589500 -- [-795.093] (-794.048) (-794.028) (-793.757) * (-794.403) [-794.761] (-791.461) (-791.787) -- 0:00:25
590000 -- (-792.225) (-795.055) [-792.972] (-801.517) * (-791.977) (-795.032) [-791.487] (-792.856) -- 0:00:25
Average standard deviation of split frequencies: 0.009876
590500 -- (-796.112) (-793.665) (-792.820) [-792.616] * [-791.695] (-794.035) (-792.349) (-797.486) -- 0:00:24
591000 -- [-792.171] (-796.307) (-793.088) (-795.976) * (-793.324) (-793.618) (-792.534) [-791.811] -- 0:00:24
591500 -- (-792.681) (-792.924) (-793.740) [-792.995] * (-792.981) [-791.831] (-793.085) (-794.012) -- 0:00:24
592000 -- (-792.944) (-794.150) [-793.730] (-796.379) * (-795.164) (-791.400) [-793.384] (-797.851) -- 0:00:24
592500 -- [-794.091] (-792.388) (-793.308) (-795.220) * (-796.623) (-791.758) (-792.567) [-791.375] -- 0:00:24
593000 -- [-792.885] (-794.183) (-793.899) (-794.612) * (-792.110) (-794.473) (-793.572) [-792.343] -- 0:00:24
593500 -- [-791.781] (-794.260) (-792.852) (-796.316) * [-792.765] (-792.586) (-795.024) (-793.006) -- 0:00:24
594000 -- (-792.407) (-793.955) (-795.560) [-797.111] * (-792.722) [-792.586] (-795.405) (-794.290) -- 0:00:24
594500 -- [-792.245] (-796.207) (-793.803) (-798.482) * (-793.036) (-794.152) [-793.446] (-791.467) -- 0:00:24
595000 -- (-797.565) (-794.134) [-795.037] (-795.882) * (-791.529) (-793.661) [-792.074] (-792.615) -- 0:00:24
Average standard deviation of split frequencies: 0.009689
595500 -- (-794.193) (-795.650) [-792.005] (-797.763) * (-795.237) (-791.956) [-795.281] (-794.866) -- 0:00:24
596000 -- [-791.959] (-792.439) (-796.557) (-794.263) * (-798.016) (-794.467) [-791.860] (-794.031) -- 0:00:24
596500 -- [-792.153] (-794.838) (-794.836) (-792.745) * (-797.518) (-795.370) [-791.836] (-795.038) -- 0:00:24
597000 -- (-793.962) (-792.902) [-793.023] (-793.056) * [-794.286] (-793.751) (-792.715) (-795.567) -- 0:00:24
597500 -- [-793.109] (-793.525) (-792.214) (-795.679) * (-793.276) [-792.224] (-793.118) (-792.289) -- 0:00:24
598000 -- [-791.933] (-796.855) (-794.313) (-793.762) * (-795.112) [-794.677] (-792.784) (-792.364) -- 0:00:24
598500 -- [-792.266] (-796.764) (-795.772) (-793.711) * (-793.479) (-792.945) (-792.095) [-794.986] -- 0:00:24
599000 -- (-794.591) (-797.145) (-794.799) [-793.371] * (-793.298) [-794.070] (-795.201) (-794.042) -- 0:00:24
599500 -- [-793.884] (-793.698) (-793.547) (-792.874) * (-793.716) (-794.993) [-792.386] (-793.728) -- 0:00:24
600000 -- (-794.657) [-791.804] (-796.981) (-795.703) * (-793.617) [-797.315] (-793.729) (-793.807) -- 0:00:24
Average standard deviation of split frequencies: 0.009810
600500 -- (-792.223) (-798.234) [-796.077] (-795.392) * (-793.844) (-794.875) [-793.271] (-791.587) -- 0:00:23
601000 -- (-792.827) (-798.352) (-794.255) [-793.141] * [-793.080] (-798.734) (-792.126) (-795.023) -- 0:00:23
601500 -- (-794.016) (-791.722) (-793.623) [-793.422] * (-795.939) [-792.479] (-792.536) (-794.354) -- 0:00:23
602000 -- (-793.172) [-794.096] (-793.125) (-796.130) * (-791.713) [-793.021] (-794.218) (-793.366) -- 0:00:23
602500 -- [-798.334] (-792.989) (-792.694) (-797.820) * (-793.328) [-792.453] (-795.304) (-796.297) -- 0:00:23
603000 -- [-792.774] (-794.680) (-792.545) (-793.741) * [-792.281] (-792.684) (-791.556) (-792.275) -- 0:00:23
603500 -- (-794.084) (-792.947) (-793.016) [-792.160] * (-792.204) [-793.097] (-791.848) (-792.312) -- 0:00:23
604000 -- [-794.641] (-794.732) (-794.231) (-792.379) * (-792.061) (-792.775) [-793.720] (-794.271) -- 0:00:23
604500 -- (-793.787) [-795.152] (-794.428) (-793.381) * (-794.106) (-791.849) (-792.591) [-792.285] -- 0:00:23
605000 -- (-796.925) (-792.743) [-794.010] (-794.989) * (-792.903) (-791.798) (-793.643) [-793.357] -- 0:00:23
Average standard deviation of split frequencies: 0.009432
605500 -- (-794.610) (-792.469) (-794.469) [-797.394] * (-794.797) (-791.581) [-795.065] (-794.516) -- 0:00:23
606000 -- (-795.151) [-793.156] (-792.772) (-792.696) * (-794.262) (-795.815) (-796.492) [-792.220] -- 0:00:24
606500 -- [-792.319] (-797.382) (-794.887) (-793.150) * [-795.986] (-795.764) (-798.619) (-792.059) -- 0:00:24
607000 -- (-794.742) (-792.669) [-794.338] (-795.153) * [-792.298] (-794.741) (-798.201) (-795.615) -- 0:00:23
607500 -- [-795.729] (-794.056) (-793.695) (-800.886) * (-794.909) (-793.800) [-796.953] (-794.259) -- 0:00:23
608000 -- [-794.893] (-793.989) (-793.382) (-793.987) * (-796.655) [-799.582] (-792.640) (-797.311) -- 0:00:23
608500 -- [-793.521] (-794.666) (-793.462) (-792.919) * (-795.297) (-793.395) (-795.970) [-792.767] -- 0:00:23
609000 -- (-794.721) (-793.562) [-792.047] (-793.959) * (-792.081) (-794.594) (-794.241) [-793.585] -- 0:00:23
609500 -- (-794.781) (-793.001) [-792.871] (-795.155) * (-792.080) (-794.736) [-793.855] (-793.003) -- 0:00:23
610000 -- (-793.059) (-793.540) (-793.337) [-793.222] * (-797.351) (-793.990) (-796.400) [-793.216] -- 0:00:23
Average standard deviation of split frequencies: 0.009263
610500 -- (-792.082) [-793.175] (-794.697) (-797.037) * (-793.396) (-794.815) [-791.795] (-794.135) -- 0:00:23
611000 -- (-797.172) (-794.809) [-795.420] (-799.683) * (-794.365) [-793.197] (-793.383) (-792.671) -- 0:00:23
611500 -- (-796.466) (-794.453) (-795.630) [-798.938] * (-794.439) (-792.625) (-793.028) [-794.008] -- 0:00:23
612000 -- (-796.536) (-796.206) [-793.349] (-797.288) * (-796.040) (-793.685) (-793.609) [-793.535] -- 0:00:23
612500 -- [-792.929] (-796.229) (-792.210) (-795.188) * (-794.097) [-793.027] (-793.594) (-794.800) -- 0:00:23
613000 -- (-793.975) (-793.058) [-793.298] (-797.453) * (-796.144) [-793.828] (-793.404) (-795.113) -- 0:00:23
613500 -- [-792.122] (-795.855) (-792.802) (-798.496) * [-792.275] (-792.983) (-793.564) (-796.099) -- 0:00:23
614000 -- (-793.838) (-795.005) [-792.663] (-795.552) * (-797.300) [-792.831] (-793.969) (-793.214) -- 0:00:23
614500 -- [-793.872] (-794.008) (-792.945) (-794.264) * [-792.283] (-794.032) (-796.564) (-791.810) -- 0:00:23
615000 -- (-792.270) (-793.671) [-794.411] (-794.847) * (-793.861) [-794.608] (-796.089) (-793.768) -- 0:00:23
Average standard deviation of split frequencies: 0.009375
615500 -- (-791.934) (-797.569) [-795.058] (-791.693) * [-792.763] (-794.071) (-796.726) (-792.637) -- 0:00:23
616000 -- (-792.530) [-792.098] (-795.030) (-792.613) * (-791.730) (-792.534) [-793.111] (-794.136) -- 0:00:23
616500 -- (-793.624) (-795.285) (-796.130) [-795.307] * (-795.225) [-793.121] (-792.579) (-793.883) -- 0:00:23
617000 -- (-793.799) (-791.716) [-792.181] (-793.835) * (-792.960) [-792.767] (-794.643) (-795.831) -- 0:00:22
617500 -- (-795.278) (-794.730) [-792.749] (-794.940) * (-797.285) [-793.302] (-796.754) (-793.508) -- 0:00:22
618000 -- (-793.256) (-795.088) (-796.756) [-799.175] * (-793.508) (-793.995) [-794.529] (-796.636) -- 0:00:22
618500 -- [-792.941] (-797.013) (-792.977) (-793.435) * (-792.261) (-793.074) (-792.504) [-802.680] -- 0:00:22
619000 -- (-804.952) (-795.857) [-793.443] (-793.427) * [-792.276] (-796.042) (-792.614) (-801.999) -- 0:00:22
619500 -- (-793.455) (-793.565) [-792.876] (-794.306) * [-793.520] (-794.152) (-793.329) (-798.597) -- 0:00:22
620000 -- (-796.063) [-792.775] (-793.954) (-793.588) * (-802.399) (-794.000) (-792.688) [-793.427] -- 0:00:22
Average standard deviation of split frequencies: 0.009019
620500 -- [-792.726] (-793.807) (-792.864) (-792.830) * [-798.098] (-797.699) (-794.307) (-794.216) -- 0:00:22
621000 -- (-799.299) (-792.324) (-793.085) [-792.382] * (-792.657) [-795.185] (-793.145) (-791.400) -- 0:00:22
621500 -- (-797.650) (-794.100) (-792.619) [-793.995] * (-793.740) [-795.997] (-793.152) (-793.965) -- 0:00:22
622000 -- (-795.460) (-793.989) (-795.679) [-795.252] * (-793.006) [-792.476] (-795.594) (-794.696) -- 0:00:22
622500 -- (-791.828) (-792.678) [-792.455] (-793.138) * (-791.702) (-792.213) (-795.194) [-793.242] -- 0:00:23
623000 -- [-793.816] (-797.444) (-793.277) (-792.508) * (-793.213) (-791.778) [-793.967] (-794.684) -- 0:00:22
623500 -- [-794.492] (-797.286) (-795.785) (-791.325) * (-792.995) [-793.471] (-792.891) (-793.725) -- 0:00:22
624000 -- (-796.473) (-796.246) [-793.020] (-791.452) * (-793.617) (-799.374) [-793.576] (-792.245) -- 0:00:22
624500 -- [-792.404] (-792.962) (-795.239) (-793.657) * (-796.189) (-797.894) (-793.219) [-791.933] -- 0:00:22
625000 -- (-796.656) (-793.998) (-792.471) [-794.997] * (-793.136) [-793.574] (-795.700) (-792.717) -- 0:00:22
Average standard deviation of split frequencies: 0.008566
625500 -- (-795.054) (-795.632) (-793.526) [-792.900] * (-793.461) (-791.761) (-798.076) [-791.553] -- 0:00:22
626000 -- (-792.588) (-797.282) (-793.920) [-792.001] * (-792.053) (-794.476) (-797.474) [-792.480] -- 0:00:22
626500 -- (-792.531) [-797.152] (-794.122) (-792.216) * (-795.563) (-791.917) [-793.218] (-794.199) -- 0:00:22
627000 -- (-798.529) (-792.114) [-794.270] (-791.514) * [-797.222] (-792.384) (-793.709) (-797.176) -- 0:00:22
627500 -- (-791.909) (-793.399) (-794.178) [-793.605] * (-795.473) [-795.187] (-794.438) (-796.886) -- 0:00:22
628000 -- (-796.915) (-791.902) [-792.561] (-792.312) * [-794.542] (-792.775) (-793.743) (-794.724) -- 0:00:22
628500 -- (-793.659) (-795.448) (-796.171) [-795.520] * (-795.368) [-794.128] (-793.923) (-794.993) -- 0:00:22
629000 -- [-793.925] (-796.007) (-795.008) (-794.637) * (-793.521) [-792.251] (-793.301) (-803.606) -- 0:00:22
629500 -- (-793.873) (-796.667) (-793.754) [-795.462] * (-793.217) (-793.104) [-793.328] (-793.773) -- 0:00:22
630000 -- (-792.311) [-793.138] (-797.066) (-795.961) * (-794.116) (-792.093) (-793.755) [-791.701] -- 0:00:22
Average standard deviation of split frequencies: 0.008502
630500 -- (-793.471) (-792.219) (-796.698) [-794.669] * (-795.088) (-793.059) (-799.163) [-791.559] -- 0:00:22
631000 -- (-792.471) [-792.933] (-792.590) (-793.800) * (-794.262) (-792.806) (-791.355) [-791.771] -- 0:00:22
631500 -- (-795.255) [-794.987] (-794.282) (-793.976) * (-798.655) (-793.918) [-793.514] (-792.086) -- 0:00:22
632000 -- (-793.298) (-796.166) [-794.326] (-794.788) * (-795.842) (-792.245) [-793.075] (-793.629) -- 0:00:22
632500 -- (-793.365) (-796.394) [-795.499] (-794.230) * (-795.456) (-796.152) (-793.802) [-792.226] -- 0:00:22
633000 -- (-793.078) (-795.274) (-794.913) [-792.236] * (-793.538) [-794.333] (-797.493) (-793.169) -- 0:00:22
633500 -- (-793.386) (-792.799) [-793.924] (-792.342) * (-793.349) (-795.250) (-796.216) [-792.890] -- 0:00:21
634000 -- (-792.597) [-793.842] (-793.323) (-795.764) * (-793.330) (-792.314) [-793.776] (-792.112) -- 0:00:21
634500 -- (-794.646) (-793.722) (-793.716) [-792.026] * (-795.389) (-791.659) [-795.496] (-792.259) -- 0:00:21
635000 -- (-795.448) (-793.939) (-792.119) [-793.327] * (-793.119) [-793.465] (-794.909) (-796.055) -- 0:00:21
Average standard deviation of split frequencies: 0.008385
635500 -- (-796.428) (-791.427) (-796.312) [-792.519] * (-796.684) [-793.988] (-794.300) (-793.103) -- 0:00:21
636000 -- (-797.103) (-794.505) (-794.029) [-793.426] * (-794.210) (-796.052) (-793.169) [-793.387] -- 0:00:21
636500 -- (-795.842) (-795.514) [-792.898] (-791.666) * [-793.101] (-792.519) (-792.537) (-791.805) -- 0:00:21
637000 -- (-794.622) [-791.927] (-792.969) (-794.460) * [-792.691] (-795.275) (-792.049) (-793.057) -- 0:00:21
637500 -- (-792.166) (-794.658) (-792.119) [-794.321] * (-792.550) (-792.406) [-793.257] (-795.883) -- 0:00:21
638000 -- (-792.153) (-794.807) [-794.523] (-793.904) * (-793.497) [-792.535] (-793.968) (-792.054) -- 0:00:21
638500 -- (-792.499) [-793.758] (-795.259) (-793.701) * [-794.688] (-792.864) (-795.922) (-792.718) -- 0:00:21
639000 -- (-793.059) (-792.210) (-794.371) [-793.395] * [-792.392] (-797.463) (-794.623) (-792.231) -- 0:00:21
639500 -- [-792.779] (-791.516) (-797.927) (-795.025) * (-794.015) [-792.325] (-793.565) (-791.886) -- 0:00:21
640000 -- (-792.855) [-795.194] (-793.659) (-799.109) * (-796.159) (-793.591) [-796.206] (-794.719) -- 0:00:21
Average standard deviation of split frequencies: 0.008278
640500 -- (-792.605) [-794.098] (-795.193) (-794.052) * (-794.608) (-793.652) [-792.907] (-792.829) -- 0:00:21
641000 -- [-793.227] (-793.856) (-793.196) (-792.952) * (-792.041) (-793.993) (-793.481) [-797.978] -- 0:00:21
641500 -- (-796.389) [-792.773] (-792.647) (-793.469) * (-792.353) (-792.411) [-794.364] (-793.270) -- 0:00:21
642000 -- (-795.423) [-794.722] (-791.979) (-792.862) * [-797.550] (-792.273) (-794.901) (-793.530) -- 0:00:21
642500 -- (-795.558) (-795.390) (-792.465) [-792.731] * (-791.925) (-792.871) [-792.567] (-793.518) -- 0:00:21
643000 -- (-797.401) (-793.697) [-792.779] (-793.103) * (-795.380) (-792.732) (-793.145) [-794.983] -- 0:00:21
643500 -- [-794.692] (-798.211) (-799.053) (-793.469) * (-794.669) (-796.387) [-793.705] (-795.973) -- 0:00:21
644000 -- (-794.552) [-796.457] (-792.700) (-794.504) * (-795.889) [-795.228] (-793.423) (-794.898) -- 0:00:21
644500 -- (-792.163) [-794.315] (-794.706) (-793.940) * (-796.093) (-793.536) (-798.252) [-793.782] -- 0:00:21
645000 -- [-793.627] (-791.982) (-792.558) (-791.488) * (-795.817) [-792.513] (-798.955) (-792.573) -- 0:00:21
Average standard deviation of split frequencies: 0.008209
645500 -- (-795.419) (-791.671) [-791.666] (-791.881) * (-794.640) [-791.730] (-794.760) (-794.750) -- 0:00:21
646000 -- [-798.253] (-793.557) (-791.855) (-792.005) * (-793.528) (-792.410) [-793.457] (-791.719) -- 0:00:21
646500 -- (-794.813) [-792.738] (-794.215) (-794.267) * (-794.842) [-792.720] (-793.073) (-792.830) -- 0:00:21
647000 -- (-795.299) [-792.720] (-795.480) (-796.682) * (-795.925) (-795.327) [-791.878] (-791.498) -- 0:00:21
647500 -- (-797.566) [-792.079] (-792.197) (-794.115) * (-794.486) [-795.075] (-792.924) (-797.153) -- 0:00:21
648000 -- (-796.424) (-793.835) (-792.871) [-793.651] * (-795.162) (-796.763) [-792.775] (-795.021) -- 0:00:21
648500 -- (-793.248) (-799.763) [-793.051] (-794.906) * [-793.279] (-793.481) (-793.994) (-792.471) -- 0:00:21
649000 -- (-794.237) (-793.827) [-792.624] (-794.958) * [-794.075] (-793.436) (-792.611) (-796.137) -- 0:00:21
649500 -- (-792.501) (-794.257) (-792.896) [-794.966] * (-795.957) (-793.015) [-792.970] (-795.904) -- 0:00:21
650000 -- (-798.792) (-791.640) (-792.315) [-792.026] * (-793.426) [-794.512] (-794.752) (-792.286) -- 0:00:21
Average standard deviation of split frequencies: 0.008196
650500 -- (-798.258) (-792.148) [-793.375] (-793.652) * [-792.973] (-794.775) (-793.876) (-792.926) -- 0:00:20
651000 -- (-792.790) (-792.640) (-795.077) [-795.454] * (-795.336) (-795.594) [-793.172] (-794.436) -- 0:00:20
651500 -- (-797.957) (-793.814) (-793.363) [-793.828] * (-793.520) (-794.467) [-792.449] (-800.398) -- 0:00:20
652000 -- (-798.143) [-793.738] (-793.370) (-793.367) * (-794.252) (-792.599) (-793.206) [-792.058] -- 0:00:20
652500 -- (-795.233) (-795.944) [-794.626] (-794.625) * [-793.884] (-792.913) (-794.045) (-792.448) -- 0:00:20
653000 -- (-797.062) [-798.461] (-797.150) (-794.733) * (-795.304) [-792.588] (-793.302) (-794.192) -- 0:00:20
653500 -- [-796.187] (-793.563) (-793.006) (-798.593) * (-794.514) (-794.218) (-793.613) [-796.666] -- 0:00:20
654000 -- (-797.973) [-794.409] (-795.010) (-797.628) * (-792.288) [-792.417] (-792.052) (-793.135) -- 0:00:20
654500 -- (-794.685) (-797.219) [-795.298] (-796.531) * [-793.315] (-792.465) (-792.121) (-792.527) -- 0:00:20
655000 -- [-795.647] (-796.304) (-794.354) (-797.946) * (-793.498) [-793.032] (-793.554) (-795.754) -- 0:00:20
Average standard deviation of split frequencies: 0.007228
655500 -- (-795.381) [-793.368] (-792.760) (-794.201) * (-793.883) [-793.787] (-793.449) (-795.893) -- 0:00:20
656000 -- [-794.011] (-796.837) (-797.818) (-792.626) * (-792.217) (-791.939) [-793.877] (-791.807) -- 0:00:20
656500 -- (-792.401) (-792.167) (-796.483) [-794.029] * (-792.105) (-794.530) [-793.623] (-798.125) -- 0:00:20
657000 -- (-794.313) [-792.691] (-792.274) (-795.155) * [-793.354] (-791.666) (-796.019) (-792.911) -- 0:00:20
657500 -- (-793.068) (-796.118) (-796.097) [-794.231] * [-791.621] (-792.454) (-796.834) (-792.634) -- 0:00:20
658000 -- (-795.150) (-793.628) (-794.700) [-793.012] * (-794.027) (-792.912) (-797.074) [-797.071] -- 0:00:20
658500 -- (-792.461) (-792.142) [-793.946] (-792.266) * (-793.778) (-793.644) (-796.664) [-793.687] -- 0:00:20
659000 -- (-793.600) [-793.345] (-792.247) (-792.166) * (-792.175) (-791.365) (-800.215) [-791.990] -- 0:00:20
659500 -- (-792.562) [-794.523] (-792.639) (-794.018) * (-791.947) (-791.769) [-792.859] (-792.555) -- 0:00:20
660000 -- (-792.283) [-794.686] (-796.768) (-795.695) * [-791.843] (-792.609) (-796.231) (-793.005) -- 0:00:20
Average standard deviation of split frequencies: 0.007009
660500 -- (-798.199) [-793.711] (-797.313) (-798.248) * (-793.499) [-792.959] (-793.205) (-797.651) -- 0:00:20
661000 -- [-792.229] (-792.527) (-795.701) (-796.275) * [-791.855] (-793.436) (-793.326) (-799.679) -- 0:00:20
661500 -- (-798.151) (-794.712) (-794.540) [-795.482] * [-792.558] (-795.798) (-794.896) (-793.490) -- 0:00:20
662000 -- (-793.181) [-792.710] (-793.541) (-795.513) * (-795.867) (-800.041) [-792.060] (-794.483) -- 0:00:20
662500 -- [-794.659] (-793.313) (-794.729) (-795.348) * [-796.055] (-794.552) (-794.539) (-792.823) -- 0:00:20
663000 -- (-795.173) (-793.975) [-794.846] (-796.554) * (-793.396) (-791.784) [-795.566] (-804.113) -- 0:00:20
663500 -- (-793.432) (-792.810) (-794.786) [-795.785] * [-793.232] (-792.507) (-793.317) (-795.895) -- 0:00:20
664000 -- [-794.821] (-793.612) (-795.270) (-795.180) * [-795.143] (-796.652) (-795.487) (-794.384) -- 0:00:20
664500 -- (-792.594) (-795.199) (-795.479) [-793.034] * (-793.171) (-792.929) (-796.231) [-793.720] -- 0:00:20
665000 -- (-793.536) [-795.250] (-791.886) (-795.038) * (-795.118) (-794.069) [-794.613] (-794.984) -- 0:00:20
Average standard deviation of split frequencies: 0.007245
665500 -- [-791.492] (-794.108) (-795.883) (-793.466) * [-795.903] (-794.263) (-800.878) (-793.806) -- 0:00:20
666000 -- (-794.941) (-795.215) (-796.024) [-794.045] * (-793.898) [-793.879] (-792.577) (-797.233) -- 0:00:20
666500 -- (-795.614) [-793.194] (-798.958) (-796.300) * [-792.278] (-792.504) (-793.482) (-794.883) -- 0:00:20
667000 -- (-796.552) (-798.341) [-792.767] (-795.228) * [-792.510] (-792.333) (-796.472) (-791.472) -- 0:00:19
667500 -- (-793.563) [-796.003] (-792.767) (-792.408) * (-793.692) (-794.168) [-792.945] (-797.085) -- 0:00:19
668000 -- (-792.817) (-793.135) (-794.708) [-795.454] * (-793.137) (-792.224) (-795.017) [-791.925] -- 0:00:19
668500 -- (-792.311) [-794.746] (-793.675) (-796.433) * [-792.722] (-793.404) (-793.773) (-791.689) -- 0:00:19
669000 -- [-793.741] (-793.052) (-794.676) (-794.081) * (-792.413) (-794.400) (-797.647) [-794.005] -- 0:00:19
669500 -- (-794.997) [-795.831] (-794.343) (-799.031) * [-794.237] (-794.609) (-794.197) (-795.588) -- 0:00:19
670000 -- (-791.743) [-793.709] (-796.651) (-795.827) * [-793.984] (-795.410) (-792.273) (-795.419) -- 0:00:19
Average standard deviation of split frequencies: 0.007525
670500 -- (-792.215) [-793.517] (-794.012) (-792.897) * (-794.840) (-793.955) [-793.859] (-794.874) -- 0:00:19
671000 -- (-794.793) (-795.610) [-794.948] (-794.879) * [-795.142] (-794.136) (-793.696) (-795.803) -- 0:00:19
671500 -- (-794.809) [-795.282] (-796.811) (-795.105) * (-793.725) (-797.181) (-793.888) [-794.334] -- 0:00:19
672000 -- (-792.144) [-792.207] (-796.511) (-794.879) * (-795.267) (-794.943) [-795.532] (-792.745) -- 0:00:19
672500 -- (-792.280) (-792.972) (-792.468) [-792.279] * (-795.861) (-799.155) (-794.606) [-797.489] -- 0:00:19
673000 -- (-792.662) (-791.828) [-792.697] (-798.345) * (-796.447) (-792.922) [-793.852] (-795.172) -- 0:00:19
673500 -- (-792.758) [-794.637] (-791.767) (-796.784) * (-792.284) [-792.580] (-794.110) (-794.776) -- 0:00:19
674000 -- [-792.036] (-793.084) (-792.409) (-792.470) * (-792.995) (-795.387) [-793.603] (-794.226) -- 0:00:19
674500 -- (-791.897) (-794.370) (-792.653) [-791.735] * (-792.127) (-793.041) (-792.474) [-792.917] -- 0:00:19
675000 -- [-795.467] (-798.786) (-794.830) (-792.348) * [-791.565] (-793.477) (-793.474) (-793.922) -- 0:00:19
Average standard deviation of split frequencies: 0.007548
675500 -- (-795.214) (-794.639) (-793.792) [-794.219] * (-792.641) (-791.962) [-794.510] (-793.608) -- 0:00:19
676000 -- (-793.412) (-797.524) [-792.526] (-793.736) * [-795.670] (-794.185) (-795.437) (-796.062) -- 0:00:19
676500 -- (-793.341) (-792.358) [-793.299] (-795.476) * (-795.217) (-793.119) (-794.305) [-794.564] -- 0:00:19
677000 -- (-792.518) [-792.510] (-793.957) (-794.934) * (-794.517) [-792.199] (-792.783) (-800.429) -- 0:00:19
677500 -- [-791.564] (-795.434) (-792.814) (-793.079) * [-793.439] (-793.496) (-791.783) (-792.455) -- 0:00:19
678000 -- (-791.621) (-795.959) (-792.779) [-793.792] * (-794.462) (-792.341) [-792.421] (-795.541) -- 0:00:19
678500 -- [-793.546] (-792.057) (-792.384) (-793.030) * (-794.915) (-791.982) [-792.977] (-797.585) -- 0:00:19
679000 -- (-794.965) (-792.996) (-794.573) [-791.681] * (-795.047) (-796.711) [-792.376] (-792.730) -- 0:00:19
679500 -- (-794.086) (-791.468) [-794.023] (-793.365) * (-792.899) (-792.741) (-793.989) [-795.667] -- 0:00:19
680000 -- [-791.770] (-793.887) (-792.498) (-792.989) * (-793.048) [-794.205] (-791.548) (-793.780) -- 0:00:19
Average standard deviation of split frequencies: 0.007822
680500 -- (-791.417) (-792.371) (-794.902) [-795.982] * (-793.060) [-793.220] (-791.504) (-792.791) -- 0:00:19
681000 -- (-792.383) (-792.316) (-791.291) [-792.333] * (-791.729) (-794.300) (-795.418) [-794.924] -- 0:00:19
681500 -- [-793.186] (-791.635) (-793.181) (-792.155) * [-792.152] (-792.406) (-794.313) (-795.567) -- 0:00:19
682000 -- [-792.219] (-794.719) (-794.265) (-795.378) * (-794.948) (-791.742) [-796.891] (-793.957) -- 0:00:19
682500 -- (-793.933) [-794.962] (-792.505) (-795.679) * [-793.712] (-792.299) (-797.461) (-795.348) -- 0:00:19
683000 -- (-792.193) (-795.338) (-793.920) [-791.875] * (-795.489) [-794.805] (-793.831) (-795.328) -- 0:00:19
683500 -- (-795.544) (-794.932) [-794.212] (-792.028) * (-795.977) (-792.911) [-792.833] (-794.641) -- 0:00:18
684000 -- (-792.854) (-794.690) [-792.645] (-798.369) * [-792.405] (-792.561) (-794.050) (-794.602) -- 0:00:18
684500 -- (-792.726) (-800.881) [-792.384] (-792.952) * [-793.221] (-792.529) (-791.874) (-792.262) -- 0:00:18
685000 -- (-794.355) [-793.649] (-797.374) (-792.373) * [-792.103] (-792.913) (-792.365) (-792.641) -- 0:00:18
Average standard deviation of split frequencies: 0.007882
685500 -- (-792.565) (-795.923) [-795.216] (-792.404) * [-791.902] (-793.246) (-793.031) (-792.025) -- 0:00:18
686000 -- (-793.205) [-791.998] (-795.896) (-793.290) * [-793.462] (-792.212) (-792.750) (-792.383) -- 0:00:18
686500 -- (-794.081) (-791.685) (-793.806) [-794.356] * (-791.940) (-793.557) (-791.991) [-794.879] -- 0:00:18
687000 -- [-792.680] (-793.489) (-793.934) (-794.375) * (-793.877) [-793.407] (-797.802) (-794.418) -- 0:00:18
687500 -- (-794.927) (-793.581) (-792.999) [-792.865] * (-794.610) (-799.371) (-793.173) [-794.811] -- 0:00:18
688000 -- (-793.700) [-793.264] (-793.587) (-793.570) * (-794.889) (-797.115) (-794.113) [-793.817] -- 0:00:18
688500 -- (-794.360) (-793.437) [-793.200] (-794.331) * (-793.051) (-794.031) [-793.385] (-799.671) -- 0:00:18
689000 -- (-797.121) [-795.659] (-792.942) (-796.682) * (-795.300) (-793.823) (-793.762) [-791.843] -- 0:00:18
689500 -- (-794.794) (-796.906) [-792.335] (-799.096) * (-793.721) (-791.806) [-792.063] (-791.631) -- 0:00:18
690000 -- (-796.537) (-793.810) [-791.825] (-795.697) * (-793.644) (-792.516) (-794.661) [-792.001] -- 0:00:18
Average standard deviation of split frequencies: 0.007749
690500 -- (-795.668) [-795.083] (-795.348) (-799.147) * [-794.797] (-796.512) (-792.068) (-792.994) -- 0:00:18
691000 -- (-796.431) (-797.728) [-795.119] (-795.455) * (-794.992) [-794.686] (-793.932) (-798.361) -- 0:00:18
691500 -- (-794.755) (-795.270) [-798.325] (-795.217) * [-793.869] (-796.081) (-795.978) (-792.827) -- 0:00:18
692000 -- (-793.912) (-796.632) [-793.980] (-794.710) * (-792.828) (-796.836) (-797.192) [-792.359] -- 0:00:18
692500 -- [-793.251] (-792.535) (-794.691) (-795.485) * (-793.633) (-793.407) [-793.816] (-794.953) -- 0:00:18
693000 -- (-793.962) [-792.965] (-793.095) (-792.621) * [-793.152] (-794.212) (-794.507) (-795.028) -- 0:00:18
693500 -- (-792.329) (-792.983) (-792.874) [-792.466] * [-792.380] (-795.921) (-795.364) (-793.889) -- 0:00:18
694000 -- (-791.432) (-794.336) (-792.474) [-796.592] * (-792.885) (-792.753) (-793.004) [-795.854] -- 0:00:18
694500 -- [-791.927] (-794.363) (-793.106) (-792.280) * (-792.477) [-794.577] (-792.835) (-795.359) -- 0:00:18
695000 -- (-791.875) [-795.702] (-792.355) (-798.855) * (-798.669) (-793.982) [-794.429] (-793.453) -- 0:00:18
Average standard deviation of split frequencies: 0.007570
695500 -- (-793.620) (-793.743) (-793.687) [-792.369] * (-792.411) (-792.172) [-793.254] (-793.055) -- 0:00:18
696000 -- (-793.145) (-794.654) [-794.086] (-796.606) * [-795.108] (-792.671) (-797.568) (-795.932) -- 0:00:18
696500 -- [-792.519] (-792.833) (-794.013) (-793.349) * (-792.518) (-792.727) (-792.393) [-795.015] -- 0:00:18
697000 -- (-792.717) [-796.421] (-792.321) (-795.141) * (-798.715) [-793.405] (-797.247) (-797.209) -- 0:00:18
697500 -- (-797.581) [-794.645] (-794.656) (-792.749) * [-794.081] (-794.252) (-796.425) (-796.950) -- 0:00:18
698000 -- (-795.795) [-794.786] (-794.005) (-800.083) * (-793.383) [-793.671] (-792.632) (-793.940) -- 0:00:18
698500 -- (-799.337) (-792.330) [-793.457] (-794.152) * (-798.676) (-792.947) (-796.633) [-796.777] -- 0:00:18
699000 -- (-799.798) (-791.776) [-796.016] (-792.518) * [-793.191] (-794.429) (-796.136) (-791.832) -- 0:00:18
699500 -- (-795.368) [-792.705] (-795.196) (-792.634) * (-795.417) (-794.839) [-792.455] (-793.378) -- 0:00:18
700000 -- (-792.938) [-797.080] (-792.830) (-796.233) * (-796.162) [-792.167] (-794.022) (-795.480) -- 0:00:18
Average standard deviation of split frequencies: 0.007519
700500 -- (-794.944) [-797.231] (-792.162) (-792.736) * (-792.978) (-793.734) [-792.993] (-792.733) -- 0:00:17
701000 -- [-793.046] (-793.702) (-792.473) (-793.300) * [-794.054] (-792.950) (-796.746) (-792.311) -- 0:00:17
701500 -- (-800.026) (-793.337) (-792.151) [-796.623] * [-794.346] (-792.114) (-794.919) (-793.040) -- 0:00:17
702000 -- [-796.816] (-792.066) (-794.950) (-791.483) * (-792.753) [-791.447] (-793.218) (-792.523) -- 0:00:17
702500 -- (-793.590) (-793.573) (-792.597) [-793.844] * [-791.825] (-791.446) (-794.983) (-792.675) -- 0:00:17
703000 -- [-795.546] (-794.832) (-792.839) (-793.739) * (-794.316) (-794.663) [-792.455] (-798.783) -- 0:00:17
703500 -- (-794.534) (-794.561) [-792.694] (-792.872) * (-794.346) (-792.787) (-797.298) [-793.252] -- 0:00:17
704000 -- (-795.400) (-793.186) [-792.676] (-793.233) * (-799.048) [-794.349] (-794.378) (-795.031) -- 0:00:17
704500 -- [-791.473] (-794.328) (-793.392) (-793.804) * [-795.487] (-792.425) (-799.768) (-794.108) -- 0:00:17
705000 -- [-792.399] (-793.246) (-792.082) (-793.059) * [-796.337] (-791.647) (-792.950) (-794.631) -- 0:00:17
Average standard deviation of split frequencies: 0.007423
705500 -- (-792.717) (-793.301) [-793.152] (-792.625) * [-792.187] (-791.598) (-792.357) (-793.898) -- 0:00:17
706000 -- (-792.892) (-792.722) (-794.608) [-792.091] * (-792.310) (-791.663) (-791.856) [-792.214] -- 0:00:17
706500 -- (-792.294) (-792.192) [-793.475] (-794.815) * (-796.825) (-793.674) (-793.557) [-793.945] -- 0:00:17
707000 -- [-793.213] (-792.116) (-796.059) (-794.622) * (-791.746) [-795.010] (-791.873) (-794.838) -- 0:00:17
707500 -- (-795.558) [-792.641] (-794.270) (-794.827) * [-793.201] (-793.415) (-793.298) (-792.922) -- 0:00:17
708000 -- (-795.740) (-792.828) [-793.977] (-795.007) * (-798.099) [-794.918] (-792.531) (-794.891) -- 0:00:17
708500 -- (-794.928) (-793.815) (-793.585) [-793.253] * [-799.006] (-792.103) (-792.231) (-794.909) -- 0:00:17
709000 -- (-796.527) (-800.790) (-793.427) [-794.487] * [-799.076] (-792.896) (-792.686) (-796.528) -- 0:00:17
709500 -- (-794.081) (-798.761) [-792.637] (-796.886) * [-792.699] (-796.819) (-792.574) (-795.462) -- 0:00:17
710000 -- [-792.857] (-796.047) (-795.134) (-796.221) * (-795.827) (-797.621) (-795.273) [-796.149] -- 0:00:17
Average standard deviation of split frequencies: 0.007545
710500 -- (-798.219) (-793.204) [-792.021] (-792.191) * (-794.050) [-793.212] (-793.286) (-792.583) -- 0:00:17
711000 -- [-792.702] (-793.415) (-793.027) (-794.171) * (-793.547) [-794.032] (-795.998) (-793.320) -- 0:00:17
711500 -- (-793.540) [-792.383] (-794.317) (-795.155) * [-793.996] (-797.318) (-795.215) (-792.697) -- 0:00:17
712000 -- (-793.926) (-792.432) [-795.181] (-798.707) * [-793.866] (-796.214) (-796.545) (-794.169) -- 0:00:17
712500 -- [-793.339] (-795.775) (-793.882) (-795.317) * [-793.859] (-796.840) (-794.434) (-795.807) -- 0:00:17
713000 -- [-791.605] (-792.979) (-793.573) (-797.970) * (-795.279) (-794.979) [-792.454] (-794.820) -- 0:00:17
713500 -- (-794.569) (-793.852) [-793.189] (-796.013) * (-794.923) (-793.719) [-793.556] (-791.612) -- 0:00:17
714000 -- [-793.478] (-795.425) (-794.613) (-795.013) * (-794.476) [-792.417] (-792.995) (-792.294) -- 0:00:17
714500 -- [-792.542] (-794.736) (-798.051) (-791.997) * (-794.355) (-794.038) [-792.392] (-797.014) -- 0:00:17
715000 -- [-792.542] (-794.533) (-796.852) (-795.038) * (-793.806) (-792.829) [-792.350] (-795.409) -- 0:00:17
Average standard deviation of split frequencies: 0.007366
715500 -- (-794.102) [-794.745] (-801.230) (-794.498) * (-793.845) [-796.196] (-792.268) (-793.305) -- 0:00:17
716000 -- (-795.265) (-794.404) [-795.204] (-795.777) * (-793.314) (-800.531) (-796.639) [-793.148] -- 0:00:17
716500 -- (-798.947) (-792.486) [-793.605] (-794.012) * [-793.707] (-803.557) (-796.293) (-793.887) -- 0:00:17
717000 -- (-797.483) [-795.217] (-793.824) (-793.851) * (-797.062) (-796.428) (-792.060) [-795.531] -- 0:00:16
717500 -- (-794.181) (-794.644) [-794.481] (-794.586) * [-792.620] (-793.037) (-792.656) (-800.772) -- 0:00:16
718000 -- (-796.728) [-791.779] (-798.389) (-794.861) * (-791.475) (-792.149) [-794.318] (-794.689) -- 0:00:16
718500 -- (-793.836) (-795.893) [-794.291] (-794.943) * (-797.717) (-792.647) (-797.939) [-794.527] -- 0:00:16
719000 -- (-795.652) (-792.868) (-794.233) [-793.512] * [-793.723] (-794.069) (-803.013) (-792.975) -- 0:00:16
719500 -- [-796.596] (-794.228) (-794.878) (-792.088) * (-792.348) [-793.279] (-800.899) (-797.766) -- 0:00:16
720000 -- [-795.471] (-793.014) (-795.243) (-794.672) * (-797.893) (-791.981) [-795.861] (-795.180) -- 0:00:16
Average standard deviation of split frequencies: 0.007503
720500 -- (-796.257) (-792.536) [-793.993] (-792.637) * (-797.698) [-792.942] (-794.245) (-794.788) -- 0:00:16
721000 -- (-793.997) (-793.209) [-794.030] (-795.357) * [-794.339] (-792.650) (-793.535) (-795.076) -- 0:00:17
721500 -- (-799.577) (-793.490) (-791.490) [-793.719] * (-792.001) (-793.527) [-793.278] (-796.518) -- 0:00:16
722000 -- (-800.786) (-792.268) (-794.708) [-796.901] * (-793.996) (-793.394) [-791.837] (-795.368) -- 0:00:16
722500 -- (-791.834) (-792.406) [-792.602] (-798.037) * (-793.879) (-794.428) [-791.813] (-794.149) -- 0:00:16
723000 -- (-793.213) (-793.146) (-793.346) [-798.378] * (-795.332) (-792.265) [-792.482] (-791.636) -- 0:00:16
723500 -- (-794.873) (-794.365) (-793.280) [-793.453] * (-791.801) (-796.400) [-792.613] (-796.313) -- 0:00:16
724000 -- (-791.488) (-795.572) (-792.774) [-794.494] * [-799.107] (-793.576) (-792.384) (-794.027) -- 0:00:16
724500 -- [-791.460] (-793.726) (-792.477) (-793.357) * (-799.195) (-795.689) [-793.225] (-791.740) -- 0:00:16
725000 -- [-792.505] (-793.445) (-800.360) (-794.203) * (-797.041) (-795.267) [-792.777] (-797.839) -- 0:00:16
Average standard deviation of split frequencies: 0.007792
725500 -- (-794.127) (-793.765) (-797.813) [-798.700] * (-794.622) (-793.017) (-793.514) [-793.721] -- 0:00:16
726000 -- [-792.758] (-792.006) (-792.587) (-797.228) * (-796.439) [-791.616] (-792.836) (-793.273) -- 0:00:16
726500 -- [-793.652] (-793.019) (-794.119) (-795.946) * (-795.955) (-795.845) [-793.141] (-792.014) -- 0:00:16
727000 -- (-795.974) [-795.352] (-794.584) (-796.390) * [-793.390] (-795.134) (-795.786) (-793.677) -- 0:00:16
727500 -- (-797.359) [-792.823] (-796.569) (-794.706) * (-794.051) (-793.073) (-800.748) [-793.429] -- 0:00:16
728000 -- (-796.118) [-793.763] (-795.226) (-792.998) * [-795.017] (-792.794) (-795.168) (-793.447) -- 0:00:16
728500 -- [-794.447] (-793.488) (-793.734) (-791.569) * (-792.634) [-791.785] (-795.843) (-793.557) -- 0:00:16
729000 -- [-794.053] (-794.872) (-792.093) (-791.496) * (-793.199) (-793.539) (-797.611) [-792.890] -- 0:00:16
729500 -- (-793.645) (-793.815) (-792.009) [-792.092] * (-793.339) (-792.201) [-792.924] (-795.902) -- 0:00:16
730000 -- (-792.968) (-792.888) (-791.868) [-793.184] * (-793.174) (-793.424) (-795.957) [-793.873] -- 0:00:16
Average standard deviation of split frequencies: 0.008468
730500 -- (-793.608) (-792.758) (-798.706) [-793.855] * (-792.713) (-795.003) (-791.395) [-793.668] -- 0:00:16
731000 -- (-793.710) (-795.441) [-794.228] (-792.753) * [-792.031] (-796.471) (-791.517) (-797.772) -- 0:00:16
731500 -- (-793.762) (-793.741) (-793.183) [-791.649] * (-792.604) (-794.091) (-792.619) [-793.621] -- 0:00:16
732000 -- [-793.451] (-795.474) (-799.681) (-791.982) * (-792.021) [-793.953] (-792.017) (-793.509) -- 0:00:16
732500 -- (-792.521) (-795.669) (-794.730) [-791.773] * (-792.259) (-793.729) (-793.089) [-794.240] -- 0:00:16
733000 -- (-797.212) (-795.851) (-793.394) [-794.054] * (-791.313) (-793.694) [-793.402] (-792.097) -- 0:00:16
733500 -- (-796.335) (-796.593) [-792.985] (-795.221) * (-793.355) (-792.480) [-793.242] (-797.130) -- 0:00:15
734000 -- (-795.890) [-792.750] (-794.034) (-794.616) * [-792.094] (-797.518) (-794.727) (-794.009) -- 0:00:15
734500 -- [-795.613] (-792.352) (-797.954) (-795.204) * (-794.251) (-794.207) (-793.659) [-793.671] -- 0:00:15
735000 -- (-791.636) (-795.564) (-793.208) [-794.160] * (-794.930) [-794.009] (-791.668) (-793.240) -- 0:00:15
Average standard deviation of split frequencies: 0.008527
735500 -- [-794.095] (-791.906) (-795.294) (-795.074) * (-794.546) (-795.515) [-792.760] (-797.291) -- 0:00:15
736000 -- (-795.439) [-792.292] (-795.783) (-795.787) * (-792.206) (-792.510) (-794.118) [-793.990] -- 0:00:15
736500 -- (-797.632) [-792.207] (-795.697) (-791.867) * [-793.214] (-792.268) (-792.443) (-792.835) -- 0:00:16
737000 -- (-795.341) (-795.866) [-793.041] (-792.118) * [-793.915] (-792.482) (-795.044) (-795.247) -- 0:00:16
737500 -- (-791.758) [-794.258] (-793.725) (-792.748) * [-795.137] (-792.767) (-795.861) (-794.576) -- 0:00:16
738000 -- (-794.404) [-798.181] (-797.775) (-792.520) * (-798.720) [-794.270] (-795.386) (-793.100) -- 0:00:15
738500 -- (-793.180) [-794.798] (-797.410) (-793.383) * [-793.733] (-793.509) (-793.090) (-794.459) -- 0:00:15
739000 -- [-793.290] (-793.719) (-797.587) (-792.284) * (-796.936) [-797.446] (-797.329) (-794.404) -- 0:00:15
739500 -- (-791.865) [-793.790] (-796.414) (-791.993) * [-794.364] (-795.480) (-793.610) (-794.438) -- 0:00:15
740000 -- [-792.281] (-794.124) (-791.646) (-792.601) * (-791.938) (-802.934) [-793.395] (-792.018) -- 0:00:15
Average standard deviation of split frequencies: 0.008314
740500 -- (-792.332) (-795.222) [-794.304] (-791.876) * (-794.877) [-795.108] (-794.068) (-796.595) -- 0:00:15
741000 -- (-795.994) (-797.510) (-792.178) [-792.165] * (-795.703) (-795.534) (-792.200) [-795.165] -- 0:00:15
741500 -- (-796.164) (-798.574) (-792.175) [-792.059] * (-795.473) (-794.343) (-792.812) [-792.791] -- 0:00:15
742000 -- [-794.148] (-795.071) (-792.176) (-791.293) * (-794.905) [-793.330] (-792.098) (-792.567) -- 0:00:15
742500 -- [-795.818] (-793.980) (-793.375) (-791.293) * (-795.042) (-794.689) (-797.419) [-792.066] -- 0:00:15
743000 -- (-792.904) (-793.628) (-792.667) [-792.226] * (-793.058) [-793.153] (-792.769) (-792.246) -- 0:00:15
743500 -- (-792.694) [-798.039] (-791.623) (-794.583) * (-792.732) [-793.614] (-794.635) (-793.939) -- 0:00:15
744000 -- (-793.074) (-797.584) (-791.931) [-796.271] * (-799.501) (-794.805) (-795.719) [-794.511] -- 0:00:15
744500 -- (-794.756) (-797.397) [-792.315] (-797.129) * (-794.919) (-796.287) [-793.284] (-793.425) -- 0:00:15
745000 -- (-795.587) (-793.818) [-797.710] (-793.356) * (-791.890) (-796.569) (-794.019) [-792.567] -- 0:00:15
Average standard deviation of split frequencies: 0.008531
745500 -- [-795.340] (-792.666) (-794.130) (-793.187) * (-796.883) (-793.021) (-793.219) [-797.447] -- 0:00:15
746000 -- (-794.065) (-792.593) [-794.335] (-792.564) * (-792.487) (-793.418) [-793.984] (-795.061) -- 0:00:15
746500 -- (-793.881) [-792.312] (-792.943) (-792.339) * (-796.185) (-795.245) (-792.383) [-792.223] -- 0:00:15
747000 -- (-792.490) (-794.301) [-792.182] (-792.233) * (-797.412) (-795.108) (-791.392) [-792.138] -- 0:00:15
747500 -- (-792.897) [-796.296] (-792.540) (-791.841) * [-792.889] (-796.237) (-793.649) (-794.018) -- 0:00:15
748000 -- (-793.548) (-795.391) [-793.675] (-793.871) * (-792.348) (-795.935) (-794.260) [-792.593] -- 0:00:15
748500 -- (-791.953) (-794.083) (-793.939) [-793.414] * [-792.869] (-794.379) (-792.719) (-795.298) -- 0:00:15
749000 -- (-792.518) [-795.528] (-792.510) (-793.139) * (-793.811) (-791.811) (-796.113) [-793.374] -- 0:00:15
749500 -- [-792.211] (-792.576) (-791.789) (-798.625) * (-794.952) [-792.925] (-794.265) (-794.511) -- 0:00:15
750000 -- (-797.642) (-795.070) (-792.430) [-799.844] * (-793.892) (-791.950) (-792.593) [-796.418] -- 0:00:15
Average standard deviation of split frequencies: 0.008164
750500 -- (-799.535) [-792.166] (-793.840) (-797.095) * (-794.266) [-793.272] (-792.939) (-793.217) -- 0:00:15
751000 -- (-794.337) (-792.756) [-794.601] (-796.055) * (-792.463) (-795.430) (-792.381) [-798.274] -- 0:00:15
751500 -- (-794.798) (-792.519) [-794.711] (-792.975) * (-792.571) (-798.972) [-793.397] (-796.517) -- 0:00:15
752000 -- (-793.574) (-792.954) (-798.470) [-794.017] * (-794.914) [-794.893] (-793.463) (-793.251) -- 0:00:15
752500 -- [-794.338] (-799.158) (-795.269) (-793.850) * (-793.310) [-793.406] (-793.929) (-796.495) -- 0:00:15
753000 -- [-791.837] (-794.063) (-797.659) (-793.158) * (-792.658) (-792.591) [-792.900] (-794.264) -- 0:00:15
753500 -- (-792.657) (-797.451) [-792.828] (-793.617) * [-791.813] (-793.997) (-793.381) (-795.631) -- 0:00:15
754000 -- (-791.647) (-792.174) (-792.819) [-794.521] * (-791.190) [-794.397] (-795.596) (-795.846) -- 0:00:15
754500 -- [-793.058] (-792.898) (-794.556) (-791.773) * [-795.312] (-793.374) (-794.445) (-794.483) -- 0:00:14
755000 -- (-797.053) (-795.003) [-795.529] (-791.909) * (-792.333) [-791.992] (-795.812) (-793.558) -- 0:00:14
Average standard deviation of split frequencies: 0.007833
755500 -- (-796.020) (-793.395) [-794.248] (-794.542) * [-794.064] (-793.516) (-795.763) (-794.896) -- 0:00:14
756000 -- (-800.442) (-792.642) [-795.050] (-793.991) * (-792.977) (-793.760) [-795.189] (-792.271) -- 0:00:14
756500 -- (-796.562) [-792.593] (-795.155) (-792.267) * (-794.233) (-791.673) (-793.680) [-794.312] -- 0:00:14
757000 -- (-794.149) [-794.411] (-797.033) (-794.286) * (-795.934) (-791.655) (-793.179) [-794.460] -- 0:00:14
757500 -- (-792.731) [-792.061] (-793.534) (-795.261) * (-792.437) (-794.540) [-793.893] (-793.470) -- 0:00:14
758000 -- (-793.577) (-792.972) [-793.332] (-792.737) * [-794.719] (-795.469) (-794.478) (-792.543) -- 0:00:14
758500 -- (-797.688) [-793.603] (-792.133) (-793.070) * (-797.755) [-794.566] (-791.631) (-793.944) -- 0:00:14
759000 -- (-794.364) (-793.205) [-793.878] (-795.431) * (-791.792) (-797.937) [-792.263] (-798.050) -- 0:00:14
759500 -- [-793.408] (-792.676) (-795.627) (-795.625) * (-803.481) [-795.414] (-792.979) (-798.351) -- 0:00:14
760000 -- (-794.883) (-792.045) (-791.389) [-793.259] * (-792.795) [-792.903] (-794.285) (-792.046) -- 0:00:14
Average standard deviation of split frequencies: 0.007708
760500 -- [-792.328] (-791.775) (-794.522) (-795.649) * (-793.363) (-792.903) [-793.049] (-792.495) -- 0:00:14
761000 -- [-793.712] (-792.259) (-792.398) (-792.665) * (-798.182) (-793.333) (-795.328) [-793.060] -- 0:00:14
761500 -- (-795.327) (-794.549) (-791.979) [-791.958] * (-793.077) (-795.019) [-794.009] (-795.164) -- 0:00:14
762000 -- (-792.164) (-796.231) [-792.162] (-794.038) * [-793.738] (-795.366) (-795.826) (-792.987) -- 0:00:14
762500 -- (-792.697) [-798.263] (-793.149) (-796.337) * (-796.426) (-793.369) [-792.590] (-793.873) -- 0:00:14
763000 -- (-792.060) [-792.822] (-796.238) (-793.927) * (-793.601) [-792.222] (-795.023) (-795.224) -- 0:00:14
763500 -- (-792.995) (-795.514) (-793.966) [-795.280] * (-793.729) (-797.037) (-796.369) [-795.065] -- 0:00:14
764000 -- [-792.908] (-793.076) (-795.008) (-793.993) * (-796.808) [-792.182] (-796.279) (-794.748) -- 0:00:14
764500 -- (-792.070) [-795.547] (-793.114) (-796.853) * [-795.712] (-791.906) (-796.974) (-797.035) -- 0:00:14
765000 -- (-793.125) (-794.252) (-794.036) [-798.559] * (-798.042) [-792.730] (-792.396) (-793.797) -- 0:00:14
Average standard deviation of split frequencies: 0.008385
765500 -- (-792.502) [-791.497] (-791.560) (-798.470) * (-792.484) (-797.926) [-792.471] (-793.720) -- 0:00:14
766000 -- (-792.596) (-792.215) [-792.678] (-792.641) * (-792.134) [-793.399] (-794.031) (-795.221) -- 0:00:14
766500 -- (-794.525) (-793.212) (-796.769) [-794.111] * [-792.964] (-799.301) (-793.087) (-791.519) -- 0:00:14
767000 -- (-793.488) [-793.984] (-797.651) (-792.614) * (-793.565) (-791.367) [-793.349] (-792.434) -- 0:00:14
767500 -- (-798.474) (-793.492) (-801.451) [-799.225] * [-793.215] (-791.438) (-796.071) (-793.773) -- 0:00:14
768000 -- (-793.026) (-795.156) [-801.896] (-795.173) * [-793.290] (-794.708) (-801.126) (-795.171) -- 0:00:14
768500 -- [-792.188] (-798.108) (-793.166) (-791.694) * (-793.350) (-793.353) [-796.485] (-793.044) -- 0:00:14
769000 -- (-794.766) (-795.544) [-793.102] (-793.629) * (-791.879) (-799.963) (-794.321) [-792.026] -- 0:00:14
769500 -- (-793.547) (-792.173) [-792.596] (-793.747) * (-793.034) [-792.625] (-796.718) (-793.189) -- 0:00:14
770000 -- [-795.110] (-793.606) (-793.412) (-794.066) * (-793.404) [-793.406] (-796.397) (-791.928) -- 0:00:14
Average standard deviation of split frequencies: 0.008067
770500 -- [-794.703] (-798.151) (-796.733) (-797.979) * (-794.408) (-797.955) (-797.542) [-793.895] -- 0:00:13
771000 -- (-794.760) (-791.806) (-793.792) [-793.524] * (-794.045) (-799.223) (-793.168) [-791.777] -- 0:00:13
771500 -- (-796.524) (-796.544) [-791.737] (-793.219) * (-793.995) [-795.295] (-792.402) (-792.532) -- 0:00:13
772000 -- [-794.387] (-795.117) (-791.577) (-791.493) * (-793.124) (-795.208) (-792.844) [-792.770] -- 0:00:13
772500 -- [-792.459] (-794.325) (-791.790) (-792.005) * (-795.247) (-792.225) (-795.642) [-792.016] -- 0:00:13
773000 -- (-791.947) (-792.619) (-797.383) [-793.537] * (-792.103) [-792.304] (-792.725) (-793.383) -- 0:00:13
773500 -- (-793.950) (-795.947) [-793.819] (-793.238) * (-794.584) [-792.185] (-798.219) (-797.483) -- 0:00:13
774000 -- (-795.101) (-792.947) (-792.807) [-791.667] * [-793.989] (-791.869) (-799.337) (-797.558) -- 0:00:13
774500 -- [-791.729] (-794.159) (-792.891) (-791.617) * (-793.185) [-793.745] (-798.170) (-795.100) -- 0:00:13
775000 -- [-792.330] (-792.295) (-792.065) (-791.869) * [-793.869] (-795.982) (-799.036) (-793.419) -- 0:00:13
Average standard deviation of split frequencies: 0.007594
775500 -- (-793.242) (-794.056) [-795.552] (-793.763) * (-795.529) (-793.612) [-793.912] (-792.144) -- 0:00:13
776000 -- (-797.702) (-793.515) (-794.373) [-793.046] * (-792.473) (-793.200) (-794.064) [-794.770] -- 0:00:13
776500 -- [-793.973] (-795.582) (-794.639) (-793.195) * (-796.890) (-796.160) [-795.628] (-793.683) -- 0:00:13
777000 -- (-794.593) [-794.092] (-796.601) (-797.917) * (-792.035) (-795.407) (-792.484) [-794.447] -- 0:00:13
777500 -- (-793.164) [-792.314] (-792.533) (-795.453) * (-791.612) [-793.384] (-793.092) (-795.704) -- 0:00:13
778000 -- [-793.157] (-793.938) (-792.771) (-796.858) * [-791.613] (-793.680) (-793.649) (-793.804) -- 0:00:13
778500 -- (-793.899) (-794.031) [-796.810] (-792.380) * [-793.188] (-793.300) (-794.630) (-791.483) -- 0:00:13
779000 -- (-792.764) [-795.370] (-792.917) (-793.957) * (-793.498) (-798.679) [-793.270] (-791.485) -- 0:00:13
779500 -- [-794.587] (-794.825) (-794.675) (-792.772) * (-794.617) [-793.164] (-792.533) (-792.070) -- 0:00:13
780000 -- (-794.126) (-795.045) [-792.561] (-792.040) * [-793.802] (-793.691) (-792.084) (-793.306) -- 0:00:13
Average standard deviation of split frequencies: 0.007510
780500 -- (-794.913) (-796.400) (-793.794) [-791.841] * (-795.638) (-792.320) [-792.484] (-792.465) -- 0:00:13
781000 -- [-794.163] (-794.467) (-796.354) (-792.663) * (-793.007) [-795.608] (-793.300) (-796.368) -- 0:00:13
781500 -- [-795.093] (-799.650) (-796.741) (-793.303) * [-794.240] (-793.839) (-793.425) (-791.737) -- 0:00:13
782000 -- (-794.630) (-795.809) [-793.388] (-794.550) * [-792.322] (-797.644) (-792.920) (-792.939) -- 0:00:13
782500 -- (-794.866) (-793.925) [-795.652] (-796.671) * [-792.847] (-797.528) (-792.913) (-799.934) -- 0:00:13
783000 -- (-791.850) (-793.096) (-793.570) [-793.819] * (-792.180) (-794.738) (-794.611) [-795.934] -- 0:00:13
783500 -- (-791.797) (-792.740) [-793.873] (-794.007) * (-792.156) (-793.509) [-792.620] (-793.428) -- 0:00:13
784000 -- (-791.937) (-797.980) (-792.093) [-793.399] * (-792.721) (-796.440) [-793.327] (-791.943) -- 0:00:13
784500 -- (-794.157) (-799.232) (-792.247) [-792.857] * [-792.742] (-791.604) (-793.472) (-792.636) -- 0:00:13
785000 -- [-794.069] (-795.671) (-798.613) (-792.090) * (-794.570) [-792.340] (-797.387) (-793.460) -- 0:00:13
Average standard deviation of split frequencies: 0.007759
785500 -- (-793.644) (-796.768) (-795.005) [-792.175] * [-795.427] (-795.818) (-796.059) (-795.130) -- 0:00:13
786000 -- (-794.559) (-796.496) (-796.089) [-792.886] * (-796.803) (-794.118) [-799.253] (-800.305) -- 0:00:13
786500 -- [-792.381] (-793.434) (-792.486) (-792.759) * (-793.882) (-795.395) (-794.280) [-793.956] -- 0:00:13
787000 -- (-793.036) (-792.445) (-792.450) [-793.447] * (-791.567) (-793.872) [-795.373] (-794.033) -- 0:00:12
787500 -- (-794.488) (-793.457) [-793.649] (-792.856) * (-798.320) (-793.137) (-794.072) [-792.931] -- 0:00:12
788000 -- [-792.034] (-793.262) (-792.664) (-792.689) * [-792.307] (-792.920) (-792.766) (-793.658) -- 0:00:12
788500 -- (-792.013) (-793.303) [-792.172] (-791.499) * (-793.844) [-792.451] (-792.314) (-792.772) -- 0:00:12
789000 -- (-791.361) (-794.437) (-794.145) [-792.441] * [-794.813] (-791.295) (-791.507) (-795.559) -- 0:00:12
789500 -- (-792.275) [-791.511] (-792.909) (-796.139) * (-794.972) [-792.769] (-792.719) (-795.200) -- 0:00:13
790000 -- (-793.215) (-796.937) [-793.077] (-794.054) * (-792.634) (-795.722) (-792.732) [-793.332] -- 0:00:13
Average standard deviation of split frequencies: 0.008161
790500 -- (-797.206) (-793.568) [-792.831] (-793.788) * (-793.269) (-792.518) (-794.781) [-794.133] -- 0:00:12
791000 -- (-795.458) (-793.958) (-795.575) [-791.945] * (-793.265) [-793.078] (-793.137) (-794.759) -- 0:00:12
791500 -- (-795.860) (-792.018) [-793.234] (-793.467) * (-794.241) (-792.525) (-793.880) [-793.831] -- 0:00:12
792000 -- (-793.167) [-795.189] (-793.445) (-793.772) * (-796.227) [-792.717] (-792.663) (-799.731) -- 0:00:12
792500 -- (-791.704) (-793.294) (-793.328) [-800.159] * (-797.347) [-793.356] (-796.916) (-792.552) -- 0:00:12
793000 -- [-793.705] (-798.186) (-793.433) (-793.251) * [-795.554] (-793.358) (-795.552) (-791.818) -- 0:00:12
793500 -- (-796.608) [-795.059] (-798.177) (-793.210) * (-794.855) (-792.740) [-795.180] (-796.020) -- 0:00:12
794000 -- (-798.454) (-796.778) [-791.957] (-797.618) * [-791.743] (-792.992) (-793.543) (-797.494) -- 0:00:12
794500 -- (-792.672) (-795.074) [-791.715] (-792.486) * (-792.791) (-792.817) (-793.228) [-796.263] -- 0:00:12
795000 -- (-793.763) [-794.838] (-794.924) (-793.037) * (-796.829) [-793.551] (-793.063) (-792.085) -- 0:00:12
Average standard deviation of split frequencies: 0.008920
795500 -- [-794.373] (-794.199) (-793.149) (-798.188) * [-795.977] (-792.980) (-793.454) (-792.141) -- 0:00:12
796000 -- [-792.971] (-794.890) (-799.097) (-797.401) * [-792.541] (-793.608) (-791.915) (-793.937) -- 0:00:12
796500 -- (-792.038) [-793.338] (-798.027) (-799.833) * [-795.437] (-794.400) (-792.123) (-791.539) -- 0:00:12
797000 -- [-791.900] (-796.652) (-797.825) (-795.232) * [-791.991] (-796.011) (-794.419) (-794.903) -- 0:00:12
797500 -- [-792.199] (-798.164) (-797.716) (-793.937) * (-792.006) (-793.855) (-794.146) [-792.362] -- 0:00:12
798000 -- [-792.435] (-792.219) (-793.910) (-793.715) * (-795.959) [-794.833] (-794.158) (-798.182) -- 0:00:12
798500 -- (-791.812) (-792.181) [-800.089] (-796.623) * (-795.668) (-794.169) [-794.503] (-793.371) -- 0:00:12
799000 -- (-796.731) (-793.105) [-794.369] (-795.345) * (-798.693) [-792.491] (-795.035) (-793.095) -- 0:00:12
799500 -- (-793.945) (-794.266) (-792.933) [-792.772] * (-796.034) (-795.328) [-791.854] (-794.554) -- 0:00:12
800000 -- [-792.067] (-796.038) (-792.071) (-796.309) * (-796.428) (-796.329) (-791.671) [-796.204] -- 0:00:12
Average standard deviation of split frequencies: 0.009015
800500 -- [-792.302] (-796.254) (-793.024) (-793.197) * (-794.157) (-792.799) [-791.594] (-792.581) -- 0:00:12
801000 -- (-791.518) (-798.638) [-791.688] (-794.409) * (-792.754) (-797.685) (-793.164) [-793.034] -- 0:00:12
801500 -- (-792.654) [-799.342] (-791.572) (-799.183) * (-792.484) (-793.695) (-792.061) [-794.246] -- 0:00:12
802000 -- [-793.700] (-799.106) (-791.897) (-795.002) * [-795.735] (-794.998) (-793.071) (-793.160) -- 0:00:12
802500 -- (-792.692) (-795.698) (-792.575) [-791.849] * (-792.809) (-793.416) (-792.304) [-792.848] -- 0:00:12
803000 -- (-793.306) (-793.304) (-796.194) [-792.492] * (-793.268) (-792.376) [-796.964] (-795.697) -- 0:00:12
803500 -- [-791.937] (-793.455) (-796.387) (-795.008) * [-792.907] (-793.421) (-792.755) (-794.762) -- 0:00:11
804000 -- (-795.354) (-793.361) (-796.990) [-792.116] * (-792.598) [-792.267] (-792.421) (-794.515) -- 0:00:11
804500 -- (-797.321) [-799.975] (-793.787) (-793.204) * (-794.503) (-792.256) [-795.287] (-796.325) -- 0:00:11
805000 -- (-794.700) [-794.961] (-795.069) (-795.072) * (-796.687) (-792.619) [-792.627] (-795.532) -- 0:00:12
Average standard deviation of split frequencies: 0.008334
805500 -- (-794.999) (-795.084) (-792.359) [-792.093] * (-792.351) [-792.882] (-793.869) (-797.060) -- 0:00:12
806000 -- (-794.447) [-794.985] (-792.860) (-792.811) * (-792.151) [-793.641] (-792.866) (-796.385) -- 0:00:12
806500 -- (-794.952) (-792.404) [-793.377] (-794.208) * (-793.693) [-793.410] (-795.959) (-794.212) -- 0:00:11
807000 -- (-793.355) [-793.255] (-793.075) (-792.912) * [-795.771] (-794.729) (-792.064) (-793.458) -- 0:00:11
807500 -- (-793.219) [-792.995] (-793.080) (-793.158) * (-794.824) (-795.497) [-792.856] (-793.816) -- 0:00:11
808000 -- (-793.451) (-792.117) (-798.574) [-792.712] * (-793.909) (-793.961) (-793.997) [-792.752] -- 0:00:11
808500 -- (-793.144) [-796.937] (-796.529) (-794.949) * (-796.442) [-794.232] (-794.461) (-792.229) -- 0:00:11
809000 -- (-792.426) (-795.026) (-792.213) [-792.161] * (-796.688) (-798.963) [-791.379] (-791.917) -- 0:00:11
809500 -- [-792.300] (-794.869) (-792.707) (-796.973) * [-795.452] (-799.160) (-795.097) (-791.769) -- 0:00:11
810000 -- [-792.078] (-792.681) (-791.967) (-791.443) * (-794.944) [-794.812] (-792.877) (-791.634) -- 0:00:11
Average standard deviation of split frequencies: 0.009086
810500 -- [-793.860] (-793.631) (-791.613) (-793.430) * [-798.431] (-793.202) (-792.538) (-792.749) -- 0:00:11
811000 -- [-794.522] (-792.793) (-793.271) (-792.162) * (-799.566) (-793.103) (-794.900) [-793.976] -- 0:00:11
811500 -- (-797.055) [-795.197] (-791.775) (-793.841) * (-791.414) (-794.533) (-792.682) [-791.759] -- 0:00:11
812000 -- (-794.030) [-792.655] (-795.240) (-794.269) * (-794.625) (-792.516) [-792.434] (-793.877) -- 0:00:11
812500 -- (-793.280) (-791.857) [-795.968] (-794.756) * (-792.717) (-792.316) [-792.179] (-795.331) -- 0:00:11
813000 -- [-792.041] (-793.671) (-795.228) (-799.738) * [-795.116] (-792.589) (-792.848) (-791.573) -- 0:00:11
813500 -- (-795.661) (-793.826) (-793.547) [-793.473] * [-793.841] (-792.910) (-791.936) (-791.703) -- 0:00:11
814000 -- [-792.376] (-792.365) (-792.209) (-794.359) * (-793.050) (-794.187) [-792.965] (-794.445) -- 0:00:11
814500 -- (-795.427) (-792.381) (-794.992) [-794.109] * (-793.533) (-794.029) (-793.265) [-792.050] -- 0:00:11
815000 -- (-793.494) (-793.218) (-794.617) [-797.955] * [-793.570] (-794.639) (-794.591) (-796.285) -- 0:00:11
Average standard deviation of split frequencies: 0.008882
815500 -- [-792.690] (-794.320) (-794.787) (-795.526) * (-791.876) (-793.622) (-792.125) [-796.323] -- 0:00:11
816000 -- (-792.408) [-793.017] (-793.751) (-795.755) * (-792.907) [-795.566] (-791.819) (-793.221) -- 0:00:11
816500 -- (-792.802) (-792.950) (-793.267) [-794.176] * (-795.313) (-793.627) (-792.863) [-794.325] -- 0:00:11
817000 -- (-796.043) (-794.676) (-793.138) [-792.462] * (-801.812) [-793.522] (-798.684) (-797.218) -- 0:00:11
817500 -- (-793.985) [-793.394] (-793.553) (-797.562) * (-794.665) (-795.032) (-794.521) [-794.063] -- 0:00:11
818000 -- [-794.620] (-795.324) (-793.138) (-797.359) * (-795.181) [-792.689] (-794.493) (-791.555) -- 0:00:11
818500 -- [-793.740] (-793.354) (-798.357) (-795.831) * (-794.077) [-792.472] (-793.127) (-795.329) -- 0:00:11
819000 -- (-792.264) (-792.425) (-796.598) [-792.789] * (-791.261) [-793.501] (-792.805) (-792.741) -- 0:00:11
819500 -- [-792.882] (-794.700) (-793.460) (-792.618) * (-792.036) (-793.665) (-793.613) [-794.129] -- 0:00:11
820000 -- (-795.503) (-792.680) (-797.101) [-795.661] * (-792.594) [-791.914] (-792.346) (-796.397) -- 0:00:10
Average standard deviation of split frequencies: 0.008868
820500 -- (-793.791) [-792.495] (-791.629) (-796.791) * (-793.943) (-794.415) (-798.274) [-793.356] -- 0:00:10
821000 -- (-793.262) (-798.237) (-793.767) [-792.350] * (-795.372) (-795.132) [-793.200] (-793.754) -- 0:00:10
821500 -- (-793.341) (-796.660) (-793.153) [-796.672] * (-796.720) [-791.495] (-793.086) (-792.386) -- 0:00:11
822000 -- (-793.934) (-795.764) [-793.316] (-795.560) * (-796.478) (-792.972) (-791.730) [-792.005] -- 0:00:11
822500 -- (-795.170) (-793.029) (-794.316) [-793.447] * (-793.209) (-792.647) (-793.920) [-792.115] -- 0:00:11
823000 -- (-792.916) (-792.672) (-793.278) [-794.181] * (-794.223) (-798.527) (-794.673) [-793.409] -- 0:00:10
823500 -- (-798.838) (-792.808) [-792.374] (-792.221) * (-792.761) (-797.934) [-794.473] (-792.434) -- 0:00:10
824000 -- (-795.490) (-795.111) (-794.515) [-792.363] * (-791.732) (-794.041) [-792.882] (-795.758) -- 0:00:10
824500 -- (-794.216) (-792.925) (-794.225) [-797.393] * [-800.865] (-793.822) (-793.644) (-795.840) -- 0:00:10
825000 -- (-792.750) (-794.170) [-797.249] (-795.190) * (-802.681) [-794.689] (-793.672) (-792.996) -- 0:00:10
Average standard deviation of split frequencies: 0.008632
825500 -- [-793.408] (-792.665) (-796.991) (-794.556) * (-794.253) [-793.366] (-796.411) (-792.705) -- 0:00:10
826000 -- (-797.020) (-793.213) (-792.333) [-794.016] * (-792.762) (-794.622) (-797.971) [-792.893] -- 0:00:10
826500 -- (-798.044) (-793.371) [-792.455] (-796.595) * (-792.494) (-794.995) (-797.348) [-793.432] -- 0:00:10
827000 -- (-792.474) (-794.288) (-794.316) [-791.765] * [-791.397] (-792.844) (-798.621) (-793.029) -- 0:00:10
827500 -- (-796.271) (-794.100) [-794.004] (-793.402) * [-793.306] (-795.029) (-792.427) (-792.173) -- 0:00:10
828000 -- (-799.444) (-794.822) (-793.151) [-793.105] * (-793.286) (-793.752) (-794.098) [-792.055] -- 0:00:10
828500 -- [-792.083] (-792.238) (-791.999) (-792.800) * [-793.091] (-793.123) (-792.151) (-792.005) -- 0:00:10
829000 -- (-792.460) (-800.966) [-795.140] (-795.738) * [-791.914] (-795.330) (-792.335) (-791.922) -- 0:00:10
829500 -- (-793.466) (-793.448) [-794.409] (-794.981) * [-793.127] (-797.517) (-792.071) (-792.745) -- 0:00:10
830000 -- (-794.285) [-792.476] (-798.613) (-793.635) * (-793.125) [-793.740] (-793.641) (-793.289) -- 0:00:10
Average standard deviation of split frequencies: 0.009009
830500 -- (-792.783) (-792.955) (-799.921) [-792.620] * (-795.083) [-792.324] (-794.632) (-795.399) -- 0:00:10
831000 -- (-792.845) (-793.075) (-793.644) [-796.651] * [-794.656] (-793.849) (-793.034) (-794.155) -- 0:00:10
831500 -- [-793.675] (-793.752) (-792.503) (-796.651) * (-791.752) (-796.252) (-792.230) [-794.282] -- 0:00:10
832000 -- (-799.020) (-793.375) [-793.413] (-797.032) * (-791.562) (-795.534) [-793.377] (-796.024) -- 0:00:10
832500 -- (-797.044) (-795.524) [-792.839] (-791.786) * (-794.994) (-792.187) [-792.034] (-793.498) -- 0:00:10
833000 -- (-794.982) [-793.687] (-794.274) (-793.243) * (-796.336) (-793.438) [-791.824] (-792.195) -- 0:00:10
833500 -- (-795.160) (-794.212) [-792.282] (-794.173) * (-793.639) [-795.724] (-791.585) (-793.122) -- 0:00:10
834000 -- (-792.635) (-792.273) [-792.470] (-792.397) * (-793.787) [-795.757] (-792.230) (-792.844) -- 0:00:10
834500 -- [-793.821] (-791.875) (-794.062) (-792.424) * [-793.425] (-793.182) (-795.772) (-793.988) -- 0:00:10
835000 -- (-792.328) [-791.843] (-792.912) (-794.481) * (-794.045) (-792.383) [-795.509] (-795.146) -- 0:00:10
Average standard deviation of split frequencies: 0.008987
835500 -- (-792.912) [-792.501] (-792.393) (-795.095) * (-793.954) [-793.500] (-799.978) (-792.632) -- 0:00:10
836000 -- [-796.191] (-792.256) (-792.920) (-793.152) * (-792.541) [-793.259] (-794.332) (-796.652) -- 0:00:10
836500 -- (-793.590) [-794.063] (-794.566) (-794.587) * [-794.198] (-793.142) (-799.260) (-796.960) -- 0:00:09
837000 -- (-798.410) (-792.364) [-793.164] (-795.519) * (-794.199) (-792.854) [-793.174] (-792.789) -- 0:00:09
837500 -- (-792.500) [-793.036] (-794.314) (-794.334) * (-795.281) [-793.542] (-792.652) (-793.496) -- 0:00:09
838000 -- [-792.218] (-791.656) (-794.031) (-795.854) * (-793.230) (-792.939) (-793.489) [-791.798] -- 0:00:09
838500 -- (-792.767) [-794.191] (-795.955) (-793.221) * (-794.659) [-792.617] (-793.270) (-792.714) -- 0:00:10
839000 -- (-794.389) (-791.502) (-796.398) [-792.758] * (-792.940) (-797.297) (-793.982) [-793.453] -- 0:00:09
839500 -- (-796.123) (-793.094) (-793.590) [-792.437] * (-793.470) [-793.698] (-797.787) (-794.237) -- 0:00:09
840000 -- (-793.686) (-792.283) (-794.239) [-791.887] * (-792.426) [-793.566] (-794.327) (-796.803) -- 0:00:09
Average standard deviation of split frequencies: 0.009498
840500 -- [-792.831] (-792.927) (-795.093) (-793.092) * (-796.192) (-793.863) (-796.660) [-794.735] -- 0:00:09
841000 -- (-792.325) [-793.212] (-799.005) (-791.891) * (-794.972) (-794.396) (-793.828) [-797.102] -- 0:00:09
841500 -- (-792.441) (-793.063) [-794.759] (-795.949) * (-796.672) [-792.727] (-796.029) (-792.795) -- 0:00:09
842000 -- (-797.230) (-792.663) [-793.300] (-795.838) * [-795.084] (-793.743) (-793.398) (-794.144) -- 0:00:09
842500 -- (-793.048) (-795.421) (-795.761) [-792.594] * [-793.784] (-794.164) (-792.101) (-793.651) -- 0:00:09
843000 -- [-793.369] (-793.208) (-799.540) (-792.500) * (-795.731) (-793.800) (-795.753) [-792.147] -- 0:00:09
843500 -- (-794.062) [-791.920] (-793.999) (-794.433) * (-794.552) (-792.063) (-792.358) [-792.947] -- 0:00:09
844000 -- (-799.802) (-792.259) [-796.711] (-792.189) * (-793.095) (-793.533) [-793.372] (-794.650) -- 0:00:09
844500 -- (-795.655) [-794.284] (-794.412) (-795.954) * (-794.643) (-794.899) [-800.572] (-791.915) -- 0:00:09
845000 -- (-795.817) [-792.805] (-791.926) (-796.130) * (-793.449) (-796.329) (-794.259) [-791.927] -- 0:00:09
Average standard deviation of split frequencies: 0.009194
845500 -- (-796.411) (-796.919) [-792.378] (-794.469) * (-794.038) [-793.160] (-793.782) (-793.678) -- 0:00:09
846000 -- (-792.010) (-791.577) (-794.936) [-793.954] * (-793.039) (-793.786) (-795.635) [-792.628] -- 0:00:09
846500 -- [-793.444] (-793.358) (-792.806) (-791.573) * [-793.417] (-795.742) (-796.681) (-793.576) -- 0:00:09
847000 -- (-792.253) (-793.046) (-794.656) [-792.693] * [-795.431] (-794.553) (-793.761) (-795.287) -- 0:00:09
847500 -- (-794.315) [-794.757] (-793.692) (-793.075) * (-797.950) [-792.046] (-802.422) (-795.493) -- 0:00:09
848000 -- (-795.678) (-794.049) (-800.899) [-795.171] * (-794.312) (-793.096) [-793.859] (-795.043) -- 0:00:09
848500 -- (-793.961) [-792.095] (-793.985) (-791.835) * (-796.541) [-792.861] (-792.358) (-794.801) -- 0:00:09
849000 -- (-794.281) (-792.859) (-796.691) [-792.739] * [-793.732] (-792.909) (-793.712) (-797.084) -- 0:00:09
849500 -- (-792.066) (-792.149) [-792.814] (-794.655) * (-795.112) [-793.290] (-793.215) (-799.156) -- 0:00:09
850000 -- (-791.366) (-791.929) [-792.309] (-793.294) * (-792.824) (-796.829) [-794.391] (-792.064) -- 0:00:09
Average standard deviation of split frequencies: 0.009282
850500 -- (-791.553) [-794.252] (-794.911) (-793.616) * [-793.532] (-794.832) (-793.867) (-792.390) -- 0:00:09
851000 -- (-791.721) [-793.740] (-793.989) (-792.952) * [-792.488] (-792.174) (-793.000) (-793.353) -- 0:00:09
851500 -- (-792.783) (-793.932) [-792.145] (-792.527) * (-796.436) [-791.860] (-795.388) (-791.448) -- 0:00:09
852000 -- (-792.098) (-795.093) [-792.468] (-792.465) * (-793.234) (-791.906) (-794.652) [-794.297] -- 0:00:09
852500 -- (-796.091) (-793.827) [-792.617] (-792.031) * (-794.817) (-791.181) [-792.065] (-796.786) -- 0:00:08
853000 -- [-795.888] (-792.041) (-791.454) (-792.375) * (-794.865) (-792.224) (-791.640) [-795.840] -- 0:00:08
853500 -- (-794.422) (-791.753) (-793.626) [-796.532] * (-794.743) [-793.731] (-795.316) (-796.185) -- 0:00:08
854000 -- (-799.392) [-792.440] (-795.028) (-795.671) * (-793.964) (-792.687) [-794.808] (-795.162) -- 0:00:08
854500 -- (-795.280) [-792.630] (-792.845) (-794.121) * (-794.882) (-796.048) [-792.162] (-795.296) -- 0:00:08
855000 -- (-792.891) (-793.566) [-793.999] (-793.745) * (-798.712) (-797.090) (-794.192) [-794.616] -- 0:00:08
Average standard deviation of split frequencies: 0.009224
855500 -- (-797.938) (-793.094) [-797.613] (-793.741) * [-792.510] (-794.077) (-793.751) (-792.295) -- 0:00:08
856000 -- (-792.959) (-791.717) [-793.088] (-792.731) * [-792.920] (-792.853) (-793.587) (-797.622) -- 0:00:08
856500 -- (-794.610) (-793.815) (-792.101) [-794.806] * (-793.015) (-792.291) (-797.057) [-796.447] -- 0:00:08
857000 -- (-796.772) (-792.897) (-791.476) [-793.208] * [-792.051] (-792.440) (-795.807) (-792.519) -- 0:00:08
857500 -- (-797.527) (-793.322) [-794.178] (-794.025) * [-794.555] (-794.338) (-796.918) (-795.578) -- 0:00:08
858000 -- (-793.269) (-797.594) [-794.060] (-792.211) * [-795.051] (-796.783) (-795.759) (-796.182) -- 0:00:08
858500 -- [-793.936] (-793.173) (-792.635) (-793.473) * (-794.787) [-795.837] (-793.135) (-792.634) -- 0:00:08
859000 -- (-794.155) [-792.046] (-793.304) (-792.206) * [-792.362] (-795.625) (-792.587) (-793.468) -- 0:00:08
859500 -- [-793.537] (-795.364) (-794.858) (-793.618) * (-795.876) [-798.992] (-792.421) (-793.528) -- 0:00:08
860000 -- [-792.726] (-795.231) (-798.065) (-793.806) * (-792.549) (-793.206) (-792.421) [-793.069] -- 0:00:08
Average standard deviation of split frequencies: 0.009174
860500 -- (-793.891) (-792.623) (-796.393) [-794.386] * (-794.416) [-792.005] (-791.598) (-794.279) -- 0:00:08
861000 -- [-793.044] (-793.337) (-796.687) (-793.154) * [-793.019] (-793.797) (-792.228) (-793.268) -- 0:00:08
861500 -- (-795.659) (-793.327) [-796.223] (-793.194) * (-795.112) [-793.859] (-796.886) (-794.106) -- 0:00:08
862000 -- [-796.185] (-792.360) (-793.842) (-794.475) * (-793.983) [-792.116] (-793.147) (-794.254) -- 0:00:08
862500 -- (-793.774) (-792.901) (-793.733) [-793.622] * (-793.411) (-792.367) (-793.790) [-796.164] -- 0:00:08
863000 -- (-793.163) (-798.971) [-794.247] (-794.610) * (-796.294) (-793.219) [-793.166] (-792.845) -- 0:00:08
863500 -- (-793.082) (-793.302) (-796.151) [-795.765] * [-794.909] (-799.900) (-793.636) (-794.536) -- 0:00:08
864000 -- (-793.783) (-798.405) (-791.788) [-792.711] * (-793.234) (-795.899) (-792.679) [-792.247] -- 0:00:08
864500 -- (-796.142) (-800.699) [-796.627] (-792.656) * (-793.488) (-795.577) (-793.717) [-796.361] -- 0:00:08
865000 -- (-792.863) (-792.067) (-793.057) [-795.284] * (-793.221) [-792.727] (-794.576) (-793.889) -- 0:00:08
Average standard deviation of split frequencies: 0.009424
865500 -- (-796.255) (-793.339) (-793.277) [-792.498] * (-794.187) (-793.767) [-795.292] (-800.377) -- 0:00:08
866000 -- (-796.183) [-793.757] (-795.779) (-792.242) * (-793.331) [-793.049] (-795.614) (-796.756) -- 0:00:08
866500 -- [-794.622] (-795.047) (-795.348) (-793.288) * (-793.862) (-793.659) (-792.916) [-797.227] -- 0:00:08
867000 -- (-798.318) [-793.901] (-800.137) (-793.162) * (-793.064) [-794.432] (-794.250) (-792.993) -- 0:00:08
867500 -- (-802.055) (-793.405) (-796.497) [-793.205] * [-797.846] (-794.341) (-794.786) (-792.617) -- 0:00:08
868000 -- (-797.598) (-792.301) (-792.572) [-793.731] * [-797.187] (-792.335) (-792.617) (-793.353) -- 0:00:08
868500 -- [-792.746] (-792.576) (-800.992) (-793.125) * [-793.240] (-794.602) (-792.378) (-793.932) -- 0:00:08
869000 -- (-793.432) [-794.899] (-793.966) (-794.700) * (-794.013) (-794.252) (-793.759) [-795.376] -- 0:00:07
869500 -- (-793.155) (-792.270) [-794.416] (-794.759) * (-791.987) (-792.952) [-792.621] (-796.922) -- 0:00:07
870000 -- (-794.209) (-792.642) [-797.388] (-793.446) * (-792.599) (-794.634) (-792.360) [-798.670] -- 0:00:07
Average standard deviation of split frequencies: 0.009712
870500 -- (-795.120) (-795.438) (-793.642) [-793.281] * (-794.293) [-795.717] (-793.160) (-795.274) -- 0:00:07
871000 -- (-793.749) [-796.507] (-793.331) (-792.157) * (-792.730) (-793.976) [-791.624] (-793.865) -- 0:00:07
871500 -- (-798.883) [-794.282] (-793.718) (-791.596) * (-793.469) (-795.972) (-793.503) [-795.585] -- 0:00:07
872000 -- (-797.034) [-792.956] (-793.134) (-794.867) * (-792.935) [-791.635] (-793.297) (-792.884) -- 0:00:07
872500 -- [-792.509] (-792.745) (-792.936) (-799.027) * (-793.213) (-791.723) [-793.465] (-793.415) -- 0:00:07
873000 -- (-794.436) (-791.741) (-794.535) [-798.746] * (-792.906) (-792.724) [-794.900] (-792.939) -- 0:00:07
873500 -- (-797.917) (-798.574) [-796.052] (-802.945) * [-793.268] (-797.091) (-794.279) (-793.643) -- 0:00:07
874000 -- (-792.463) (-793.340) (-792.103) [-791.415] * [-794.311] (-795.144) (-797.828) (-795.393) -- 0:00:07
874500 -- [-794.871] (-793.288) (-794.258) (-792.938) * (-796.291) [-792.335] (-792.735) (-794.040) -- 0:00:07
875000 -- (-792.951) (-793.854) (-797.488) [-792.024] * (-792.561) [-791.910] (-799.124) (-795.689) -- 0:00:07
Average standard deviation of split frequencies: 0.009518
875500 -- [-793.169] (-795.304) (-792.587) (-794.042) * (-792.287) (-793.112) [-791.838] (-794.408) -- 0:00:07
876000 -- (-793.055) (-795.598) (-792.013) [-792.208] * (-793.894) (-794.018) (-791.421) [-793.264] -- 0:00:07
876500 -- [-791.632] (-791.859) (-793.870) (-794.307) * [-791.399] (-795.151) (-792.050) (-793.749) -- 0:00:07
877000 -- (-791.946) (-793.622) [-794.435] (-796.784) * (-791.640) [-792.448] (-792.797) (-795.674) -- 0:00:07
877500 -- [-791.564] (-793.230) (-793.159) (-793.908) * [-791.467] (-795.230) (-791.820) (-796.125) -- 0:00:07
878000 -- (-795.395) [-792.190] (-794.281) (-792.631) * [-792.310] (-793.035) (-794.557) (-795.147) -- 0:00:07
878500 -- (-794.210) [-791.605] (-792.519) (-792.475) * [-793.299] (-793.614) (-793.609) (-792.666) -- 0:00:07
879000 -- (-795.489) [-793.072] (-794.151) (-793.516) * [-793.187] (-791.852) (-792.221) (-792.226) -- 0:00:07
879500 -- (-795.900) (-792.522) [-792.579] (-793.393) * (-793.427) (-792.169) [-794.139] (-791.848) -- 0:00:07
880000 -- (-792.351) (-797.493) (-791.859) [-795.316] * (-793.729) (-792.651) (-792.553) [-794.528] -- 0:00:07
Average standard deviation of split frequencies: 0.009367
880500 -- (-792.703) (-798.339) [-794.221] (-792.627) * [-792.995] (-793.645) (-795.923) (-794.612) -- 0:00:07
881000 -- (-792.082) (-797.241) (-793.437) [-792.384] * [-793.110] (-792.782) (-792.987) (-794.299) -- 0:00:07
881500 -- [-791.940] (-798.769) (-794.481) (-791.933) * (-793.560) [-792.168] (-792.859) (-793.215) -- 0:00:07
882000 -- (-794.543) (-795.990) (-795.235) [-792.537] * (-795.933) [-792.482] (-792.458) (-792.104) -- 0:00:07
882500 -- [-791.647] (-792.829) (-796.435) (-791.801) * (-795.340) (-792.942) [-792.078] (-792.149) -- 0:00:07
883000 -- (-792.536) (-791.898) (-793.231) [-794.195] * [-793.202] (-792.746) (-794.621) (-793.317) -- 0:00:07
883500 -- (-795.982) (-794.193) [-792.454] (-794.195) * (-793.633) (-794.420) (-793.256) [-791.541] -- 0:00:07
884000 -- [-794.043] (-795.272) (-796.951) (-798.172) * (-795.326) (-795.166) (-792.488) [-792.290] -- 0:00:07
884500 -- (-793.884) (-794.885) [-792.446] (-793.183) * (-797.525) (-793.853) [-792.477] (-795.911) -- 0:00:07
885000 -- [-793.884] (-792.949) (-792.609) (-795.619) * (-796.253) [-792.753] (-796.245) (-798.598) -- 0:00:07
Average standard deviation of split frequencies: 0.008446
885500 -- (-794.003) [-794.439] (-794.627) (-794.255) * [-792.225] (-798.402) (-794.257) (-793.911) -- 0:00:06
886000 -- [-797.700] (-792.336) (-795.433) (-793.148) * [-793.888] (-794.103) (-796.695) (-798.305) -- 0:00:06
886500 -- (-795.079) [-792.051] (-793.148) (-794.886) * (-794.753) (-792.354) (-794.550) [-797.678] -- 0:00:06
887000 -- (-794.543) (-792.037) [-792.971] (-793.078) * (-794.513) [-793.510] (-793.274) (-797.912) -- 0:00:06
887500 -- (-793.953) (-793.902) [-794.496] (-792.706) * (-794.423) [-792.946] (-796.812) (-798.089) -- 0:00:06
888000 -- (-793.194) [-794.455] (-793.345) (-792.988) * (-792.453) (-794.697) [-796.079] (-794.470) -- 0:00:06
888500 -- [-792.943] (-794.889) (-794.025) (-794.722) * (-793.918) (-792.842) (-792.334) [-796.617] -- 0:00:06
889000 -- (-793.066) (-795.869) [-793.612] (-796.088) * (-791.688) [-793.580] (-793.412) (-792.554) -- 0:00:06
889500 -- (-793.675) [-793.427] (-792.134) (-794.562) * (-793.365) (-792.916) [-793.233] (-794.011) -- 0:00:06
890000 -- (-794.397) (-794.199) [-792.873] (-794.452) * (-792.577) (-793.058) [-792.225] (-797.265) -- 0:00:06
Average standard deviation of split frequencies: 0.007586
890500 -- [-793.372] (-794.796) (-793.336) (-791.886) * (-794.909) [-793.752] (-796.193) (-793.785) -- 0:00:06
891000 -- (-793.385) [-792.410] (-793.857) (-795.292) * (-793.507) [-792.395] (-795.886) (-793.391) -- 0:00:06
891500 -- (-794.219) (-793.559) [-792.271] (-793.523) * [-794.886] (-793.072) (-794.371) (-794.035) -- 0:00:06
892000 -- (-799.804) (-793.195) (-792.658) [-794.580] * (-792.228) (-792.654) [-794.789] (-794.292) -- 0:00:06
892500 -- (-797.399) [-792.925] (-794.458) (-793.960) * (-795.103) (-792.259) [-795.601] (-791.702) -- 0:00:06
893000 -- (-792.962) [-792.777] (-792.962) (-793.909) * (-794.384) (-793.151) (-801.585) [-792.238] -- 0:00:06
893500 -- (-792.535) (-794.352) (-794.721) [-792.787] * [-792.525] (-792.526) (-797.157) (-793.375) -- 0:00:06
894000 -- [-793.532] (-793.340) (-793.964) (-794.744) * [-791.686] (-792.669) (-794.135) (-795.310) -- 0:00:06
894500 -- (-797.959) (-797.371) [-794.032] (-793.833) * [-793.773] (-793.835) (-792.974) (-792.168) -- 0:00:06
895000 -- [-794.718] (-799.116) (-795.067) (-794.326) * (-793.544) (-795.073) [-792.918] (-793.109) -- 0:00:06
Average standard deviation of split frequencies: 0.007716
895500 -- [-797.334] (-792.454) (-791.941) (-794.377) * (-792.260) (-793.718) [-792.998] (-796.836) -- 0:00:06
896000 -- [-793.162] (-794.707) (-792.503) (-791.339) * (-792.700) (-795.772) (-792.908) [-794.456] -- 0:00:06
896500 -- [-792.362] (-794.997) (-793.650) (-791.737) * (-794.704) [-793.716] (-792.957) (-793.260) -- 0:00:06
897000 -- (-791.635) (-794.127) (-795.251) [-792.420] * (-793.957) [-793.021] (-793.222) (-797.498) -- 0:00:06
897500 -- [-791.840] (-795.289) (-794.685) (-793.338) * [-792.627] (-792.973) (-796.220) (-794.043) -- 0:00:06
898000 -- (-791.847) (-796.226) (-792.976) [-793.050] * (-792.549) [-791.685] (-793.496) (-796.890) -- 0:00:06
898500 -- (-794.765) (-795.525) [-794.665] (-795.374) * [-793.028] (-792.023) (-794.545) (-793.747) -- 0:00:06
899000 -- [-792.695] (-796.583) (-793.072) (-793.262) * (-793.528) (-794.424) (-794.308) [-791.672] -- 0:00:06
899500 -- (-793.125) (-794.008) [-794.209] (-793.664) * (-792.121) (-791.535) (-793.275) [-791.737] -- 0:00:06
900000 -- (-795.441) (-794.024) (-795.122) [-794.638] * (-792.165) [-794.079] (-792.599) (-795.419) -- 0:00:06
Average standard deviation of split frequencies: 0.007711
900500 -- [-791.449] (-791.804) (-791.834) (-796.954) * (-793.798) (-793.755) (-796.111) [-795.341] -- 0:00:06
901000 -- [-795.184] (-795.883) (-793.353) (-791.822) * [-792.240] (-794.692) (-794.717) (-794.061) -- 0:00:06
901500 -- (-792.517) [-793.898] (-792.143) (-791.827) * (-797.521) (-796.759) (-793.220) [-792.865] -- 0:00:06
902000 -- [-792.723] (-796.559) (-792.187) (-791.911) * (-796.517) (-793.301) (-794.419) [-795.936] -- 0:00:05
902500 -- (-794.346) (-795.233) [-793.857] (-793.056) * (-799.202) [-792.440] (-794.767) (-793.762) -- 0:00:05
903000 -- (-794.767) [-795.659] (-794.685) (-792.725) * (-792.384) (-792.095) [-795.076] (-797.432) -- 0:00:05
903500 -- (-794.390) (-797.887) (-793.650) [-793.578] * (-791.595) (-793.785) (-794.214) [-793.350] -- 0:00:05
904000 -- (-795.496) (-798.877) (-792.416) [-793.714] * (-793.657) (-792.004) [-793.556] (-792.793) -- 0:00:05
904500 -- (-796.465) (-797.389) (-791.913) [-796.263] * (-792.879) (-793.388) [-793.851] (-793.227) -- 0:00:05
905000 -- (-795.453) (-799.175) [-793.076] (-794.585) * (-793.981) [-793.846] (-795.248) (-794.100) -- 0:00:05
Average standard deviation of split frequencies: 0.008013
905500 -- (-795.752) [-795.826] (-791.547) (-794.295) * (-794.231) [-793.364] (-792.230) (-795.267) -- 0:00:05
906000 -- (-793.541) [-793.109] (-792.520) (-801.271) * (-794.246) [-792.889] (-797.407) (-794.691) -- 0:00:05
906500 -- [-792.972] (-793.340) (-796.118) (-795.501) * [-794.355] (-793.516) (-793.394) (-797.623) -- 0:00:05
907000 -- [-792.221] (-791.988) (-794.873) (-792.636) * [-796.071] (-794.858) (-792.185) (-801.898) -- 0:00:05
907500 -- [-794.654] (-794.143) (-792.558) (-794.482) * (-793.861) (-792.587) [-792.606] (-793.274) -- 0:00:05
908000 -- [-792.303] (-792.422) (-792.024) (-795.422) * (-795.394) [-792.626] (-793.056) (-797.212) -- 0:00:05
908500 -- (-792.586) [-791.311] (-793.995) (-793.034) * (-794.684) [-794.184] (-792.716) (-793.554) -- 0:00:05
909000 -- (-793.063) (-792.963) [-794.967] (-793.245) * (-791.864) (-794.683) (-794.353) [-794.792] -- 0:00:05
909500 -- (-792.521) (-793.188) (-795.156) [-791.726] * (-795.591) (-792.504) (-792.074) [-796.997] -- 0:00:05
910000 -- [-793.148] (-792.851) (-795.301) (-793.184) * (-792.916) [-793.599] (-792.100) (-796.049) -- 0:00:05
Average standard deviation of split frequencies: 0.008282
910500 -- (-793.724) (-792.685) (-794.102) [-795.614] * [-792.698] (-792.607) (-792.827) (-794.761) -- 0:00:05
911000 -- [-792.336] (-794.610) (-792.685) (-793.023) * [-792.657] (-794.300) (-793.808) (-795.202) -- 0:00:05
911500 -- (-796.338) (-795.139) (-792.757) [-792.626] * (-794.139) [-792.972] (-791.695) (-793.599) -- 0:00:05
912000 -- [-793.397] (-794.918) (-792.055) (-800.918) * [-793.084] (-794.805) (-797.857) (-793.813) -- 0:00:05
912500 -- (-795.328) [-795.485] (-793.554) (-795.108) * (-792.423) (-796.643) [-794.163] (-793.835) -- 0:00:05
913000 -- [-791.966] (-792.769) (-794.443) (-795.571) * (-793.414) (-795.909) [-795.252] (-794.746) -- 0:00:05
913500 -- (-794.166) [-794.969] (-795.647) (-793.835) * (-794.928) (-792.533) (-794.833) [-792.997] -- 0:00:05
914000 -- (-792.770) (-795.807) (-795.621) [-795.248] * (-794.438) (-793.287) [-791.604] (-793.594) -- 0:00:05
914500 -- (-794.278) [-798.492] (-798.525) (-793.978) * [-793.379] (-792.928) (-791.975) (-794.941) -- 0:00:05
915000 -- [-792.927] (-793.306) (-793.433) (-795.256) * [-794.139] (-795.647) (-791.633) (-794.162) -- 0:00:05
Average standard deviation of split frequencies: 0.008200
915500 -- (-791.615) [-792.667] (-793.417) (-795.686) * (-792.946) (-792.195) [-792.548] (-795.260) -- 0:00:05
916000 -- (-792.999) (-793.900) (-797.507) [-796.299] * [-792.400] (-793.568) (-794.183) (-796.081) -- 0:00:05
916500 -- (-791.909) (-792.066) [-792.384] (-794.883) * (-794.020) (-792.516) (-793.972) [-795.489] -- 0:00:05
917000 -- (-791.775) (-797.309) [-794.976] (-793.358) * (-793.230) (-792.148) (-791.321) [-793.297] -- 0:00:05
917500 -- (-794.290) (-794.397) (-795.447) [-797.320] * (-792.879) [-792.146] (-794.341) (-791.610) -- 0:00:05
918000 -- (-794.512) [-792.299] (-794.139) (-795.387) * (-794.979) (-797.869) (-796.624) [-792.888] -- 0:00:05
918500 -- (-792.821) [-791.834] (-793.924) (-795.420) * (-792.868) [-796.769] (-794.759) (-792.188) -- 0:00:04
919000 -- (-798.304) (-792.632) (-798.213) [-794.129] * [-793.398] (-797.620) (-792.518) (-792.387) -- 0:00:04
919500 -- [-797.801] (-798.075) (-792.541) (-791.648) * (-793.026) (-798.385) [-793.875] (-791.674) -- 0:00:04
920000 -- (-794.588) [-793.789] (-793.981) (-792.689) * (-794.640) (-793.802) (-794.275) [-791.618] -- 0:00:04
Average standard deviation of split frequencies: 0.008431
920500 -- (-800.112) [-794.428] (-797.538) (-792.957) * [-794.787] (-793.247) (-794.160) (-793.897) -- 0:00:04
921000 -- (-793.012) (-793.475) (-791.937) [-792.976] * (-795.548) (-797.116) [-791.738] (-792.093) -- 0:00:04
921500 -- (-792.548) [-793.646] (-796.407) (-793.902) * (-792.394) [-793.471] (-793.177) (-795.994) -- 0:00:04
922000 -- (-795.252) [-792.938] (-793.052) (-794.551) * (-793.111) (-792.346) (-792.062) [-792.950] -- 0:00:04
922500 -- (-796.531) (-794.219) (-794.458) [-794.006] * (-791.929) (-792.883) [-793.190] (-791.485) -- 0:00:04
923000 -- (-794.332) (-793.106) [-794.344] (-795.787) * (-792.667) (-791.444) (-794.266) [-792.574] -- 0:00:04
923500 -- [-799.499] (-793.160) (-796.189) (-794.604) * (-793.626) (-795.208) [-794.983] (-794.848) -- 0:00:04
924000 -- (-797.456) (-794.996) (-794.685) [-793.507] * (-793.927) [-795.251] (-792.858) (-794.940) -- 0:00:04
924500 -- (-797.177) (-799.008) (-793.909) [-795.008] * (-793.613) (-793.972) [-792.825] (-792.441) -- 0:00:04
925000 -- (-796.297) (-792.329) [-793.158] (-793.657) * (-794.505) [-792.208] (-793.850) (-792.204) -- 0:00:04
Average standard deviation of split frequencies: 0.008111
925500 -- (-793.700) (-793.401) (-800.174) [-792.172] * (-795.125) [-792.553] (-798.930) (-796.884) -- 0:00:04
926000 -- (-795.068) (-794.531) [-791.571] (-795.152) * (-796.161) (-793.706) [-792.820] (-793.026) -- 0:00:04
926500 -- (-797.189) (-795.400) (-793.837) [-796.344] * (-795.578) [-792.046] (-792.640) (-792.777) -- 0:00:04
927000 -- (-793.907) (-794.934) (-795.391) [-795.216] * (-796.706) (-792.839) (-793.015) [-791.631] -- 0:00:04
927500 -- (-795.574) [-794.153] (-795.277) (-797.474) * [-795.248] (-792.479) (-795.944) (-793.201) -- 0:00:04
928000 -- (-793.634) (-794.652) [-795.103] (-793.537) * (-792.632) (-792.641) [-798.491] (-792.837) -- 0:00:04
928500 -- [-792.806] (-797.304) (-796.656) (-792.404) * (-791.945) (-792.819) (-793.972) [-791.955] -- 0:00:04
929000 -- (-793.248) [-793.628] (-796.395) (-792.319) * [-792.696] (-795.559) (-794.864) (-792.548) -- 0:00:04
929500 -- (-795.846) [-796.191] (-794.328) (-792.716) * (-792.269) (-793.029) (-794.676) [-795.299] -- 0:00:04
930000 -- (-792.277) [-799.590] (-794.907) (-794.922) * (-792.939) [-794.342] (-794.299) (-793.182) -- 0:00:04
Average standard deviation of split frequencies: 0.008172
930500 -- (-795.124) [-792.443] (-792.444) (-793.362) * (-792.633) (-794.242) (-794.760) [-793.585] -- 0:00:04
931000 -- (-794.888) [-791.637] (-794.346) (-794.411) * (-792.820) (-793.019) [-795.723] (-796.628) -- 0:00:04
931500 -- [-792.263] (-792.936) (-794.642) (-792.186) * (-798.118) (-797.224) (-795.242) [-794.132] -- 0:00:04
932000 -- (-792.322) (-793.143) (-794.989) [-791.857] * (-795.321) (-793.132) (-794.969) [-792.357] -- 0:00:04
932500 -- [-793.842] (-793.955) (-794.867) (-792.929) * (-794.477) [-791.957] (-792.391) (-791.691) -- 0:00:04
933000 -- (-792.042) (-795.146) (-796.157) [-797.565] * (-800.769) (-793.940) [-793.553] (-791.589) -- 0:00:04
933500 -- (-795.775) [-795.252] (-793.316) (-792.998) * (-794.285) (-794.320) [-795.635] (-794.560) -- 0:00:04
934000 -- (-791.867) (-794.005) (-792.969) [-793.202] * [-793.786] (-793.187) (-795.614) (-791.645) -- 0:00:04
934500 -- (-792.451) (-795.820) (-792.367) [-795.025] * [-791.845] (-791.587) (-793.689) (-792.398) -- 0:00:03
935000 -- (-794.515) (-793.241) [-796.154] (-794.178) * [-792.853] (-792.730) (-794.018) (-792.335) -- 0:00:03
Average standard deviation of split frequencies: 0.008360
935500 -- [-793.494] (-792.844) (-792.484) (-796.979) * (-799.105) [-792.678] (-795.608) (-793.099) -- 0:00:03
936000 -- (-794.787) (-794.351) [-792.525] (-792.983) * (-795.618) (-792.302) (-795.181) [-794.055] -- 0:00:03
936500 -- (-793.344) [-793.117] (-796.661) (-792.972) * (-796.379) (-792.347) [-792.863] (-794.181) -- 0:00:03
937000 -- [-793.580] (-791.515) (-793.192) (-793.801) * (-792.852) (-794.110) [-793.867] (-794.526) -- 0:00:03
937500 -- (-794.881) (-795.910) [-791.379] (-794.303) * (-793.977) (-793.542) [-792.365] (-793.728) -- 0:00:03
938000 -- (-797.651) (-794.349) (-792.172) [-795.655] * (-793.775) (-798.096) [-793.374] (-794.166) -- 0:00:03
938500 -- [-795.131] (-792.211) (-795.098) (-795.484) * (-794.501) (-792.755) (-792.117) [-794.519] -- 0:00:03
939000 -- (-791.517) (-791.651) [-793.162] (-795.940) * (-795.650) [-793.712] (-795.884) (-793.065) -- 0:00:03
939500 -- (-793.924) [-791.612] (-793.353) (-793.945) * (-792.792) [-793.480] (-796.546) (-791.350) -- 0:00:03
940000 -- (-793.304) (-796.479) [-794.175] (-792.790) * (-792.765) (-793.853) [-795.933] (-793.528) -- 0:00:03
Average standard deviation of split frequencies: 0.008653
940500 -- (-795.553) [-794.217] (-793.519) (-792.821) * [-793.365] (-800.090) (-793.558) (-794.729) -- 0:00:03
941000 -- (-792.947) (-791.325) [-794.158] (-793.233) * (-795.761) (-795.712) [-794.867] (-794.060) -- 0:00:03
941500 -- (-796.975) [-791.568] (-792.614) (-792.772) * [-791.839] (-797.794) (-794.544) (-794.226) -- 0:00:03
942000 -- [-791.556] (-792.951) (-796.386) (-793.057) * (-792.364) [-791.847] (-792.809) (-792.074) -- 0:00:03
942500 -- (-793.754) (-795.240) (-794.297) [-793.205] * [-793.581] (-797.264) (-792.491) (-793.104) -- 0:00:03
943000 -- (-793.802) [-793.076] (-798.788) (-795.307) * [-797.692] (-793.691) (-791.888) (-795.994) -- 0:00:03
943500 -- (-794.007) [-793.385] (-797.296) (-795.698) * [-796.853] (-792.562) (-792.491) (-791.966) -- 0:00:03
944000 -- [-794.176] (-792.794) (-793.057) (-794.512) * (-793.502) (-791.693) (-793.101) [-792.270] -- 0:00:03
944500 -- (-794.378) (-792.458) (-793.714) [-793.137] * (-793.806) (-793.478) (-793.096) [-792.142] -- 0:00:03
945000 -- (-799.244) (-794.672) [-791.707] (-793.472) * (-791.528) [-793.782] (-793.408) (-794.028) -- 0:00:03
Average standard deviation of split frequencies: 0.008671
945500 -- (-794.456) (-795.875) (-791.993) [-793.369] * (-792.476) [-792.346] (-791.847) (-794.986) -- 0:00:03
946000 -- (-794.467) [-795.133] (-793.347) (-792.374) * (-791.904) (-792.020) [-792.406] (-794.553) -- 0:00:03
946500 -- (-794.809) (-793.423) [-794.466] (-795.498) * (-796.646) (-792.008) [-795.448] (-793.710) -- 0:00:03
947000 -- [-793.990] (-793.728) (-793.294) (-796.655) * (-796.239) [-792.673] (-793.644) (-793.052) -- 0:00:03
947500 -- (-792.204) [-793.126] (-795.550) (-796.758) * (-792.621) (-799.565) (-793.552) [-792.747] -- 0:00:03
948000 -- (-791.942) (-793.854) (-794.742) [-796.246] * [-793.901] (-796.126) (-793.408) (-793.328) -- 0:00:03
948500 -- [-795.823] (-793.212) (-795.667) (-792.467) * (-793.465) (-794.346) (-793.416) [-793.637] -- 0:00:03
949000 -- (-795.387) (-793.346) [-791.971] (-794.168) * [-793.387] (-792.309) (-791.752) (-793.586) -- 0:00:03
949500 -- (-793.549) (-797.344) [-791.890] (-795.020) * (-794.903) [-794.608] (-793.209) (-794.548) -- 0:00:03
950000 -- [-792.520] (-793.513) (-791.741) (-796.038) * [-792.508] (-792.281) (-794.214) (-796.032) -- 0:00:03
Average standard deviation of split frequencies: 0.009124
950500 -- [-791.797] (-792.712) (-791.879) (-793.435) * (-793.205) (-793.741) (-796.554) [-792.333] -- 0:00:03
951000 -- (-797.433) (-793.400) [-793.792] (-792.183) * (-796.477) [-792.417] (-797.205) (-792.266) -- 0:00:02
951500 -- (-795.979) (-794.654) [-792.432] (-791.586) * (-795.172) [-792.557] (-793.348) (-793.781) -- 0:00:02
952000 -- (-795.714) (-794.314) (-797.587) [-791.957] * (-793.921) (-795.935) (-794.254) [-797.475] -- 0:00:02
952500 -- [-794.814] (-792.654) (-792.324) (-794.790) * (-793.411) (-792.612) (-794.316) [-797.206] -- 0:00:02
953000 -- [-793.386] (-793.237) (-794.776) (-796.354) * (-794.367) [-797.872] (-792.111) (-797.854) -- 0:00:02
953500 -- (-792.679) [-792.851] (-800.803) (-795.073) * (-793.745) (-792.365) [-795.176] (-795.890) -- 0:00:02
954000 -- [-792.615] (-794.212) (-798.745) (-794.262) * (-795.416) (-796.637) [-793.717] (-794.600) -- 0:00:02
954500 -- (-792.850) [-792.543] (-795.836) (-792.845) * (-797.984) (-793.221) (-797.069) [-794.846] -- 0:00:02
955000 -- (-793.640) (-792.381) [-793.587] (-792.845) * (-794.292) (-793.795) [-792.973] (-794.197) -- 0:00:02
Average standard deviation of split frequencies: 0.009468
955500 -- (-792.615) [-792.267] (-798.852) (-794.674) * [-793.792] (-793.053) (-794.575) (-795.346) -- 0:00:02
956000 -- (-792.555) (-792.995) (-792.504) [-796.884] * (-792.781) (-794.467) (-792.624) [-796.398] -- 0:00:02
956500 -- (-793.288) (-791.742) [-792.234] (-792.495) * (-793.623) [-796.751] (-792.696) (-795.388) -- 0:00:02
957000 -- (-795.978) (-793.776) [-793.330] (-791.683) * (-792.726) (-794.121) [-791.330] (-793.644) -- 0:00:02
957500 -- (-792.707) (-795.187) (-792.915) [-793.350] * [-794.108] (-798.491) (-793.203) (-792.740) -- 0:00:02
958000 -- [-792.942] (-794.989) (-793.742) (-796.034) * (-795.068) (-795.129) [-797.186] (-797.399) -- 0:00:02
958500 -- [-792.026] (-793.093) (-792.897) (-794.478) * (-792.613) (-793.160) (-794.187) [-795.040] -- 0:00:02
959000 -- (-793.027) [-792.940] (-793.435) (-797.055) * (-792.692) (-795.386) (-793.889) [-793.937] -- 0:00:02
959500 -- (-797.115) (-793.647) (-794.154) [-793.985] * (-792.476) (-794.323) [-794.214] (-794.722) -- 0:00:02
960000 -- (-794.213) (-792.070) [-792.239] (-793.076) * (-792.031) [-793.657] (-795.588) (-794.913) -- 0:00:02
Average standard deviation of split frequencies: 0.009618
960500 -- (-797.933) [-793.754] (-792.774) (-792.675) * [-794.732] (-792.008) (-792.041) (-793.470) -- 0:00:02
961000 -- [-796.150] (-793.922) (-792.538) (-793.367) * [-792.423] (-792.702) (-793.953) (-791.520) -- 0:00:02
961500 -- (-798.938) (-792.608) (-792.255) [-793.096] * [-791.849] (-795.877) (-794.352) (-792.115) -- 0:00:02
962000 -- (-794.350) (-793.709) [-792.524] (-799.022) * (-792.535) (-792.716) (-792.627) [-792.847] -- 0:00:02
962500 -- (-792.445) (-793.264) (-796.790) [-793.743] * (-792.404) (-793.796) (-792.998) [-798.147] -- 0:00:02
963000 -- (-793.130) (-792.624) (-796.077) [-796.236] * (-791.870) [-792.879] (-798.236) (-794.671) -- 0:00:02
963500 -- [-796.178] (-793.304) (-800.208) (-793.590) * (-792.204) (-793.899) (-793.787) [-792.483] -- 0:00:02
964000 -- [-793.623] (-796.186) (-792.066) (-797.832) * (-794.356) (-798.938) [-793.379] (-792.436) -- 0:00:02
964500 -- (-794.518) (-792.463) (-791.722) [-792.539] * [-793.065] (-793.397) (-795.851) (-792.623) -- 0:00:02
965000 -- [-792.606] (-794.019) (-793.720) (-793.631) * (-795.366) (-793.177) (-793.789) [-791.477] -- 0:00:02
Average standard deviation of split frequencies: 0.009760
965500 -- (-795.711) (-793.452) [-793.643] (-793.168) * (-793.864) (-794.036) (-792.130) [-792.767] -- 0:00:02
966000 -- [-794.910] (-791.847) (-793.187) (-792.820) * (-791.671) (-793.977) [-793.197] (-794.404) -- 0:00:02
966500 -- (-791.921) [-791.771] (-792.059) (-792.710) * (-797.603) (-793.125) [-792.195] (-793.735) -- 0:00:02
967000 -- (-794.776) [-792.345] (-793.416) (-792.445) * [-793.926] (-794.125) (-794.894) (-793.599) -- 0:00:02
967500 -- [-793.769] (-792.326) (-794.342) (-797.059) * (-795.065) (-793.006) (-793.045) [-792.555] -- 0:00:01
968000 -- (-798.275) (-793.623) (-793.840) [-793.047] * (-792.458) [-793.452] (-792.553) (-793.590) -- 0:00:01
968500 -- (-793.240) (-794.945) (-792.036) [-793.820] * (-792.597) [-796.859] (-793.703) (-792.710) -- 0:00:01
969000 -- (-793.597) (-793.070) [-791.915] (-794.780) * [-794.458] (-792.891) (-795.323) (-795.099) -- 0:00:01
969500 -- (-797.604) [-793.796] (-792.988) (-792.745) * (-796.538) (-794.259) (-795.275) [-792.360] -- 0:00:01
970000 -- (-796.627) (-794.498) (-793.734) [-792.394] * [-793.547] (-798.807) (-792.182) (-794.416) -- 0:00:01
Average standard deviation of split frequencies: 0.009810
970500 -- [-793.223] (-794.183) (-795.155) (-794.148) * (-793.427) (-795.579) (-794.243) [-791.797] -- 0:00:01
971000 -- [-795.756] (-794.665) (-791.729) (-792.930) * (-794.642) [-792.140] (-794.616) (-792.760) -- 0:00:01
971500 -- (-793.044) (-794.894) [-794.946] (-795.176) * (-793.306) (-791.756) (-793.598) [-793.194] -- 0:00:01
972000 -- (-792.072) [-794.355] (-797.017) (-793.777) * (-795.333) [-792.365] (-793.329) (-792.240) -- 0:00:01
972500 -- (-792.425) [-792.162] (-795.834) (-792.752) * (-792.120) (-793.763) (-793.733) [-794.727] -- 0:00:01
973000 -- [-793.149] (-794.495) (-795.861) (-792.122) * (-794.884) (-796.876) (-796.003) [-792.852] -- 0:00:01
973500 -- (-794.879) [-793.590] (-793.823) (-796.521) * (-794.475) [-796.929] (-798.430) (-793.942) -- 0:00:01
974000 -- (-795.254) [-792.443] (-792.174) (-794.425) * (-796.352) (-792.887) [-794.194] (-798.271) -- 0:00:01
974500 -- [-793.539] (-793.759) (-792.566) (-791.886) * [-794.489] (-798.444) (-795.782) (-793.688) -- 0:00:01
975000 -- (-794.058) [-796.987] (-793.048) (-792.139) * (-793.470) [-795.149] (-794.785) (-796.112) -- 0:00:01
Average standard deviation of split frequencies: 0.009821
975500 -- (-792.370) [-793.154] (-793.447) (-792.079) * (-794.494) (-795.179) [-795.504] (-793.428) -- 0:00:01
976000 -- (-792.315) (-794.677) [-793.074] (-794.653) * (-794.521) (-796.207) [-796.023] (-796.202) -- 0:00:01
976500 -- (-794.466) [-794.756] (-793.647) (-794.037) * (-797.560) (-802.686) [-795.490] (-793.476) -- 0:00:01
977000 -- (-792.694) (-795.305) [-792.948] (-793.741) * (-794.082) [-797.397] (-794.160) (-793.355) -- 0:00:01
977500 -- (-793.015) (-793.549) [-792.605] (-795.468) * (-793.527) [-795.992] (-793.306) (-792.793) -- 0:00:01
978000 -- (-792.596) (-795.135) (-793.187) [-794.351] * (-793.816) [-796.844] (-792.859) (-797.487) -- 0:00:01
978500 -- (-792.598) (-794.024) (-792.218) [-794.332] * (-793.444) (-791.885) [-794.319] (-794.256) -- 0:00:01
979000 -- (-793.961) (-791.263) (-794.613) [-794.755] * (-793.331) (-791.753) (-794.686) [-793.502] -- 0:00:01
979500 -- [-797.954] (-794.977) (-794.236) (-795.650) * (-793.152) (-794.517) (-792.979) [-793.240] -- 0:00:01
980000 -- (-791.734) (-793.398) (-793.537) [-797.162] * (-796.533) (-793.126) [-793.710] (-796.358) -- 0:00:01
Average standard deviation of split frequencies: 0.009582
980500 -- [-795.120] (-793.784) (-797.119) (-792.659) * [-793.050] (-795.243) (-795.208) (-795.398) -- 0:00:01
981000 -- (-793.428) (-793.994) (-796.638) [-793.146] * (-794.455) [-792.591] (-797.167) (-792.851) -- 0:00:01
981500 -- (-796.320) [-792.890] (-795.422) (-796.864) * (-799.046) (-793.083) [-792.518] (-795.757) -- 0:00:01
982000 -- [-791.437] (-794.191) (-798.906) (-792.008) * (-793.937) (-792.312) (-792.122) [-793.255] -- 0:00:01
982500 -- (-793.550) [-795.970] (-792.325) (-799.580) * (-793.165) (-795.228) [-792.683] (-792.726) -- 0:00:01
983000 -- [-792.032] (-793.895) (-793.172) (-792.007) * (-794.580) (-794.144) [-792.679] (-794.841) -- 0:00:01
983500 -- (-792.316) [-791.951] (-795.883) (-792.821) * (-793.508) (-791.663) (-794.257) [-795.460] -- 0:00:01
984000 -- (-792.454) (-793.801) (-792.263) [-793.002] * (-793.675) (-792.433) [-794.088] (-795.161) -- 0:00:00
984500 -- (-794.134) (-799.575) [-794.517] (-799.198) * (-794.427) (-793.071) [-793.632] (-793.320) -- 0:00:00
985000 -- (-794.763) [-792.952] (-793.020) (-795.666) * (-791.964) (-793.875) [-791.869] (-793.544) -- 0:00:00
Average standard deviation of split frequencies: 0.009562
985500 -- [-792.332] (-794.015) (-792.495) (-795.168) * (-793.327) [-793.003] (-793.921) (-793.721) -- 0:00:00
986000 -- (-792.599) (-797.226) (-792.769) [-791.753] * (-795.084) [-794.139] (-793.547) (-792.041) -- 0:00:00
986500 -- (-796.182) (-793.726) [-794.288] (-791.468) * (-792.019) (-792.659) (-793.651) [-791.980] -- 0:00:00
987000 -- (-795.208) [-791.704] (-793.540) (-792.765) * (-793.775) (-793.759) (-794.652) [-791.792] -- 0:00:00
987500 -- (-796.193) [-792.733] (-795.831) (-793.654) * [-797.732] (-793.011) (-793.952) (-791.856) -- 0:00:00
988000 -- (-794.284) (-791.775) (-797.879) [-793.530] * (-794.957) (-792.657) (-793.379) [-795.087] -- 0:00:00
988500 -- (-798.406) [-791.475] (-791.494) (-796.545) * [-798.892] (-799.233) (-795.606) (-792.620) -- 0:00:00
989000 -- [-792.254] (-793.576) (-797.744) (-796.053) * (-796.051) (-792.328) [-794.915] (-792.331) -- 0:00:00
989500 -- (-797.523) (-798.065) (-793.128) [-794.101] * (-795.835) (-793.065) (-796.543) [-795.197] -- 0:00:00
990000 -- (-796.123) [-799.238] (-794.216) (-794.339) * (-795.042) (-793.074) (-797.038) [-793.120] -- 0:00:00
Average standard deviation of split frequencies: 0.010171
990500 -- (-795.032) [-793.403] (-794.758) (-792.582) * (-795.984) (-792.918) (-794.806) [-793.343] -- 0:00:00
991000 -- (-793.187) (-793.236) (-794.146) [-793.188] * (-795.844) [-794.972] (-792.305) (-794.246) -- 0:00:00
991500 -- (-793.106) (-794.098) (-794.243) [-796.527] * (-792.948) (-798.431) (-794.639) [-792.585] -- 0:00:00
992000 -- (-792.315) [-792.675] (-793.866) (-792.865) * [-792.104] (-795.337) (-795.368) (-794.130) -- 0:00:00
992500 -- (-791.320) (-794.211) (-794.127) [-795.463] * (-794.888) [-792.807] (-797.239) (-793.172) -- 0:00:00
993000 -- [-791.439] (-794.595) (-792.206) (-793.631) * (-797.530) [-794.705] (-796.839) (-796.158) -- 0:00:00
993500 -- (-794.274) [-795.058] (-793.196) (-794.228) * (-793.767) (-793.114) [-796.607] (-792.582) -- 0:00:00
994000 -- [-792.888] (-792.623) (-793.553) (-796.823) * (-794.756) (-793.400) [-793.246] (-795.812) -- 0:00:00
994500 -- (-793.259) [-792.173] (-793.292) (-795.894) * (-794.436) [-793.820] (-794.216) (-796.599) -- 0:00:00
995000 -- [-792.617] (-792.569) (-794.579) (-792.450) * (-797.885) (-793.914) [-793.077] (-792.677) -- 0:00:00
Average standard deviation of split frequencies: 0.009466
995500 -- (-792.962) (-793.820) [-793.275] (-793.109) * (-791.938) [-792.061] (-795.715) (-796.815) -- 0:00:00
996000 -- (-792.840) [-793.003] (-792.244) (-792.438) * (-791.969) [-792.653] (-792.797) (-796.637) -- 0:00:00
996500 -- [-793.991] (-794.231) (-793.830) (-792.012) * (-794.823) (-794.827) (-792.447) [-792.387] -- 0:00:00
997000 -- (-794.985) (-794.208) [-792.200] (-792.575) * (-793.386) (-793.138) (-794.023) [-792.425] -- 0:00:00
997500 -- [-793.126] (-793.957) (-793.305) (-793.502) * [-794.251] (-791.299) (-792.898) (-794.404) -- 0:00:00
998000 -- (-796.390) [-793.953] (-793.041) (-792.250) * [-794.581] (-791.444) (-793.209) (-793.145) -- 0:00:00
998500 -- (-795.137) [-796.764] (-792.736) (-792.841) * [-794.422] (-798.232) (-793.845) (-792.920) -- 0:00:00
999000 -- (-793.355) (-801.038) [-792.764] (-796.143) * (-795.144) (-794.827) [-794.124] (-792.221) -- 0:00:00
999500 -- (-794.588) (-795.743) [-794.155] (-795.225) * (-793.813) (-794.828) [-793.846] (-792.839) -- 0:00:00
1000000 -- (-793.181) (-792.409) (-793.209) [-794.500] * [-794.206] (-791.732) (-792.552) (-795.145) -- 0:00:00
Average standard deviation of split frequencies: 0.009610
Analysis completed in 1 mins 1 seconds
Analysis used 59.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -791.20
Likelihood of best state for "cold" chain of run 2 was -791.20
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.2 % ( 18 %) Dirichlet(Pi{all})
30.2 % ( 24 %) Slider(Pi{all})
79.3 % ( 47 %) Multiplier(Alpha{1,2})
78.1 % ( 50 %) Multiplier(Alpha{3})
22.1 % ( 24 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 58 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 83 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.5 % ( 25 %) Dirichlet(Pi{all})
30.9 % ( 22 %) Slider(Pi{all})
78.5 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 58 %) Multiplier(Alpha{3})
22.3 % ( 25 %) Slider(Pinvar{all})
98.5 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.8 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166284 0.82 0.67
3 | 167344 167148 0.84
4 | 166115 166663 166446
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166590 0.82 0.67
3 | 166324 166975 0.84
4 | 167214 166905 165992
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -792.89
| 2 2 |
| 1 |
| 1 2 1 |
| 2 1 1 2 2 1 |
| 1 2 2 2 |
| 22 1 22 1 2 1 221 |
| 12 1 21 2 22 2 1 * 1 1 * |
|1 112 1 2 * 1 2 2 *1 1 12 1 1 12 2 2 1|
|2 1 21 1 2 * 2 2 1 2 2 1 |
| 1 2 1 2 1 2 2 1 |
| 11 2 2 121 2 1 2 |
| 22 1 2 11 1 1 2|
| 1 1 1 2 |
| 2 1 1 2 1 |
| 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -794.53
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -792.97 -796.29
2 -792.95 -796.69
--------------------------------------
TOTAL -792.96 -796.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897772 0.089982 0.355598 1.460203 0.863950 1343.88 1419.38 1.000
r(A<->C){all} 0.169610 0.020390 0.000065 0.456099 0.129928 270.09 310.25 1.004
r(A<->G){all} 0.167104 0.019446 0.000043 0.440783 0.128072 233.86 296.14 1.001
r(A<->T){all} 0.160052 0.018389 0.000023 0.420664 0.124792 201.49 234.35 1.000
r(C<->G){all} 0.162032 0.019440 0.000020 0.443227 0.123539 159.62 172.88 1.001
r(C<->T){all} 0.165480 0.020639 0.000014 0.457291 0.122929 100.34 108.06 1.000
r(G<->T){all} 0.175723 0.021684 0.000119 0.466393 0.136385 148.65 223.64 1.000
pi(A){all} 0.143858 0.000212 0.116718 0.173054 0.143601 1342.76 1361.04 1.000
pi(C){all} 0.269710 0.000342 0.233640 0.305209 0.269363 1069.11 1219.97 1.000
pi(G){all} 0.367536 0.000395 0.327609 0.404195 0.366984 1000.65 1070.77 1.000
pi(T){all} 0.218897 0.000300 0.185126 0.251413 0.219189 1057.13 1256.56 1.001
alpha{1,2} 0.415751 0.215669 0.000103 1.363644 0.245073 1010.17 1141.49 1.000
alpha{3} 0.445590 0.228746 0.000198 1.416554 0.279176 1128.75 1189.47 1.000
pinvar{all} 0.997327 0.000010 0.991368 0.999999 0.998376 1254.08 1270.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .***.*
9 -- .****.
10 -- .*.*..
11 -- ..*..*
12 -- ...*.*
13 -- ..****
14 -- ....**
15 -- ..*.*.
16 -- .*..*.
17 -- ...**.
18 -- ..**..
19 -- .*...*
20 -- .**.**
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 468 0.155896 0.001884 0.154564 0.157229 2
8 462 0.153897 0.000000 0.153897 0.153897 2
9 461 0.153564 0.020257 0.139241 0.167888 2
10 456 0.151899 0.016017 0.140573 0.163225 2
11 438 0.145903 0.026381 0.127249 0.164557 2
12 431 0.143571 0.003298 0.141239 0.145903 2
13 428 0.142572 0.001884 0.141239 0.143904 2
14 427 0.142239 0.004240 0.139241 0.145237 2
15 425 0.141572 0.006124 0.137242 0.145903 2
16 416 0.138574 0.005653 0.134577 0.142572 2
17 415 0.138241 0.008009 0.132578 0.143904 2
18 405 0.134910 0.019315 0.121252 0.148568 2
19 393 0.130913 0.022141 0.115256 0.146569 2
20 392 0.130580 0.005653 0.126582 0.134577 2
21 391 0.130247 0.003298 0.127915 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099861 0.010167 0.000037 0.299433 0.069789 1.000 2
length{all}[2] 0.098959 0.009320 0.000002 0.292768 0.070838 1.000 2
length{all}[3] 0.101244 0.009808 0.000038 0.291028 0.071828 1.001 2
length{all}[4] 0.102867 0.010335 0.000062 0.299942 0.073546 1.000 2
length{all}[5] 0.099147 0.009513 0.000059 0.295346 0.070184 1.000 2
length{all}[6] 0.099962 0.010518 0.000090 0.307068 0.067915 1.000 2
length{all}[7] 0.100765 0.009833 0.000011 0.306353 0.070504 0.999 2
length{all}[8] 0.100768 0.010247 0.000146 0.307571 0.075001 1.000 2
length{all}[9] 0.096478 0.007730 0.000050 0.271861 0.073018 0.999 2
length{all}[10] 0.103019 0.011401 0.000419 0.318187 0.075316 0.998 2
length{all}[11] 0.102449 0.011586 0.000050 0.340908 0.069368 0.998 2
length{all}[12] 0.097227 0.008472 0.000162 0.291460 0.071663 1.003 2
length{all}[13] 0.097595 0.010313 0.000050 0.288058 0.064161 0.999 2
length{all}[14] 0.098671 0.009889 0.000211 0.326546 0.063170 1.005 2
length{all}[15] 0.106479 0.011599 0.000134 0.335716 0.073385 0.998 2
length{all}[16] 0.096197 0.009000 0.000094 0.270038 0.068913 0.998 2
length{all}[17] 0.099035 0.010146 0.000114 0.306793 0.065561 1.000 2
length{all}[18] 0.096065 0.011003 0.000073 0.310913 0.063476 0.998 2
length{all}[19] 0.096496 0.010602 0.000007 0.283174 0.065593 0.997 2
length{all}[20] 0.096584 0.009434 0.000425 0.308858 0.066910 0.998 2
length{all}[21] 0.094449 0.009847 0.000581 0.309663 0.059558 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009610
Maximum standard deviation of split frequencies = 0.026381
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 594
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 198 / 198 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 198 / 198 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099784 0.068205 0.049645 0.035269 0.093708 0.053927 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -845.005799
Iterating by ming2
Initial: fx= 845.005799
x= 0.09978 0.06820 0.04964 0.03527 0.09371 0.05393 0.30000 1.30000
1 h-m-p 0.0000 0.0002 478.2071 +++ 803.823264 m 0.0002 14 | 1/8
2 h-m-p 0.0011 0.0107 68.6890 ++ 801.388485 m 0.0107 25 | 2/8
3 h-m-p 0.0000 0.0001 445.0576 ++ 797.094280 m 0.0001 36 | 3/8
4 h-m-p 0.0000 0.0002 843.7977 ++ 792.279198 m 0.0002 47 | 4/8
5 h-m-p 0.0002 0.0011 344.0565 ++ 773.777389 m 0.0011 58 | 5/8
6 h-m-p 0.0000 0.0001 74.3509 ++ 773.464224 m 0.0001 69 | 6/8
7 h-m-p 0.0027 0.5719 0.9377 ------------.. | 6/8
8 h-m-p 0.0000 0.0002 173.7938 +++ 766.315111 m 0.0002 104 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 766.315111 m 8.0000 115 | 7/8
10 h-m-p 0.0160 8.0000 0.0002 -----Y 766.315111 0 0.0000 132 | 7/8
11 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/8
12 h-m-p 0.0160 8.0000 0.0002 +++++ 766.315110 m 8.0000 170 | 7/8
13 h-m-p 0.0160 8.0000 0.9748 -----------C 766.315110 0 0.0000 193 | 7/8
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/8
15 h-m-p 0.0160 8.0000 0.0002 +++++ 766.315110 m 8.0000 231 | 7/8
16 h-m-p 0.0160 8.0000 0.9579 -----------Y 766.315110 0 0.0000 254 | 7/8
17 h-m-p 0.0160 8.0000 0.0000 ---Y 766.315110 0 0.0000 269 | 7/8
18 h-m-p 0.0160 8.0000 0.0000 ------Y 766.315110 0 0.0000 287
Out..
lnL = -766.315110
288 lfun, 288 eigenQcodon, 1728 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085246 0.055182 0.051207 0.041909 0.019532 0.067943 0.057212 0.720764 0.504148
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.241132
np = 9
lnL0 = -827.815232
Iterating by ming2
Initial: fx= 827.815232
x= 0.08525 0.05518 0.05121 0.04191 0.01953 0.06794 0.05721 0.72076 0.50415
1 h-m-p 0.0000 0.0001 462.1593 ++ 805.789039 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 258.7842 ++ 784.088528 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 897.1689 ++ 777.330072 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 402.7497 ++ 774.593875 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 2159.5653 ++ 769.194566 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 20576.4264 ++ 766.315401 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 766.315401 m 8.0000 86 | 6/9
8 h-m-p 0.0018 0.8455 0.2866 +++++ 766.315275 m 0.8455 104 | 7/9
9 h-m-p 0.6480 3.3997 0.3724 ----------------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0009 +++++ 766.315269 m 8.0000 150 | 7/9
11 h-m-p 0.0370 6.8733 0.1859 -----------C 766.315269 0 0.0000 175 | 7/9
12 h-m-p 0.0160 8.0000 0.0018 +++++ 766.315258 m 8.0000 192 | 7/9
13 h-m-p 0.0571 3.6787 0.2525 ------------C 766.315258 0 0.0000 218 | 7/9
14 h-m-p 0.0012 0.6144 0.1290 +++++ 766.315188 m 0.6144 235 | 8/9
15 h-m-p 0.3402 8.0000 0.0262 -----------C 766.315188 0 0.0000 260 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 -----C 766.315188 0 0.0000 278
Out..
lnL = -766.315188
279 lfun, 837 eigenQcodon, 3348 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.024946 0.105120 0.061576 0.044230 0.069555 0.016136 0.000100 0.945977 0.326328 0.291757 2.913161
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.674765
np = 11
lnL0 = -823.263327
Iterating by ming2
Initial: fx= 823.263327
x= 0.02495 0.10512 0.06158 0.04423 0.06956 0.01614 0.00011 0.94598 0.32633 0.29176 2.91316
1 h-m-p 0.0000 0.0000 394.6979 ++ 822.576673 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0019 112.0828 ++++ 801.410778 m 0.0019 32 | 2/11
3 h-m-p 0.0000 0.0001 290.5751 ++ 794.801358 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0006 125.3570 ++ 789.699231 m 0.0006 60 | 4/11
5 h-m-p 0.0006 0.0032 47.4804 ++ 785.540864 m 0.0032 74 | 5/11
6 h-m-p 0.0000 0.0000 350026.0720 ++ 776.620478 m 0.0000 88 | 6/11
7 h-m-p 0.0003 0.0014 305.2759 ++ 772.721294 m 0.0014 102 | 7/11
8 h-m-p 0.0002 0.0009 252.6109 ++ 766.315463 m 0.0009 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 766.315463 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 9.5065 ------------C 766.315463 0 0.0000 159 | 8/11
11 h-m-p 0.0160 8.0000 0.0258 +++++ 766.315446 m 8.0000 176 | 8/11
12 h-m-p 0.0759 8.0000 2.7165 --------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 766.315446 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 0.3818 ----------C 766.315446 0 0.0000 249 | 8/11
15 h-m-p 0.0160 8.0000 0.0017 +++++ 766.315445 m 8.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 2.3217 -------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 766.315445 m 8.0000 314 | 8/11
18 h-m-p 0.0160 8.0000 0.2454 ---------N 766.315445 0 0.0000 340 | 8/11
19 h-m-p 0.0160 8.0000 0.0013 +++++ 766.315444 m 8.0000 360 | 8/11
20 h-m-p 0.0160 8.0000 2.4110 -------------.. | 8/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 766.315444 m 8.0000 405 | 8/11
22 h-m-p 0.0022 1.1139 6.2589 +++++ 766.315096 m 1.1139 425 | 9/11
23 h-m-p 1.6000 8.0000 0.0436 ++ 766.315095 m 8.0000 439 | 9/11
24 h-m-p 0.2189 8.0000 1.5924 +++ 766.315095 m 8.0000 456 | 9/11
25 h-m-p 1.6000 8.0000 0.0000 Y 766.315095 0 1.6000 470 | 9/11
26 h-m-p 0.0160 8.0000 0.0000 N 766.315095 0 0.0160 486
Out..
lnL = -766.315095
487 lfun, 1948 eigenQcodon, 8766 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -766.347787 S = -766.315754 -0.012322
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022291 0.069246 0.073276 0.040018 0.046234 0.034602 0.000100 0.364138 1.821872
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.966214
np = 9
lnL0 = -817.734975
Iterating by ming2
Initial: fx= 817.734975
x= 0.02229 0.06925 0.07328 0.04002 0.04623 0.03460 0.00011 0.36414 1.82187
1 h-m-p 0.0000 0.0000 425.4678 ++ 817.407348 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0072 49.9673 +++++ 804.335578 m 0.0072 29 | 2/9
3 h-m-p 0.0000 0.0000 1626808.4003 ++ 796.398790 m 0.0000 41 | 3/9
4 h-m-p 0.0022 0.0128 10.4639 ------------.. | 3/9
5 h-m-p 0.0000 0.0001 388.8742 ++ 784.307388 m 0.0001 75 | 4/9
6 h-m-p 0.0106 0.2509 2.5873 -------------.. | 4/9
7 h-m-p 0.0000 0.0000 351.1586 ++ 780.035886 m 0.0000 110 | 5/9
8 h-m-p 0.0160 8.0000 2.0175 -------------.. | 5/9
9 h-m-p 0.0000 0.0000 303.9645 ++ 776.351651 m 0.0000 145 | 6/9
10 h-m-p 0.0160 8.0000 1.3005 -------------.. | 6/9
11 h-m-p 0.0000 0.0001 247.4880 ++ 767.142067 m 0.0001 180 | 7/9
12 h-m-p 0.0278 8.0000 0.9302 --------------.. | 7/9
13 h-m-p 0.0000 0.0000 179.5657 ++ 766.315095 m 0.0000 218 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 766.315095 0 1.6000 230 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 N 766.315095 0 0.0160 243
Out..
lnL = -766.315095
244 lfun, 2684 eigenQcodon, 14640 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.095669 0.071065 0.019064 0.082735 0.040559 0.064312 0.000100 0.900000 0.956377 1.181859 2.805739
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.118084
np = 11
lnL0 = -831.476513
Iterating by ming2
Initial: fx= 831.476513
x= 0.09567 0.07107 0.01906 0.08273 0.04056 0.06431 0.00011 0.90000 0.95638 1.18186 2.80574
1 h-m-p 0.0000 0.0000 390.4090 ++ 831.060599 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 439.9399 +++ 812.167912 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0002 244.8174 ++ 794.212832 m 0.0002 45 | 3/11
4 h-m-p 0.0014 0.0172 37.1923 ++ 772.860497 m 0.0172 59 | 4/11
5 h-m-p 0.0000 0.0000 131998.9755 ++ 770.753816 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 5689.6923 ++ 769.052968 m 0.0001 87 | 6/11
7 h-m-p 0.0001 0.0003 429.6305 ++ 768.260419 m 0.0003 101 | 7/11
8 h-m-p 0.0008 0.0042 87.5509
QuantileBeta(0.15, 0.00500, 2.15506) = 1.225617e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
+ 766.315514 m 0.0042 115
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.229859e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
| 8/11
9 h-m-p 1.6000 8.0000 0.0016
QuantileBeta(0.15, 0.00500, 2.21033) = 1.187099e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20891) = 1.188055e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20856) = 1.188294e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20847) = 1.188354e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20845) = 1.188369e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188372e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
Y 766.315514 0 0.0000 137
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.229859e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20856) = 1.188291e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20832) = 1.188456e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
| 8/11
10 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
C 766.315514 0 0.0000 162
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
Out..
lnL = -766.315514
163 lfun, 1956 eigenQcodon, 10758 P(t)
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -766.321956 S = -766.311951 -0.004389
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:10
did 20 / 54 patterns 0:11
did 30 / 54 patterns 0:11
did 40 / 54 patterns 0:11
did 50 / 54 patterns 0:11
did 54 / 54 patterns 0:11
QuantileBeta(0.15, 0.00500, 2.20844) = 1.188373e-160 2000 rounds
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=198
NC_011896_1_WP_010908206_1_1282_MLBR_RS06035 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
NC_002677_1_NP_301885_1_757_ML1222 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV
**************************************************
NC_011896_1_WP_010908206_1_1282_MLBR_RS06035 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
NC_002677_1_NP_301885_1_757_ML1222 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770 GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG
**************************************************
NC_011896_1_WP_010908206_1_1282_MLBR_RS06035 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
NC_002677_1_NP_301885_1_757_ML1222 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770 PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI
**************************************************
NC_011896_1_WP_010908206_1_1282_MLBR_RS06035 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
NC_002677_1_NP_301885_1_757_ML1222 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770 QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
************************************************
>NC_011896_1_WP_010908206_1_1282_MLBR_RS06035 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG >NC_002677_1_NP_301885_1_757_ML1222 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG >NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG >NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG >NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG >NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770 GTGACCGAACATTGCGCGTCGGACATTTCCGATGTCTCCTGCCCACCGCG GGGGCGTGTGATCGTCGGGGTGGTGCTGGGCCTTGCGGGGACTGGCGCGT TGATAGGCGGGCTGTGGGCCTGGATTGCCCCACCGATCCATGCGGTAGTG GGGCTCACGCGGACAGGCGAACGAGGGCACGACTACCTGGGCAACGAGTC CGAGCACTTCTTTGTCGCGCCATGCTTGATGTTGGGCTTATTAACTGTGC TGGCGGTTACGGCGTCGGTGCTGGCATGGCAGTTGCGTCAGCACCGTGGG CCGGGGATGGTTATCGGGCTCGCGATTGGCTTGATGATCTGCGCCGCAAC TGCGGCAGCGGTGGGGGCGCTGTTGGTTTGGATGCGCTATGGTGCCTTGA ATTTCGACGCAGTACCGCTGTCGTACGACCACAAAGTGGCGCACGTCATT CAAGCACCGCCGGTGTTCTTCGCGCACGGATTGCTGCAAGTAGCGGCCAC CGTGCTATGGCCGGCGGGCATCGCTGCGCTGGTGTATGCGGTGCTTGCTG CCGCGAACGGACGCGACGACCTGGGCGGCAGACTATGTAGTCGG
>NC_011896_1_WP_010908206_1_1282_MLBR_RS06035 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR >NC_002677_1_NP_301885_1_757_ML1222 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR >NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR >NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR >NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR >NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770 VTEHCASDISDVSCPPRGRVIVGVVLGLAGTGALIGGLWAWIAPPIHAVV GLTRTGERGHDYLGNESEHFFVAPCLMLGLLTVLAVTASVLAWQLRQHRG PGMVIGLAIGLMICAATAAAVGALLVWMRYGALNFDAVPLSYDHKVAHVI QAPPVFFAHGLLQVAATVLWPAGIAALVYAVLAAANGRDDLGGRLCSR
#NEXUS
[ID: 5717295636]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908206_1_1282_MLBR_RS06035
NC_002677_1_NP_301885_1_757_ML1222
NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790
NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050
NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620
NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908206_1_1282_MLBR_RS06035,
2 NC_002677_1_NP_301885_1_757_ML1222,
3 NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790,
4 NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050,
5 NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620,
6 NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06978886,2:0.07083822,3:0.07182786,4:0.07354604,5:0.07018363,6:0.06791468);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06978886,2:0.07083822,3:0.07182786,4:0.07354604,5:0.07018363,6:0.06791468);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -792.97 -796.29
2 -792.95 -796.69
--------------------------------------
TOTAL -792.96 -796.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1222/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897772 0.089982 0.355598 1.460203 0.863950 1343.88 1419.38 1.000
r(A<->C){all} 0.169610 0.020390 0.000065 0.456099 0.129928 270.09 310.25 1.004
r(A<->G){all} 0.167104 0.019446 0.000043 0.440783 0.128072 233.86 296.14 1.001
r(A<->T){all} 0.160052 0.018389 0.000023 0.420664 0.124792 201.49 234.35 1.000
r(C<->G){all} 0.162032 0.019440 0.000020 0.443227 0.123539 159.62 172.88 1.001
r(C<->T){all} 0.165480 0.020639 0.000014 0.457291 0.122929 100.34 108.06 1.000
r(G<->T){all} 0.175723 0.021684 0.000119 0.466393 0.136385 148.65 223.64 1.000
pi(A){all} 0.143858 0.000212 0.116718 0.173054 0.143601 1342.76 1361.04 1.000
pi(C){all} 0.269710 0.000342 0.233640 0.305209 0.269363 1069.11 1219.97 1.000
pi(G){all} 0.367536 0.000395 0.327609 0.404195 0.366984 1000.65 1070.77 1.000
pi(T){all} 0.218897 0.000300 0.185126 0.251413 0.219189 1057.13 1256.56 1.001
alpha{1,2} 0.415751 0.215669 0.000103 1.363644 0.245073 1010.17 1141.49 1.000
alpha{3} 0.445590 0.228746 0.000198 1.416554 0.279176 1128.75 1189.47 1.000
pinvar{all} 0.997327 0.000010 0.991368 0.999999 0.998376 1254.08 1270.69 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1222/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 198
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 3 3 3 3 3 3 | TAC 2 2 2 2 2 2 | TGC 4 4 4 4 4 4
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 6 6 6 6 6 6 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 10 10 10 10 10 10 | CCG 7 7 7 7 7 7 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 4 4 4 4 4 4 | GCC 6 6 6 6 6 6 | GAC 6 6 6 6 6 6 | GGC 10 10 10 10 10 10
GTA 3 3 3 3 3 3 | GCA 5 5 5 5 5 5 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 13 13 13 13 13 13 | GCG 18 18 18 18 18 18 | GAG 2 2 2 2 2 2 | GGG 10 10 10 10 10 10
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908206_1_1282_MLBR_RS06035
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
#2: NC_002677_1_NP_301885_1_757_ML1222
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
#3: NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
#4: NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
#5: NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
#6: NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 6
TTC 24 | TCC 18 | TAC 12 | TGC 24
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 18 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 18
CTC 12 | CCC 0 | CAC 36 | CGC 12
CTA 12 | CCA 18 | Gln Q CAA 12 | CGA 6
CTG 60 | CCG 42 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 6
ATC 30 | ACC 12 | AAC 12 | AGC 0
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 24 | ACG 12 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 6
GTC 24 | GCC 36 | GAC 36 | GGC 60
GTA 18 | GCA 30 | Glu E GAA 12 | GGA 12
GTG 78 | GCG 108 | GAG 12 | GGG 60
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17677 C:0.23737 A:0.14141 G:0.44444
position 2: T:0.34343 C:0.27778 A:0.15657 G:0.22222
position 3: T:0.13636 C:0.29293 A:0.13131 G:0.43939
Average T:0.21886 C:0.26936 A:0.14310 G:0.36869
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -766.315110 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.057212 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908206_1_1282_MLBR_RS06035: 0.000004, NC_002677_1_NP_301885_1_757_ML1222: 0.000004, NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790: 0.000004, NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050: 0.000004, NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620: 0.000004, NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.05721
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 432.9 161.1 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 432.9 161.1 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 432.9 161.1 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 432.9 161.1 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 432.9 161.1 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 432.9 161.1 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -766.315188 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.075498
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908206_1_1282_MLBR_RS06035: 0.000004, NC_002677_1_NP_301885_1_757_ML1222: 0.000004, NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790: 0.000004, NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050: 0.000004, NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620: 0.000004, NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.07550 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.5 160.5 0.0755 0.0000 0.0000 0.0 0.0
7..2 0.000 433.5 160.5 0.0755 0.0000 0.0000 0.0 0.0
7..3 0.000 433.5 160.5 0.0755 0.0000 0.0000 0.0 0.0
7..4 0.000 433.5 160.5 0.0755 0.0000 0.0000 0.0 0.0
7..5 0.000 433.5 160.5 0.0755 0.0000 0.0000 0.0 0.0
7..6 0.000 433.5 160.5 0.0755 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -766.315095 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908206_1_1282_MLBR_RS06035: 0.000004, NC_002677_1_NP_301885_1_757_ML1222: 0.000004, NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790: 0.000004, NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050: 0.000004, NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620: 0.000004, NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908206_1_1282_MLBR_RS06035)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -766.315095 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.780205
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908206_1_1282_MLBR_RS06035: 0.000004, NC_002677_1_NP_301885_1_757_ML1222: 0.000004, NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790: 0.000004, NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050: 0.000004, NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620: 0.000004, NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.78020
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 433.5 160.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -766.315514 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.687138 0.005000 2.208441 3.792928
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908206_1_1282_MLBR_RS06035: 0.000004, NC_002677_1_NP_301885_1_757_ML1222: 0.000004, NZ_LVXE01000044_1_WP_010908206_1_1911_A3216_RS10790: 0.000004, NZ_LYPH01000049_1_WP_010908206_1_1896_A8144_RS09050: 0.000004, NZ_CP029543_1_WP_010908206_1_1304_DIJ64_RS06620: 0.000004, NZ_AP014567_1_WP_010908206_1_1334_JK2ML_RS06770: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.68714 p = 0.00500 q = 2.20844
(p1 = 0.31286) w = 3.79293
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06871 0.06871 0.06871 0.06871 0.06871 0.06871 0.06871 0.06871 0.06871 0.06871 0.31286
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.79293
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.5 160.5 1.1867 0.0000 0.0000 0.0 0.0
7..2 0.000 433.5 160.5 1.1867 0.0000 0.0000 0.0 0.0
7..3 0.000 433.5 160.5 1.1867 0.0000 0.0000 0.0 0.0
7..4 0.000 433.5 160.5 1.1867 0.0000 0.0000 0.0 0.0
7..5 0.000 433.5 160.5 1.1867 0.0000 0.0000 0.0 0.0
7..6 0.000 433.5 160.5 1.1867 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908206_1_1282_MLBR_RS06035)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908206_1_1282_MLBR_RS06035)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:11
Model 1: NearlyNeutral -766.315188 Model 2: PositiveSelection -766.315095 Model 0: one-ratio -766.31511 Model 7: beta -766.315095 Model 8: beta&w>1 -766.315514 Model 0 vs 1 1.560000000608852E-4 Model 2 vs 1 1.859999999851425E-4 Model 8 vs 7 8.379999999306165E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
