--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken.
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -471.49 -486.06
2 -471.23 -483.96
--------------------------------------
TOTAL -471.35 -485.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.042151 0.000238 0.016822 0.071223 0.040234 1450.57 1461.43 1.000
r(A<->C){all} 0.258675 0.012177 0.062585 0.474071 0.249302 89.15 92.46 1.000
r(A<->G){all} 0.206307 0.011463 0.033201 0.421811 0.191887 77.30 78.77 1.002
r(A<->T){all} 0.097765 0.004288 0.002584 0.227955 0.084308 131.55 135.51 1.001
r(C<->G){all} 0.152767 0.009051 0.008037 0.337393 0.136455 87.29 94.61 1.000
r(C<->T){all} 0.169334 0.008304 0.023298 0.352702 0.155434 65.37 78.38 1.001
r(G<->T){all} 0.115152 0.006079 0.006809 0.272199 0.098304 76.43 91.67 1.001
pi(A){all} 0.280122 0.000655 0.226439 0.327264 0.279794 771.04 802.53 1.002
pi(C){all} 0.208239 0.000553 0.162933 0.253367 0.207324 670.24 766.57 1.000
pi(G){all} 0.188624 0.000510 0.142772 0.231314 0.188297 875.58 905.70 1.000
pi(T){all} 0.323015 0.000745 0.266821 0.373418 0.323932 735.79 780.48 1.002
alpha{1,2} 0.746129 0.717937 0.000327 2.329224 0.466153 614.90 647.20 1.000
alpha{3} 1.167151 1.061900 0.002381 3.152054 0.892139 512.64 753.98 1.000
pinvar{all} 0.487687 0.065718 0.022602 0.879274 0.504656 216.68 229.71 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
Model 1: NearlyNeutral -441.843727
Model 2: PositiveSelection -440.521385
Model 7: beta -441.930697
Model 8: beta&w>1 -440.522788
Model 2 vs 1 2.644684
Model 8 vs 7 2.815818
-- Starting log on Tue Nov 08 20:15:04 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result--
-- Starting log on Tue Nov 08 20:15:31 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result--
-- Starting log on Tue Nov 08 20:39:04 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result/gapped_alignment/codeml,NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 30 taxa and 282 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C10
Taxon 2 -> C11
Taxon 3 -> C13
Taxon 4 -> C15
Taxon 5 -> C18
Taxon 6 -> C19
Taxon 7 -> C2
Taxon 8 -> C20
Taxon 9 -> C21
Taxon 10 -> C26
Taxon 11 -> C27
Taxon 12 -> C29
Taxon 13 -> C30
Taxon 14 -> C39
Taxon 15 -> C4
Taxon 16 -> C40
Taxon 17 -> C42
Taxon 18 -> C43
Taxon 19 -> C45
Taxon 20 -> C48
Taxon 21 -> C49
Taxon 22 -> C52
Taxon 23 -> C54
Taxon 24 -> C56
Taxon 25 -> C57
Taxon 26 -> C58
Taxon 27 -> C59
Taxon 28 -> C6
Taxon 29 -> C8
Taxon 30 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1667939946
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 421898867
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9222146143
Seed = 1425138979
Swapseed = 1667939946
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 7 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 9 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -702.820036 -- 82.122948
Chain 2 -- -704.221664 -- 82.122948
Chain 3 -- -695.924713 -- 82.122948
Chain 4 -- -703.129763 -- 82.122948
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -700.077034 -- 82.122948
Chain 2 -- -701.075682 -- 82.122948
Chain 3 -- -699.016092 -- 82.122948
Chain 4 -- -703.960449 -- 82.122948
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-702.820] (-704.222) (-695.925) (-703.130) * [-700.077] (-701.076) (-699.016) (-703.960)
1000 -- (-509.922) (-515.244) [-490.607] (-476.601) * (-482.316) (-518.988) (-494.483) [-490.528] -- 0:16:39
2000 -- (-494.248) (-492.800) (-475.269) [-473.406] * (-470.917) (-509.198) [-477.506] (-492.324) -- 0:08:19
3000 -- [-482.095] (-486.165) (-480.209) (-471.492) * (-473.934) (-488.408) (-472.753) [-477.523] -- 0:11:04
4000 -- (-533.946) (-478.737) [-474.980] (-479.408) * (-475.564) (-524.413) [-474.931] (-474.513) -- 0:08:18
5000 -- (-505.369) (-487.373) (-478.198) [-476.698] * (-482.735) (-499.770) (-483.986) [-472.690] -- 0:06:38
Average standard deviation of split frequencies: 0.079912
6000 -- (-498.334) (-477.271) (-479.048) [-474.527] * (-484.226) (-499.479) (-479.992) [-470.494] -- 0:08:17
7000 -- (-491.596) [-470.881] (-481.871) (-479.825) * (-489.786) (-507.753) (-472.975) [-470.257] -- 0:07:05
8000 -- (-515.395) [-474.097] (-483.724) (-472.910) * (-486.747) (-503.082) [-473.800] (-478.060) -- 0:08:16
9000 -- (-525.996) [-472.220] (-478.855) (-490.241) * (-490.934) (-499.706) (-472.633) [-477.348] -- 0:07:20
10000 -- (-504.611) (-474.212) [-473.704] (-489.682) * [-488.658] (-510.817) (-485.072) (-475.972) -- 0:06:36
Average standard deviation of split frequencies: 0.078190
11000 -- (-502.575) (-470.909) [-475.579] (-496.608) * (-496.295) (-499.060) [-472.401] (-477.581) -- 0:07:29
12000 -- (-507.891) [-469.172] (-478.814) (-499.043) * (-496.406) (-502.335) (-477.850) [-473.927] -- 0:06:51
13000 -- (-504.118) [-470.611] (-482.434) (-495.057) * (-481.699) (-487.484) (-507.432) [-475.768] -- 0:07:35
14000 -- (-507.515) [-476.715] (-488.345) (-496.492) * (-487.413) (-484.739) (-485.185) [-476.374] -- 0:07:02
15000 -- (-505.938) [-473.313] (-478.912) (-497.140) * (-502.598) (-494.760) (-483.205) [-479.856] -- 0:06:34
Average standard deviation of split frequencies: 0.073182
16000 -- (-500.100) (-471.198) [-473.897] (-484.477) * (-514.744) (-498.324) (-481.936) [-474.158] -- 0:07:10
17000 -- (-500.041) [-472.816] (-474.540) (-497.303) * (-502.028) (-504.234) (-475.223) [-473.640] -- 0:06:44
18000 -- (-511.284) [-472.777] (-484.797) (-499.152) * (-504.554) (-498.251) (-478.113) [-474.963] -- 0:06:21
19000 -- (-508.389) [-472.880] (-472.128) (-496.119) * (-515.768) (-500.584) (-478.087) [-473.756] -- 0:06:53
20000 -- (-507.378) (-477.993) [-473.957] (-502.975) * (-500.726) (-507.829) (-474.835) [-473.567] -- 0:06:32
Average standard deviation of split frequencies: 0.060026
21000 -- (-503.101) [-471.206] (-489.954) (-497.142) * (-503.401) (-495.716) (-487.553) [-474.206] -- 0:06:59
22000 -- (-497.077) [-475.005] (-496.878) (-499.391) * (-496.320) (-492.684) (-500.620) [-473.541] -- 0:06:40
23000 -- (-502.854) [-466.919] (-494.160) (-498.390) * (-491.705) (-486.130) (-507.396) [-472.797] -- 0:06:22
24000 -- (-490.531) [-474.700] (-496.869) (-486.491) * (-495.002) (-495.309) (-512.867) [-476.467] -- 0:06:46
25000 -- (-493.124) [-472.528] (-487.540) (-491.248) * (-513.309) (-493.282) (-489.642) [-475.807] -- 0:06:30
Average standard deviation of split frequencies: 0.050162
26000 -- (-498.937) [-473.572] (-506.060) (-484.202) * (-501.463) (-500.414) (-488.799) [-472.961] -- 0:06:52
27000 -- (-499.156) [-474.679] (-514.036) (-500.108) * (-504.846) (-499.075) (-488.545) [-469.938] -- 0:06:36
28000 -- (-497.307) [-474.664] (-508.190) (-498.378) * (-487.291) (-494.116) (-491.430) [-471.421] -- 0:06:21
29000 -- (-500.532) [-476.083] (-494.842) (-494.952) * (-500.978) (-493.012) (-493.950) [-476.283] -- 0:06:41
30000 -- (-504.679) [-474.640] (-493.276) (-492.114) * (-490.563) (-491.654) (-490.940) [-474.573] -- 0:06:28
Average standard deviation of split frequencies: 0.042622
31000 -- (-499.507) [-472.381] (-503.961) (-494.345) * (-485.641) (-493.539) (-489.889) [-474.587] -- 0:06:46
32000 -- (-491.586) [-476.113] (-508.228) (-500.837) * (-497.954) (-490.438) (-494.968) [-480.287] -- 0:06:33
33000 -- (-496.120) [-473.732] (-503.799) (-497.659) * (-494.571) (-492.048) (-487.609) [-477.303] -- 0:06:20
34000 -- (-503.387) [-476.764] (-512.548) (-495.877) * (-493.314) (-491.068) (-498.367) [-473.340] -- 0:06:37
35000 -- (-494.471) [-476.313] (-506.039) (-498.500) * (-512.834) (-498.103) (-497.537) [-472.850] -- 0:06:26
Average standard deviation of split frequencies: 0.044522
36000 -- (-502.005) [-474.173] (-502.341) (-503.958) * (-494.172) (-493.071) (-493.274) [-472.088] -- 0:06:41
37000 -- (-494.593) [-479.145] (-496.384) (-511.673) * (-498.503) (-489.789) (-500.318) [-477.661] -- 0:06:30
38000 -- (-508.805) [-477.963] (-495.350) (-497.241) * (-492.870) (-491.427) (-504.786) [-469.173] -- 0:06:19
39000 -- (-501.269) [-477.946] (-493.205) (-495.476) * (-490.522) (-484.842) (-493.418) [-473.025] -- 0:06:34
40000 -- (-497.336) [-475.948] (-511.267) (-489.405) * (-493.484) (-483.228) (-496.642) [-469.869] -- 0:06:24
Average standard deviation of split frequencies: 0.040231
41000 -- (-503.115) [-471.193] (-504.909) (-498.824) * (-501.937) (-487.197) (-495.198) [-473.973] -- 0:06:37
42000 -- (-490.783) [-469.798] (-506.584) (-491.269) * (-511.397) (-485.852) (-495.293) [-472.740] -- 0:06:27
43000 -- (-492.885) [-471.117] (-494.392) (-492.217) * (-504.718) (-488.195) (-508.629) [-470.591] -- 0:06:18
44000 -- (-490.632) [-472.017] (-493.529) (-487.440) * (-491.747) (-491.865) (-494.470) [-475.347] -- 0:06:31
45000 -- (-488.970) [-477.506] (-502.355) (-499.771) * (-490.432) (-489.451) (-505.670) [-475.052] -- 0:06:22
Average standard deviation of split frequencies: 0.039473
46000 -- (-500.038) [-474.404] (-506.306) (-496.297) * (-506.776) (-488.077) (-504.779) [-479.290] -- 0:06:13
47000 -- (-500.011) [-476.640] (-502.741) (-488.652) * (-497.607) (-491.283) (-501.084) [-472.329] -- 0:06:25
48000 -- (-505.050) [-474.496] (-510.660) (-490.073) * (-493.524) (-486.641) (-502.124) [-468.085] -- 0:06:16
49000 -- (-507.383) [-475.511] (-507.860) (-487.125) * (-496.570) (-496.309) (-492.930) [-470.099] -- 0:06:28
50000 -- (-497.436) [-478.299] (-510.017) (-484.606) * (-497.053) (-497.112) (-502.130) [-472.257] -- 0:06:20
Average standard deviation of split frequencies: 0.039239
51000 -- (-494.353) [-477.166] (-494.599) (-493.522) * (-496.001) (-498.238) (-505.260) [-471.007] -- 0:06:12
52000 -- (-501.064) [-477.505] (-494.843) (-497.609) * (-503.135) (-490.860) (-504.163) [-472.175] -- 0:06:22
53000 -- (-488.685) [-486.062] (-501.091) (-487.916) * (-498.883) (-510.370) (-500.459) [-475.521] -- 0:06:15
54000 -- (-502.976) [-475.814] (-497.170) (-498.261) * (-495.201) (-502.751) (-490.508) [-474.164] -- 0:06:25
55000 -- (-491.180) [-476.874] (-507.724) (-501.099) * (-498.884) (-505.978) (-494.916) [-478.189] -- 0:06:18
Average standard deviation of split frequencies: 0.035676
56000 -- (-515.123) [-484.590] (-508.459) (-488.675) * (-497.725) (-491.571) (-510.716) [-472.642] -- 0:06:10
57000 -- (-499.635) [-479.993] (-490.983) (-495.307) * (-500.031) (-494.391) (-501.646) [-480.285] -- 0:06:20
58000 -- (-488.854) [-483.049] (-509.372) (-507.288) * (-489.509) (-492.759) (-496.172) [-471.406] -- 0:06:13
59000 -- (-494.263) [-474.453] (-494.664) (-505.299) * (-490.997) (-492.501) (-494.802) [-474.840] -- 0:06:22
60000 -- (-492.908) [-474.561] (-490.957) (-490.492) * (-487.548) (-490.695) (-493.954) [-475.000] -- 0:06:16
Average standard deviation of split frequencies: 0.036632
61000 -- (-505.383) [-477.773] (-496.130) (-490.300) * (-488.934) (-496.302) (-493.093) [-471.433] -- 0:06:09
62000 -- (-493.694) [-477.686] (-510.692) (-488.266) * (-488.347) (-487.068) (-503.655) [-472.411] -- 0:06:18
63000 -- (-492.775) [-472.234] (-496.596) (-495.613) * (-488.307) (-494.273) (-500.369) [-471.395] -- 0:06:11
64000 -- (-499.076) [-475.742] (-498.184) (-506.660) * (-483.949) (-487.154) (-508.066) [-475.248] -- 0:06:20
65000 -- (-493.201) [-472.003] (-503.388) (-493.134) * (-490.694) (-494.452) (-496.270) [-470.719] -- 0:06:14
Average standard deviation of split frequencies: 0.027856
66000 -- (-493.371) [-475.500] (-507.662) (-493.268) * (-496.778) (-489.891) (-509.142) [-472.337] -- 0:06:07
67000 -- (-491.869) [-477.408] (-501.633) (-489.982) * (-496.600) (-484.066) (-505.259) [-475.485] -- 0:06:15
68000 -- (-491.009) [-472.187] (-502.664) (-493.222) * (-490.706) (-491.244) (-509.662) [-472.302] -- 0:06:10
69000 -- (-493.836) [-469.713] (-504.192) (-496.391) * (-488.263) (-494.171) (-505.858) [-475.581] -- 0:06:17
70000 -- (-496.501) [-475.629] (-499.051) (-496.315) * (-486.274) (-489.772) (-500.179) [-473.796] -- 0:06:12
Average standard deviation of split frequencies: 0.031269
71000 -- (-490.351) [-473.505] (-497.240) (-498.242) * (-489.843) (-491.759) (-487.763) [-473.792] -- 0:06:06
72000 -- (-485.703) [-472.875] (-495.779) (-495.693) * (-489.751) (-490.756) (-486.668) [-473.468] -- 0:06:13
73000 -- (-505.956) [-474.916] (-492.975) (-490.866) * (-489.747) (-493.654) (-491.213) [-474.893] -- 0:06:08
74000 -- (-491.782) [-470.190] (-497.920) (-489.550) * (-493.316) (-492.043) (-491.507) [-471.433] -- 0:06:15
75000 -- (-489.755) [-473.763] (-504.397) (-491.294) * (-500.169) (-483.625) (-503.316) [-473.336] -- 0:06:10
Average standard deviation of split frequencies: 0.030186
76000 -- (-491.292) [-475.268] (-497.789) (-494.092) * (-506.304) (-487.241) (-504.285) [-476.850] -- 0:06:04
77000 -- (-489.184) [-476.245] (-497.733) (-498.707) * (-493.902) (-494.620) (-502.388) [-475.755] -- 0:06:11
78000 -- (-497.759) [-477.561] (-497.998) (-496.651) * (-497.193) (-486.517) (-496.073) [-478.724] -- 0:06:06
79000 -- (-486.772) [-479.413] (-488.764) (-507.987) * (-491.583) (-490.290) (-510.365) [-474.982] -- 0:06:01
80000 -- (-499.735) [-482.515] (-492.783) (-497.092) * (-492.611) (-489.902) (-505.705) [-474.193] -- 0:06:08
Average standard deviation of split frequencies: 0.035898
81000 -- (-501.111) [-477.614] (-498.820) (-494.335) * (-496.657) (-493.776) (-502.253) [-477.322] -- 0:06:03
82000 -- (-495.795) [-478.439] (-496.394) (-493.532) * (-497.393) (-489.923) (-503.784) [-475.283] -- 0:06:09
83000 -- (-493.513) [-475.162] (-507.469) (-493.625) * (-496.572) (-488.568) (-505.540) [-470.779] -- 0:06:04
84000 -- (-492.036) [-475.755] (-505.989) (-488.708) * (-495.893) (-488.695) (-497.270) [-473.430] -- 0:05:59
85000 -- (-504.916) [-479.786] (-499.392) (-489.499) * (-500.108) (-489.466) (-508.887) [-470.399] -- 0:06:06
Average standard deviation of split frequencies: 0.027712
86000 -- (-509.647) [-482.992] (-497.148) (-491.415) * (-490.553) (-501.264) (-502.584) [-475.164] -- 0:06:01
87000 -- (-507.883) [-476.889] (-496.524) (-494.728) * (-488.449) (-496.348) (-492.998) [-472.989] -- 0:06:07
88000 -- (-497.898) [-481.567] (-498.772) (-490.525) * (-509.519) (-495.778) (-495.492) [-473.716] -- 0:06:02
89000 -- (-493.892) [-477.416] (-500.545) (-500.981) * (-499.133) (-494.612) (-504.964) [-477.530] -- 0:05:58
90000 -- (-494.409) [-473.708] (-505.610) (-500.385) * (-497.163) (-494.559) (-497.881) [-471.466] -- 0:06:04
Average standard deviation of split frequencies: 0.031774
91000 -- (-494.959) [-473.057] (-510.666) (-497.699) * (-495.769) (-499.926) (-506.008) [-474.897] -- 0:05:59
92000 -- (-494.228) [-471.219] (-497.017) (-487.283) * (-495.154) (-496.235) (-499.112) [-478.956] -- 0:06:05
93000 -- (-493.761) [-474.581] (-516.898) (-489.047) * (-493.061) (-496.841) (-495.554) [-473.886] -- 0:06:00
94000 -- (-486.570) [-471.512] (-499.922) (-488.736) * (-502.223) (-498.435) (-499.740) [-471.896] -- 0:05:56
95000 -- (-493.046) [-473.166] (-507.224) (-495.927) * (-500.670) (-511.394) (-499.727) [-475.800] -- 0:06:02
Average standard deviation of split frequencies: 0.033759
96000 -- (-485.391) [-471.927] (-510.145) (-499.624) * (-491.065) (-501.537) (-492.573) [-477.535] -- 0:05:57
97000 -- (-484.144) [-473.766] (-495.665) (-496.416) * (-496.868) (-506.420) (-499.522) [-475.018] -- 0:06:03
98000 -- (-492.186) [-476.555] (-493.101) (-496.851) * (-503.915) (-509.694) (-504.195) [-471.408] -- 0:05:58
99000 -- (-490.693) [-480.836] (-495.991) (-486.418) * (-489.411) (-512.901) (-502.221) [-473.073] -- 0:05:54
100000 -- (-492.795) [-476.783] (-491.815) (-489.473) * (-486.373) (-497.334) (-493.335) [-472.699] -- 0:06:00
Average standard deviation of split frequencies: 0.035511
101000 -- (-496.481) [-477.249] (-492.707) (-495.803) * (-494.824) (-493.962) (-505.193) [-472.622] -- 0:05:56
102000 -- (-495.645) [-474.563] (-489.817) (-493.852) * (-486.931) (-494.633) (-502.041) [-475.389] -- 0:06:00
103000 -- (-490.266) [-469.150] (-492.438) (-493.046) * (-488.234) (-486.459) (-497.891) [-473.335] -- 0:05:57
104000 -- (-489.943) [-469.488] (-492.961) (-489.583) * (-485.742) (-498.681) (-506.646) [-475.581] -- 0:05:53
105000 -- (-499.149) [-470.783] (-493.480) (-490.993) * (-486.425) (-492.536) (-498.403) [-480.223] -- 0:05:58
Average standard deviation of split frequencies: 0.026945
106000 -- (-497.746) [-474.057] (-495.680) (-494.410) * (-490.115) (-501.151) (-496.209) [-469.284] -- 0:05:54
107000 -- (-497.950) [-473.027] (-503.209) (-489.742) * (-487.650) (-500.216) (-503.504) [-469.541] -- 0:05:58
108000 -- (-501.535) [-473.590] (-505.157) (-483.220) * (-486.190) (-503.960) (-495.914) [-473.572] -- 0:05:55
109000 -- (-504.082) [-479.304] (-506.226) (-483.661) * (-497.989) (-494.077) (-496.098) [-472.902] -- 0:05:51
110000 -- (-501.702) [-472.636] (-498.070) (-487.734) * (-496.547) (-495.013) (-505.372) [-470.200] -- 0:05:56
Average standard deviation of split frequencies: 0.027830
111000 -- (-496.429) [-473.299] (-512.538) (-488.905) * (-490.935) (-497.145) (-500.788) [-475.956] -- 0:05:52
112000 -- (-501.711) [-473.938] (-501.004) (-486.721) * (-488.238) (-492.417) (-498.031) [-473.785] -- 0:05:56
113000 -- (-498.775) [-470.446] (-499.161) (-487.294) * (-494.254) (-498.863) (-499.960) [-477.500] -- 0:05:53
114000 -- (-494.668) [-479.234] (-497.125) (-497.969) * (-488.448) (-505.629) (-502.269) [-478.261] -- 0:05:49
115000 -- (-485.491) [-471.081] (-499.215) (-492.272) * (-495.459) (-503.378) (-505.134) [-477.947] -- 0:05:54
Average standard deviation of split frequencies: 0.027431
116000 -- (-489.961) [-467.502] (-505.416) (-494.429) * (-490.504) (-507.742) (-494.859) [-475.660] -- 0:05:50
117000 -- (-496.648) [-473.541] (-498.851) (-489.234) * (-491.839) (-499.398) (-495.348) [-470.310] -- 0:05:54
118000 -- (-499.122) [-472.801] (-508.478) (-492.226) * (-491.126) (-501.300) (-496.254) [-472.191] -- 0:05:51
119000 -- (-490.828) [-476.618] (-494.916) (-496.631) * (-491.500) (-496.857) (-493.721) [-470.457] -- 0:05:47
120000 -- (-492.361) [-476.377] (-494.759) (-495.503) * (-491.670) (-492.416) (-491.253) [-471.665] -- 0:05:52
Average standard deviation of split frequencies: 0.030928
121000 -- (-497.166) [-481.926] (-503.392) (-494.500) * (-492.031) (-487.130) (-500.051) [-471.889] -- 0:05:48
122000 -- (-499.283) [-481.112] (-504.486) (-492.360) * (-493.690) (-494.623) (-497.893) [-474.216] -- 0:05:45
123000 -- (-493.748) [-473.593] (-502.449) (-489.368) * (-498.385) (-497.567) (-499.042) [-473.883] -- 0:05:49
124000 -- (-498.291) [-475.270] (-490.335) (-492.369) * (-485.530) (-492.354) (-493.864) [-477.639] -- 0:05:46
125000 -- (-511.529) [-477.363] (-491.521) (-490.761) * (-488.515) (-488.372) (-500.982) [-474.179] -- 0:05:50
Average standard deviation of split frequencies: 0.026456
126000 -- (-495.210) [-475.703] (-494.710) (-494.471) * (-494.071) (-494.523) (-504.855) [-477.933] -- 0:05:46
127000 -- (-500.533) [-481.087] (-491.558) (-489.491) * (-495.670) (-488.861) (-510.945) [-475.337] -- 0:05:43
128000 -- (-501.920) [-478.270] (-487.263) (-500.301) * (-491.839) (-490.111) (-504.601) [-477.406] -- 0:05:47
129000 -- (-501.449) [-478.597] (-498.873) (-490.191) * (-482.357) (-490.747) (-494.915) [-472.028] -- 0:05:44
130000 -- (-494.419) [-474.931] (-491.140) (-492.633) * (-486.666) (-487.795) (-491.414) [-476.653] -- 0:05:48
Average standard deviation of split frequencies: 0.023965
131000 -- (-500.148) [-471.567] (-496.118) (-487.199) * (-488.506) (-498.447) (-498.484) [-475.403] -- 0:05:44
132000 -- (-489.027) [-484.677] (-490.053) (-495.040) * (-490.252) (-487.169) (-492.084) [-474.724] -- 0:05:41
133000 -- (-489.296) [-479.485] (-494.640) (-492.803) * (-492.936) (-490.485) (-487.850) [-472.859] -- 0:05:45
134000 -- (-483.437) [-476.340] (-497.921) (-487.762) * (-492.622) (-491.929) (-493.263) [-473.814] -- 0:05:42
135000 -- (-501.215) [-479.189] (-499.919) (-491.198) * (-486.502) (-490.670) (-488.403) [-473.098] -- 0:05:46
Average standard deviation of split frequencies: 0.025997
136000 -- (-513.987) [-473.431] (-493.785) (-490.934) * (-486.050) (-491.026) (-497.314) [-480.883] -- 0:05:43
137000 -- (-498.371) [-469.608] (-503.282) (-495.076) * (-487.315) (-487.297) (-500.708) [-474.408] -- 0:05:40
138000 -- (-491.619) [-475.072] (-508.152) (-495.450) * (-483.321) (-494.543) (-506.278) [-475.384] -- 0:05:43
139000 -- (-495.553) [-472.673] (-509.871) (-488.085) * (-495.753) (-498.780) (-498.887) [-471.527] -- 0:05:40
140000 -- (-488.982) [-476.784] (-512.979) (-493.796) * (-503.099) (-493.473) (-489.636) [-469.930] -- 0:05:44
Average standard deviation of split frequencies: 0.026251
141000 -- (-495.368) [-475.697] (-506.453) (-497.527) * (-498.018) (-497.305) (-497.994) [-473.458] -- 0:05:41
142000 -- (-490.516) [-474.636] (-511.715) (-488.877) * (-497.184) (-492.380) (-491.200) [-475.212] -- 0:05:38
143000 -- (-489.871) [-474.292] (-505.251) (-486.046) * (-487.713) (-508.283) (-498.451) [-471.347] -- 0:05:41
144000 -- (-492.061) [-481.369] (-492.358) (-498.871) * (-491.587) (-501.531) (-493.449) [-477.439] -- 0:05:38
145000 -- (-494.149) [-476.794] (-498.005) (-492.345) * (-505.200) (-510.367) (-495.873) [-483.929] -- 0:05:42
Average standard deviation of split frequencies: 0.021679
146000 -- (-506.173) [-488.333] (-496.824) (-490.852) * (-500.772) (-505.490) (-489.643) [-475.942] -- 0:05:39
147000 -- (-490.559) [-471.014] (-496.450) (-495.375) * (-487.531) (-490.041) (-489.668) [-475.575] -- 0:05:36
148000 -- (-496.195) [-473.220] (-508.644) (-495.896) * (-488.540) (-494.558) (-488.769) [-477.947] -- 0:05:39
149000 -- (-493.961) [-476.036] (-503.799) (-495.870) * (-489.253) (-494.028) (-496.775) [-484.145] -- 0:05:36
150000 -- (-496.090) [-470.737] (-509.467) (-491.488) * (-500.446) (-487.723) (-494.892) [-474.327] -- 0:05:40
Average standard deviation of split frequencies: 0.022572
151000 -- (-498.518) [-470.584] (-505.600) (-496.497) * (-493.394) (-488.744) (-491.844) [-474.875] -- 0:05:37
152000 -- (-496.065) [-474.924] (-497.904) (-488.815) * (-501.377) (-484.442) (-496.191) [-475.903] -- 0:05:34
153000 -- (-502.142) [-474.458] (-495.666) (-491.029) * (-495.403) (-485.908) (-488.904) [-473.893] -- 0:05:37
154000 -- (-498.256) [-477.287] (-496.820) (-494.359) * (-489.972) (-489.066) (-488.275) [-474.001] -- 0:05:35
155000 -- (-497.460) [-473.927] (-503.142) (-486.836) * (-493.000) (-503.939) (-511.678) [-472.528] -- 0:05:32
Average standard deviation of split frequencies: 0.019858
156000 -- (-497.645) [-477.767] (-497.012) (-485.106) * (-493.999) (-490.575) (-510.488) [-480.941] -- 0:05:35
157000 -- (-493.891) [-476.027] (-494.067) (-491.575) * (-492.005) (-506.773) (-502.601) [-477.921] -- 0:05:32
158000 -- (-496.347) [-475.421] (-508.050) (-490.571) * (-487.483) (-495.576) (-505.705) [-477.483] -- 0:05:35
159000 -- (-496.484) [-470.089] (-513.433) (-488.107) * (-493.708) (-504.591) (-499.180) [-476.481] -- 0:05:33
160000 -- (-494.428) [-475.382] (-492.277) (-490.489) * (-497.224) (-510.544) (-498.555) [-478.533] -- 0:05:30
Average standard deviation of split frequencies: 0.022005
161000 -- (-491.567) [-474.190] (-502.796) (-498.370) * (-481.871) (-502.011) (-503.981) [-471.752] -- 0:05:33
162000 -- (-499.314) [-469.550] (-494.007) (-505.724) * (-483.976) (-494.972) (-500.195) [-469.283] -- 0:05:31
163000 -- (-493.097) [-474.488] (-498.752) (-493.292) * (-484.168) (-490.203) (-492.865) [-471.233] -- 0:05:33
164000 -- (-489.291) [-468.904] (-505.556) (-498.088) * (-484.339) (-494.097) (-506.082) [-473.803] -- 0:05:31
165000 -- (-496.334) [-477.442] (-503.563) (-480.720) * (-494.656) (-495.369) (-493.322) [-475.249] -- 0:05:28
Average standard deviation of split frequencies: 0.016471
166000 -- (-497.458) [-477.407] (-491.811) (-484.440) * (-493.201) (-502.700) (-495.028) [-471.702] -- 0:05:31
167000 -- (-489.148) [-473.946] (-490.651) (-490.986) * (-490.765) (-495.406) (-501.779) [-473.676] -- 0:05:29
168000 -- (-494.022) [-475.954] (-497.910) (-485.849) * (-490.626) (-500.105) (-493.000) [-471.302] -- 0:05:31
169000 -- (-490.860) [-475.818] (-499.186) (-497.244) * (-497.065) (-499.971) (-503.571) [-478.332] -- 0:05:29
170000 -- (-488.785) [-472.243] (-500.964) (-488.314) * (-497.148) (-493.673) (-508.875) [-475.306] -- 0:05:27
Average standard deviation of split frequencies: 0.016998
171000 -- (-496.659) [-472.237] (-503.271) (-488.286) * (-493.683) (-494.362) (-509.486) [-474.255] -- 0:05:29
172000 -- (-487.648) [-469.706] (-499.248) (-486.939) * (-496.906) (-506.172) (-498.525) [-471.425] -- 0:05:27
173000 -- (-489.303) [-472.553] (-493.201) (-492.588) * (-492.646) (-497.161) (-499.234) [-475.414] -- 0:05:25
174000 -- (-492.282) [-473.466] (-493.917) (-486.260) * (-486.341) (-512.199) (-499.142) [-481.543] -- 0:05:27
175000 -- (-490.285) [-481.690] (-503.837) (-491.573) * (-493.949) (-497.611) (-504.376) [-475.181] -- 0:05:25
Average standard deviation of split frequencies: 0.018303
176000 -- (-488.811) [-471.831] (-505.860) (-489.077) * (-491.072) (-487.453) (-498.637) [-474.297] -- 0:05:27
177000 -- (-492.472) [-476.591] (-493.696) (-488.592) * (-490.640) (-490.707) (-502.428) [-483.409] -- 0:05:25
178000 -- (-486.489) [-475.357] (-495.263) (-486.128) * (-494.679) (-482.173) (-495.851) [-477.775] -- 0:05:23
179000 -- (-495.802) [-475.113] (-492.132) (-483.100) * (-491.600) (-490.435) (-493.104) [-479.335] -- 0:05:25
180000 -- (-499.161) [-482.488] (-491.476) (-481.931) * (-496.393) (-493.573) (-491.613) [-478.198] -- 0:05:23
Average standard deviation of split frequencies: 0.018555
181000 -- (-493.493) [-477.313] (-492.633) (-491.273) * (-492.797) (-494.250) (-499.311) [-476.890] -- 0:05:25
182000 -- (-490.713) [-476.645] (-494.808) (-491.649) * (-492.602) (-491.273) (-499.465) [-478.834] -- 0:05:23
183000 -- (-501.965) [-473.327] (-501.708) (-485.929) * (-489.381) (-491.054) (-488.390) [-473.601] -- 0:05:21
184000 -- (-499.668) [-475.779] (-491.216) (-496.588) * (-486.915) (-486.708) (-495.298) [-469.810] -- 0:05:23
185000 -- (-491.864) [-470.608] (-502.765) (-497.430) * (-491.492) (-491.502) (-494.929) [-475.852] -- 0:05:21
Average standard deviation of split frequencies: 0.016051
186000 -- (-500.741) [-469.763] (-492.955) (-492.582) * (-498.355) (-490.156) (-500.111) [-477.845] -- 0:05:19
187000 -- (-488.523) [-470.881] (-492.860) (-515.745) * (-493.365) (-509.631) (-502.039) [-474.711] -- 0:05:21
188000 -- (-486.833) [-471.683] (-497.871) (-497.055) * (-492.172) (-504.943) (-498.103) [-478.094] -- 0:05:19
189000 -- (-491.183) [-474.782] (-494.102) (-504.210) * (-488.032) (-492.267) (-494.340) [-475.980] -- 0:05:21
190000 -- (-500.772) [-479.395] (-488.213) (-493.792) * (-495.754) (-492.801) (-490.728) [-475.175] -- 0:05:19
Average standard deviation of split frequencies: 0.016183
191000 -- (-490.049) [-478.595] (-491.949) (-490.775) * (-498.784) (-485.820) (-495.189) [-469.971] -- 0:05:17
192000 -- (-483.320) [-472.907] (-494.360) (-503.380) * (-502.500) (-490.112) (-494.593) [-474.900] -- 0:05:19
193000 -- (-490.240) [-470.178] (-494.728) (-496.287) * (-491.704) (-496.979) (-501.634) [-471.671] -- 0:05:17
194000 -- (-492.661) [-472.409] (-495.707) (-494.148) * (-492.571) (-492.867) (-498.384) [-476.333] -- 0:05:19
195000 -- (-496.926) [-471.898] (-496.648) (-499.518) * (-486.846) (-496.352) (-496.572) [-480.934] -- 0:05:17
Average standard deviation of split frequencies: 0.013775
196000 -- (-502.888) [-472.862] (-493.512) (-495.710) * (-488.702) (-498.517) (-492.068) [-471.598] -- 0:05:15
197000 -- (-503.242) [-473.634] (-489.076) (-503.283) * (-492.180) (-501.429) (-494.072) [-474.677] -- 0:05:17
198000 -- (-499.737) [-476.070] (-492.428) (-506.702) * (-494.162) (-494.823) (-502.346) [-472.969] -- 0:05:15
199000 -- (-488.213) [-476.217] (-491.196) (-497.482) * (-500.568) (-491.517) (-497.315) [-479.117] -- 0:05:17
200000 -- (-489.493) [-469.972] (-495.891) (-494.735) * (-489.897) (-504.855) (-499.257) [-473.672] -- 0:05:16
Average standard deviation of split frequencies: 0.014457
201000 -- (-496.776) [-475.295] (-490.403) (-503.706) * (-497.669) (-486.657) (-492.527) [-475.398] -- 0:05:14
202000 -- (-502.982) [-471.477] (-497.467) (-494.292) * (-494.742) (-494.716) (-490.464) [-477.441] -- 0:05:16
203000 -- (-499.955) [-472.427] (-490.234) (-495.681) * (-498.083) (-491.735) (-498.263) [-477.832] -- 0:05:14
204000 -- (-495.892) [-476.959] (-500.947) (-498.571) * (-495.568) (-499.474) (-498.776) [-479.039] -- 0:05:12
205000 -- (-504.481) [-472.672] (-497.572) (-486.265) * (-486.081) (-495.599) (-494.773) [-478.636] -- 0:05:14
Average standard deviation of split frequencies: 0.016019
206000 -- (-514.660) [-478.979] (-497.182) (-490.964) * (-503.190) (-488.895) (-494.061) [-477.602] -- 0:05:12
207000 -- (-508.853) [-473.054] (-495.335) (-485.367) * (-491.637) (-493.460) (-498.419) [-473.863] -- 0:05:14
208000 -- (-513.298) [-468.967] (-505.976) (-488.719) * (-489.466) (-494.020) (-496.533) [-481.515] -- 0:05:12
209000 -- (-511.920) [-472.965] (-496.737) (-495.284) * (-488.267) (-492.968) (-498.642) [-471.105] -- 0:05:10
210000 -- (-489.739) [-474.290] (-500.560) (-493.759) * (-492.335) (-502.677) (-492.432) [-468.594] -- 0:05:12
Average standard deviation of split frequencies: 0.015962
211000 -- (-505.141) [-474.226] (-512.302) (-485.301) * (-489.082) (-504.872) (-493.675) [-475.319] -- 0:05:10
212000 -- (-496.222) [-475.899] (-509.038) (-485.784) * (-487.511) (-510.705) (-498.518) [-479.201] -- 0:05:12
213000 -- (-499.161) [-471.139] (-507.688) (-487.981) * (-493.454) (-493.220) (-497.088) [-475.207] -- 0:05:10
214000 -- (-494.291) [-470.326] (-501.596) (-491.806) * (-488.724) (-496.845) (-497.916) [-475.482] -- 0:05:08
215000 -- (-489.941) [-475.428] (-506.076) (-488.818) * (-491.492) (-495.645) (-502.665) [-477.492] -- 0:05:10
Average standard deviation of split frequencies: 0.015613
216000 -- (-489.864) [-473.317] (-507.653) (-496.353) * (-488.940) (-498.413) (-502.155) [-471.007] -- 0:05:08
217000 -- (-485.474) [-475.015] (-505.788) (-488.623) * (-487.351) (-504.093) (-518.186) [-482.198] -- 0:05:10
218000 -- (-500.644) [-472.478] (-509.640) (-490.092) * (-491.543) (-497.665) (-497.187) [-475.291] -- 0:05:08
219000 -- (-501.336) [-471.977] (-504.881) (-492.925) * (-499.700) (-496.788) (-499.635) [-476.764] -- 0:05:06
220000 -- (-502.910) [-473.968] (-505.058) (-495.043) * (-489.445) (-504.734) (-493.572) [-474.385] -- 0:05:08
Average standard deviation of split frequencies: 0.015381
221000 -- (-504.308) [-472.524] (-493.584) (-488.676) * (-496.783) (-503.102) (-489.545) [-476.884] -- 0:05:06
222000 -- (-497.656) [-469.738] (-497.391) (-488.488) * (-497.346) (-497.345) (-496.706) [-475.546] -- 0:05:08
223000 -- (-496.677) [-471.527] (-495.430) (-489.985) * (-496.086) (-496.995) (-496.842) [-474.957] -- 0:05:06
224000 -- (-493.729) [-474.600] (-510.818) (-490.353) * (-493.818) (-504.303) (-494.137) [-473.556] -- 0:05:04
225000 -- (-494.730) [-474.656] (-500.289) (-497.323) * (-500.071) (-497.434) (-495.790) [-481.017] -- 0:05:06
Average standard deviation of split frequencies: 0.013732
226000 -- (-493.586) [-477.595] (-493.691) (-491.161) * (-493.626) (-510.083) (-487.090) [-474.432] -- 0:05:04
227000 -- (-495.304) [-481.023] (-506.024) (-490.272) * (-491.140) (-497.466) (-503.103) [-473.650] -- 0:05:06
228000 -- (-500.737) [-477.935] (-491.849) (-486.372) * (-492.533) (-490.291) (-490.549) [-476.004] -- 0:05:04
229000 -- (-497.579) [-476.435] (-502.471) (-484.308) * (-498.039) (-488.071) (-494.975) [-475.194] -- 0:05:03
230000 -- (-496.747) [-472.254] (-495.675) (-486.081) * (-492.273) (-488.005) (-494.853) [-475.445] -- 0:05:04
Average standard deviation of split frequencies: 0.016164
231000 -- (-490.107) [-471.804] (-495.082) (-498.007) * (-483.591) (-486.777) (-504.480) [-473.767] -- 0:05:02
232000 -- (-493.764) [-474.263] (-505.156) (-492.938) * (-499.259) (-490.080) (-494.287) [-475.671] -- 0:05:01
233000 -- (-488.971) [-468.927] (-495.838) (-496.217) * (-497.212) (-500.512) (-492.068) [-475.810] -- 0:05:02
234000 -- (-495.016) [-474.693] (-497.250) (-501.332) * (-491.962) (-493.928) (-497.615) [-476.106] -- 0:05:01
235000 -- (-489.836) [-473.718] (-493.028) (-496.835) * (-498.047) (-487.113) (-513.249) [-475.671] -- 0:05:02
Average standard deviation of split frequencies: 0.015980
236000 -- (-491.647) [-475.076] (-497.432) (-494.757) * (-498.856) (-495.238) (-501.524) [-470.743] -- 0:05:01
237000 -- (-491.326) [-473.440] (-496.641) (-501.766) * (-498.588) (-487.798) (-498.718) [-474.481] -- 0:04:59
238000 -- (-492.420) [-476.611] (-492.986) (-497.824) * (-500.588) (-487.489) (-512.746) [-472.209] -- 0:05:00
239000 -- (-496.013) [-479.458] (-493.273) (-495.657) * (-491.234) (-486.549) (-524.795) [-476.840] -- 0:04:59
240000 -- (-492.811) [-477.544] (-495.756) (-495.906) * (-491.697) (-489.509) (-511.079) [-472.869] -- 0:05:00
Average standard deviation of split frequencies: 0.016258
241000 -- (-503.171) [-476.865] (-492.192) (-499.136) * (-488.772) (-490.820) (-505.905) [-472.810] -- 0:04:59
242000 -- (-485.834) [-478.632] (-490.512) (-500.082) * (-486.890) (-495.293) (-495.446) [-469.461] -- 0:04:57
243000 -- (-491.744) [-484.897] (-496.910) (-493.938) * (-485.103) (-485.025) (-513.319) [-475.192] -- 0:04:59
244000 -- (-486.758) [-476.722] (-495.819) (-493.272) * (-484.695) (-490.473) (-503.935) [-475.551] -- 0:04:57
245000 -- (-495.774) [-473.328] (-503.158) (-494.182) * (-488.513) (-489.242) (-509.437) [-475.491] -- 0:04:58
Average standard deviation of split frequencies: 0.016027
246000 -- (-494.536) [-477.017] (-502.201) (-492.734) * (-486.620) (-487.643) (-500.431) [-475.145] -- 0:04:57
247000 -- (-491.863) [-477.148] (-498.533) (-489.097) * (-487.992) (-487.102) (-512.292) [-470.486] -- 0:04:55
248000 -- (-486.203) [-471.537] (-492.145) (-496.319) * (-493.688) (-485.565) (-500.367) [-475.751] -- 0:04:57
249000 -- (-505.017) [-472.411] (-494.001) (-488.981) * (-490.825) (-492.346) (-501.940) [-474.417] -- 0:04:55
250000 -- (-488.981) [-469.029] (-490.348) (-484.770) * (-480.738) (-505.853) (-502.166) [-472.140] -- 0:04:57
Average standard deviation of split frequencies: 0.016361
251000 -- (-500.838) [-473.766] (-495.621) (-485.214) * (-495.699) (-502.849) (-501.849) [-470.613] -- 0:04:55
252000 -- (-501.218) [-478.218] (-492.727) (-481.308) * (-489.609) (-494.057) (-494.911) [-474.455] -- 0:04:53
253000 -- (-504.484) [-471.337] (-500.262) (-491.297) * (-492.222) (-495.195) (-492.802) [-479.709] -- 0:04:55
254000 -- (-499.576) [-473.075] (-502.624) (-490.726) * (-491.416) (-491.855) (-491.006) [-476.286] -- 0:04:53
255000 -- (-496.767) [-473.417] (-495.266) (-497.797) * (-498.396) (-489.507) (-490.351) [-473.814] -- 0:04:55
Average standard deviation of split frequencies: 0.016777
256000 -- (-501.234) [-472.308] (-495.297) (-490.178) * (-490.682) (-484.751) (-500.736) [-472.701] -- 0:04:53
257000 -- (-508.410) [-480.036] (-504.450) (-501.506) * (-510.050) (-490.443) (-494.360) [-472.325] -- 0:04:51
258000 -- (-496.385) [-472.283] (-498.185) (-508.780) * (-501.446) (-490.165) (-506.869) [-472.179] -- 0:04:53
259000 -- (-488.675) [-474.881] (-497.954) (-494.948) * (-500.525) (-495.354) (-492.488) [-472.954] -- 0:04:51
260000 -- (-503.715) [-475.263] (-508.788) (-495.902) * (-486.830) (-511.550) (-503.859) [-466.789] -- 0:04:50
Average standard deviation of split frequencies: 0.016276
261000 -- (-500.603) [-475.994] (-501.359) (-505.863) * (-485.318) (-510.285) (-502.289) [-473.020] -- 0:04:51
262000 -- (-491.963) [-473.001] (-507.923) (-507.746) * (-495.259) (-502.277) (-499.208) [-476.491] -- 0:04:50
263000 -- (-500.997) [-471.718] (-491.961) (-495.204) * (-491.554) (-512.828) (-500.525) [-477.718] -- 0:04:51
264000 -- (-506.088) [-469.314] (-497.231) (-497.265) * (-493.671) (-504.824) (-501.742) [-478.750] -- 0:04:49
265000 -- (-506.555) [-473.341] (-497.069) (-488.895) * (-486.313) (-506.691) (-512.191) [-475.803] -- 0:04:48
Average standard deviation of split frequencies: 0.015359
266000 -- (-499.894) [-476.250] (-497.903) (-493.206) * (-488.959) (-503.654) (-506.297) [-474.771] -- 0:04:49
267000 -- (-502.680) [-475.608] (-502.189) (-490.509) * (-491.325) (-496.929) (-516.187) [-474.186] -- 0:04:48
268000 -- (-504.039) [-478.448] (-505.161) (-500.554) * (-487.602) (-501.314) (-501.507) [-470.379] -- 0:04:49
269000 -- (-494.590) [-477.447] (-501.360) (-493.851) * (-502.020) (-498.090) (-501.442) [-474.439] -- 0:04:48
270000 -- (-500.359) [-475.605] (-497.232) (-500.943) * (-487.854) (-501.750) (-495.266) [-479.608] -- 0:04:46
Average standard deviation of split frequencies: 0.013933
271000 -- (-500.116) [-475.435] (-499.481) (-498.651) * (-497.171) (-505.389) (-492.957) [-478.537] -- 0:04:47
272000 -- (-500.431) [-475.301] (-495.660) (-491.933) * (-496.046) (-498.458) (-490.987) [-477.708] -- 0:04:46
273000 -- (-501.727) [-477.481] (-502.181) (-494.569) * (-497.680) (-496.822) (-492.011) [-473.495] -- 0:04:47
274000 -- (-495.403) [-472.828] (-494.657) (-487.123) * (-514.711) (-496.095) (-502.307) [-474.186] -- 0:04:46
275000 -- (-494.504) [-482.277] (-494.884) (-502.236) * (-509.121) (-499.355) (-500.104) [-476.264] -- 0:04:44
Average standard deviation of split frequencies: 0.013664
276000 -- (-497.144) [-481.235] (-488.734) (-495.009) * (-490.527) (-503.744) (-493.813) [-477.715] -- 0:04:45
277000 -- (-501.171) [-482.852] (-490.241) (-492.003) * (-487.852) (-498.036) (-497.735) [-476.729] -- 0:04:44
278000 -- (-495.846) [-475.140] (-489.953) (-495.309) * (-498.558) (-495.268) (-497.375) [-475.068] -- 0:04:45
279000 -- (-507.989) [-469.474] (-490.215) (-488.361) * (-486.424) (-491.269) (-497.796) [-473.511] -- 0:04:44
280000 -- (-489.237) [-473.988] (-496.567) (-486.451) * (-485.538) (-491.448) (-492.207) [-479.838] -- 0:04:42
Average standard deviation of split frequencies: 0.015422
281000 -- (-486.337) [-475.407] (-491.983) (-496.829) * (-488.014) (-492.385) (-498.051) [-480.334] -- 0:04:44
282000 -- (-492.670) [-471.660] (-490.252) (-491.702) * (-486.197) (-505.312) (-488.235) [-471.553] -- 0:04:42
283000 -- (-493.533) [-477.393] (-491.033) (-489.557) * (-495.676) (-495.658) (-498.616) [-474.228] -- 0:04:43
284000 -- (-487.240) [-480.142] (-496.744) (-501.120) * (-490.550) (-494.510) (-492.488) [-469.458] -- 0:04:42
285000 -- (-492.893) [-471.740] (-503.838) (-489.980) * (-489.961) (-499.556) (-500.111) [-471.027] -- 0:04:40
Average standard deviation of split frequencies: 0.014385
286000 -- (-489.346) [-478.177] (-506.308) (-489.217) * (-490.001) (-491.366) (-495.105) [-470.866] -- 0:04:42
287000 -- (-487.271) [-474.186] (-503.080) (-496.112) * (-487.562) (-488.275) (-493.640) [-470.940] -- 0:04:40
288000 -- (-485.668) [-469.095] (-487.823) (-491.367) * (-487.564) (-487.571) (-493.401) [-471.500] -- 0:04:39
289000 -- (-490.044) [-478.421] (-495.265) (-495.014) * (-482.961) (-489.755) (-495.503) [-476.162] -- 0:04:40
290000 -- (-489.728) [-471.810] (-492.269) (-500.755) * (-487.651) (-494.608) (-495.621) [-472.333] -- 0:04:39
Average standard deviation of split frequencies: 0.013417
291000 -- (-483.044) [-472.066] (-493.011) (-490.615) * (-489.186) (-496.508) (-491.437) [-483.347] -- 0:04:40
292000 -- (-493.836) [-468.604] (-497.407) (-489.690) * (-486.909) (-502.476) (-497.649) [-480.900] -- 0:04:38
293000 -- (-491.433) [-474.801] (-495.700) (-489.546) * (-488.360) (-491.419) (-500.793) [-475.824] -- 0:04:37
294000 -- (-485.989) [-474.237] (-503.393) (-493.311) * (-484.546) (-496.778) (-493.454) [-475.835] -- 0:04:38
295000 -- (-492.355) [-476.685] (-518.420) (-490.247) * (-489.526) (-496.935) (-496.896) [-475.110] -- 0:04:37
Average standard deviation of split frequencies: 0.014687
296000 -- (-494.462) [-471.087] (-492.011) (-496.565) * (-490.904) (-505.666) (-494.432) [-477.134] -- 0:04:38
297000 -- (-489.209) [-476.752] (-497.303) (-490.971) * (-487.913) (-488.479) (-495.520) [-475.198] -- 0:04:36
298000 -- (-488.493) [-468.170] (-490.862) (-494.192) * (-499.088) (-493.309) (-495.383) [-474.474] -- 0:04:35
299000 -- (-495.459) [-474.395] (-498.122) (-490.047) * (-495.018) (-496.246) (-489.308) [-472.080] -- 0:04:36
300000 -- (-493.840) [-477.025] (-499.551) (-490.295) * (-506.819) (-493.203) (-493.611) [-472.812] -- 0:04:35
Average standard deviation of split frequencies: 0.016127
301000 -- (-493.699) [-476.143] (-488.853) (-487.849) * (-494.417) (-488.947) (-505.323) [-473.874] -- 0:04:36
302000 -- (-498.220) [-482.659] (-503.764) (-499.441) * (-494.389) (-488.383) (-499.496) [-472.213] -- 0:04:35
303000 -- (-499.412) [-470.841] (-492.878) (-488.926) * (-486.770) (-493.007) (-512.202) [-476.547] -- 0:04:33
304000 -- (-497.678) [-473.389] (-494.684) (-487.812) * (-490.921) (-489.326) (-505.171) [-475.235] -- 0:04:34
305000 -- (-492.285) [-478.151] (-491.653) (-484.967) * (-496.722) (-490.450) (-497.590) [-483.095] -- 0:04:33
Average standard deviation of split frequencies: 0.013557
306000 -- (-490.912) [-478.557] (-496.830) (-489.812) * (-503.149) (-488.776) (-498.704) [-476.236] -- 0:04:32
307000 -- (-496.258) [-478.567] (-496.400) (-491.125) * (-501.563) (-491.281) (-494.822) [-481.339] -- 0:04:33
308000 -- (-488.176) [-480.603] (-501.194) (-492.889) * (-500.217) (-496.908) (-493.350) [-471.920] -- 0:04:31
309000 -- (-491.182) [-482.323] (-490.664) (-499.854) * (-495.369) (-507.538) (-503.611) [-473.873] -- 0:04:32
310000 -- (-495.196) [-481.822] (-496.581) (-495.806) * (-492.966) (-499.307) (-503.044) [-471.855] -- 0:04:31
Average standard deviation of split frequencies: 0.012476
311000 -- (-493.004) [-471.536] (-495.815) (-491.517) * (-491.190) (-495.774) (-506.091) [-481.352] -- 0:04:30
312000 -- (-499.391) [-478.010] (-498.189) (-497.967) * (-489.540) (-490.823) (-515.408) [-484.949] -- 0:04:31
313000 -- (-496.760) [-475.956] (-488.334) (-491.097) * (-489.491) (-493.938) (-509.156) [-478.493] -- 0:04:29
314000 -- (-491.877) [-478.595] (-496.467) (-484.419) * (-487.590) (-491.927) (-509.423) [-479.095] -- 0:04:30
315000 -- (-493.816) [-469.896] (-499.850) (-487.842) * (-490.864) (-493.495) (-498.203) [-473.892] -- 0:04:29
Average standard deviation of split frequencies: 0.012787
316000 -- (-499.568) [-470.622] (-497.381) (-497.069) * (-495.821) (-488.580) (-500.612) [-473.086] -- 0:04:28
317000 -- (-490.493) [-473.275] (-500.064) (-492.607) * (-490.810) (-494.661) (-502.053) [-475.198] -- 0:04:29
318000 -- (-491.503) [-468.806] (-503.190) (-496.405) * (-487.318) (-496.713) (-499.574) [-472.023] -- 0:04:28
319000 -- (-491.302) [-472.665] (-502.040) (-482.881) * (-494.870) (-502.810) (-499.432) [-468.978] -- 0:04:28
320000 -- (-497.352) [-473.845] (-507.168) (-488.992) * (-493.483) (-493.023) (-506.914) [-475.829] -- 0:04:27
Average standard deviation of split frequencies: 0.011944
321000 -- (-495.028) [-476.684] (-507.465) (-492.802) * (-497.566) (-489.368) (-497.163) [-474.781] -- 0:04:26
322000 -- (-502.087) [-473.783] (-495.736) (-497.800) * (-487.646) (-494.802) (-506.385) [-470.312] -- 0:04:27
323000 -- (-503.775) [-475.630] (-490.412) (-490.952) * (-486.461) (-490.704) (-495.096) [-473.479] -- 0:04:26
324000 -- (-493.625) [-483.550] (-498.804) (-490.358) * (-493.268) (-487.733) (-509.717) [-474.291] -- 0:04:27
325000 -- (-490.276) [-481.467] (-499.154) (-499.085) * (-491.959) (-497.999) (-508.243) [-476.494] -- 0:04:25
Average standard deviation of split frequencies: 0.012854
326000 -- (-489.773) [-479.868] (-494.064) (-508.030) * (-481.395) (-492.938) (-503.339) [-477.235] -- 0:04:24
327000 -- (-492.646) [-481.478] (-491.631) (-498.472) * (-493.183) (-490.594) (-505.869) [-472.995] -- 0:04:25
328000 -- (-492.121) [-478.122] (-491.114) (-496.827) * (-491.716) (-489.147) (-505.489) [-472.365] -- 0:04:24
329000 -- (-487.473) [-471.628] (-495.166) (-502.609) * (-488.794) (-492.055) (-499.214) [-476.251] -- 0:04:25
330000 -- (-488.851) [-472.629] (-496.694) (-499.289) * (-487.595) (-488.505) (-509.488) [-474.009] -- 0:04:23
Average standard deviation of split frequencies: 0.012672
331000 -- (-492.186) [-475.132] (-488.528) (-490.445) * (-500.534) (-489.464) (-512.364) [-472.588] -- 0:04:22
332000 -- (-487.706) [-474.008] (-497.948) (-493.595) * (-491.072) (-493.144) (-502.811) [-474.491] -- 0:04:23
333000 -- (-486.144) [-477.190] (-497.724) (-508.009) * (-485.920) (-488.801) (-495.332) [-472.907] -- 0:04:22
334000 -- (-492.601) [-472.282] (-493.009) (-508.601) * (-484.233) (-501.789) (-490.140) [-471.830] -- 0:04:23
335000 -- (-496.697) [-475.803] (-491.665) (-507.297) * (-484.991) (-494.053) (-492.262) [-478.039] -- 0:04:22
Average standard deviation of split frequencies: 0.011825
336000 -- (-494.683) [-474.638] (-494.309) (-501.210) * (-497.701) (-495.508) (-498.341) [-475.080] -- 0:04:20
337000 -- (-492.967) [-473.600] (-496.188) (-513.470) * (-489.744) (-500.093) (-512.790) [-471.957] -- 0:04:21
338000 -- (-487.750) [-477.200] (-501.184) (-496.313) * (-488.013) (-492.631) (-503.723) [-472.633] -- 0:04:20
339000 -- (-490.423) [-475.217] (-500.757) (-508.062) * (-494.053) (-493.799) (-505.184) [-472.148] -- 0:04:19
340000 -- (-488.138) [-472.170] (-499.307) (-504.327) * (-489.943) (-491.892) (-501.164) [-473.320] -- 0:04:20
Average standard deviation of split frequencies: 0.010675
341000 -- (-487.401) [-475.617] (-496.682) (-501.028) * (-488.362) (-496.913) (-497.145) [-471.223] -- 0:04:18
342000 -- (-491.464) [-470.507] (-497.283) (-511.555) * (-488.724) (-483.792) (-492.517) [-470.692] -- 0:04:19
343000 -- (-493.512) [-477.184] (-497.762) (-502.791) * (-484.088) (-491.919) (-497.497) [-468.216] -- 0:04:18
344000 -- (-494.493) [-475.411] (-491.961) (-511.512) * (-486.347) (-495.675) (-495.957) [-477.104] -- 0:04:17
345000 -- (-487.889) [-473.681] (-502.341) (-508.072) * (-485.950) (-482.939) (-495.656) [-476.035] -- 0:04:18
Average standard deviation of split frequencies: 0.012398
346000 -- (-490.050) [-473.331] (-511.739) (-487.925) * (-485.319) (-493.020) (-496.695) [-477.828] -- 0:04:17
347000 -- (-490.912) [-475.227] (-506.858) (-495.088) * (-489.964) (-509.075) (-490.438) [-480.145] -- 0:04:17
348000 -- (-494.065) [-468.848] (-499.326) (-490.423) * (-485.324) (-500.272) (-493.898) [-472.064] -- 0:04:16
349000 -- (-493.684) [-471.889] (-508.276) (-489.362) * (-485.029) (-491.634) (-493.932) [-482.306] -- 0:04:15
350000 -- (-502.785) [-470.231] (-509.799) (-484.680) * (-493.392) (-490.199) (-496.733) [-478.066] -- 0:04:16
Average standard deviation of split frequencies: 0.013578
351000 -- (-487.528) [-473.288] (-502.779) (-487.356) * (-488.165) (-492.753) (-505.373) [-479.136] -- 0:04:15
352000 -- (-495.790) [-474.559] (-504.998) (-490.637) * (-498.200) (-495.332) (-509.386) [-475.761] -- 0:04:15
353000 -- (-489.066) [-471.468] (-495.086) (-484.558) * (-490.673) (-488.486) (-496.126) [-476.733] -- 0:04:14
354000 -- (-500.646) [-477.096] (-498.821) (-488.437) * (-483.782) (-501.605) (-491.904) [-480.626] -- 0:04:13
355000 -- (-497.564) [-470.027] (-498.573) (-488.708) * (-497.144) (-487.644) (-493.535) [-475.404] -- 0:04:14
Average standard deviation of split frequencies: 0.012653
356000 -- (-491.132) [-470.305] (-495.124) (-491.942) * (-489.617) (-492.410) (-499.015) [-479.171] -- 0:04:13
357000 -- (-492.511) [-472.082] (-489.507) (-497.697) * (-494.535) (-496.349) (-498.764) [-481.553] -- 0:04:12
358000 -- (-500.934) [-478.262] (-494.837) (-495.673) * (-484.315) (-501.842) (-492.664) [-484.673] -- 0:04:12
359000 -- (-496.751) [-478.036] (-495.993) (-489.927) * (-499.760) (-501.575) (-492.088) [-481.253] -- 0:04:11
360000 -- (-492.968) [-473.031] (-492.600) (-497.608) * (-495.649) (-497.889) (-497.792) [-486.099] -- 0:04:12
Average standard deviation of split frequencies: 0.012907
361000 -- (-490.960) [-472.659] (-497.596) (-499.227) * (-493.917) (-485.685) (-494.250) [-488.663] -- 0:04:11
362000 -- (-487.071) [-473.496] (-502.455) (-498.299) * (-482.264) (-492.038) (-500.223) [-475.852] -- 0:04:10
363000 -- (-487.385) [-475.333] (-497.597) (-501.345) * (-493.908) (-494.600) (-497.073) [-475.571] -- 0:04:10
364000 -- (-488.492) [-473.023] (-502.020) (-505.199) * (-496.913) (-489.148) (-512.678) [-470.987] -- 0:04:09
365000 -- (-494.388) [-476.129] (-496.287) (-504.971) * (-497.880) (-492.810) (-500.631) [-476.563] -- 0:04:10
Average standard deviation of split frequencies: 0.012665
366000 -- (-496.739) [-470.872] (-489.366) (-492.147) * (-484.073) (-502.303) (-504.486) [-472.303] -- 0:04:09
367000 -- (-492.366) [-474.196] (-498.683) (-494.722) * (-490.067) (-488.471) (-500.631) [-481.040] -- 0:04:08
368000 -- (-490.937) [-480.894] (-498.672) (-499.501) * (-495.031) (-500.087) (-494.411) [-479.944] -- 0:04:09
369000 -- (-495.211) [-474.461] (-511.804) (-493.570) * (-483.963) (-491.726) (-502.483) [-473.708] -- 0:04:07
370000 -- (-497.374) [-474.443] (-495.257) (-514.006) * (-496.569) (-493.164) (-494.646) [-479.660] -- 0:04:08
Average standard deviation of split frequencies: 0.010984
371000 -- (-496.570) [-478.410] (-492.587) (-492.016) * (-509.569) (-492.157) (-498.947) [-482.098] -- 0:04:07
372000 -- (-501.284) [-478.130] (-490.634) (-485.746) * (-495.409) (-488.546) (-501.359) [-481.314] -- 0:04:06
373000 -- (-497.536) [-482.969] (-488.463) (-493.488) * (-488.189) (-492.873) (-493.902) [-482.740] -- 0:04:07
374000 -- (-490.590) [-476.694] (-501.120) (-491.291) * (-488.167) (-490.306) (-493.291) [-471.198] -- 0:04:06
375000 -- (-497.577) [-481.802] (-497.646) (-491.284) * (-495.628) (-485.741) (-499.712) [-472.417] -- 0:04:05
Average standard deviation of split frequencies: 0.012287
376000 -- (-486.820) [-477.693] (-492.931) (-497.545) * (-493.509) (-492.522) (-506.106) [-472.960] -- 0:04:05
377000 -- (-487.276) [-472.703] (-491.537) (-494.977) * (-509.685) (-490.692) (-488.485) [-469.856] -- 0:04:04
378000 -- (-501.701) [-473.069] (-500.228) (-490.615) * (-506.983) (-485.306) (-496.826) [-472.119] -- 0:04:05
379000 -- (-495.948) [-475.922] (-494.184) (-487.299) * (-504.491) (-485.514) (-507.573) [-475.463] -- 0:04:04
380000 -- (-493.326) [-481.874] (-498.243) (-499.040) * (-510.646) (-484.063) (-513.173) [-472.693] -- 0:04:03
Average standard deviation of split frequencies: 0.011641
381000 -- (-490.276) [-478.015] (-492.206) (-496.908) * (-503.776) (-488.533) (-507.883) [-467.584] -- 0:04:03
382000 -- (-498.680) [-473.254] (-487.266) (-500.614) * (-499.002) (-491.735) (-511.486) [-477.574] -- 0:04:02
383000 -- (-486.952) [-476.619] (-486.450) (-509.130) * (-497.847) (-500.999) (-507.195) [-480.874] -- 0:04:03
384000 -- (-494.973) [-476.396] (-494.090) (-505.463) * (-489.084) (-489.282) (-507.681) [-475.280] -- 0:04:02
385000 -- (-491.516) [-478.311] (-491.932) (-506.191) * (-501.559) (-492.307) (-507.144) [-476.800] -- 0:04:02
Average standard deviation of split frequencies: 0.011768
386000 -- (-489.534) [-475.492] (-499.556) (-487.550) * (-500.359) (-509.154) (-501.229) [-477.308] -- 0:04:01
387000 -- (-491.355) [-475.061] (-491.921) (-494.152) * (-498.357) (-513.400) (-507.497) [-472.262] -- 0:04:00
388000 -- (-481.705) [-476.073] (-498.040) (-495.460) * (-497.616) (-507.474) (-509.927) [-469.976] -- 0:04:01
389000 -- (-484.541) [-474.453] (-497.362) (-496.809) * (-489.576) (-488.490) (-515.788) [-474.555] -- 0:04:00
390000 -- (-483.448) [-472.367] (-503.931) (-498.413) * (-496.320) (-487.421) (-510.217) [-473.277] -- 0:03:59
Average standard deviation of split frequencies: 0.010257
391000 -- (-490.004) [-475.585] (-496.812) (-501.400) * (-482.463) (-493.525) (-498.332) [-474.391] -- 0:03:59
392000 -- (-495.828) [-470.455] (-508.205) (-495.441) * (-496.544) (-495.113) (-511.438) [-478.996] -- 0:03:58
393000 -- (-492.877) [-478.633] (-524.036) (-491.185) * (-493.160) (-493.136) (-504.678) [-468.980] -- 0:03:59
394000 -- (-495.836) [-471.364] (-519.490) (-488.191) * (-484.619) (-493.544) (-503.580) [-470.135] -- 0:03:58
395000 -- (-496.929) [-474.591] (-511.632) (-486.688) * (-494.416) (-494.251) (-503.544) [-474.411] -- 0:03:57
Average standard deviation of split frequencies: 0.010416
396000 -- (-502.680) [-479.984] (-498.032) (-493.299) * (-490.128) (-503.827) (-498.960) [-474.287] -- 0:03:57
397000 -- (-503.190) [-474.503] (-494.847) (-488.027) * (-487.042) (-490.930) (-502.886) [-473.702] -- 0:03:56
398000 -- (-501.817) [-470.163] (-492.543) (-487.419) * (-484.913) (-494.789) (-504.045) [-470.943] -- 0:03:57
399000 -- (-487.522) [-482.458] (-487.964) (-491.525) * (-491.046) (-505.023) (-492.510) [-473.779] -- 0:03:56
400000 -- (-494.893) [-475.707] (-491.821) (-491.628) * (-490.281) (-498.821) (-497.700) [-472.635] -- 0:03:55
Average standard deviation of split frequencies: 0.010589
401000 -- (-495.574) [-472.644] (-491.131) (-486.132) * (-491.339) (-496.392) (-494.859) [-474.407] -- 0:03:56
402000 -- (-505.411) [-473.041] (-501.104) (-488.986) * (-489.848) (-497.778) (-500.492) [-477.686] -- 0:03:55
403000 -- (-495.138) [-470.246] (-495.689) (-487.972) * (-495.074) (-498.040) (-493.992) [-483.229] -- 0:03:55
404000 -- (-494.774) [-474.834] (-501.545) (-492.851) * (-492.113) (-492.730) (-490.868) [-477.699] -- 0:03:54
405000 -- (-490.862) [-474.154] (-494.586) (-507.805) * (-491.093) (-503.604) (-493.331) [-474.921] -- 0:03:53
Average standard deviation of split frequencies: 0.010218
406000 -- (-495.914) [-468.941] (-497.021) (-494.168) * (-501.212) (-501.452) (-494.296) [-475.571] -- 0:03:54
407000 -- (-496.897) [-479.378] (-495.320) (-495.443) * (-503.186) (-506.765) (-500.193) [-469.228] -- 0:03:53
408000 -- (-494.706) [-477.390] (-496.244) (-497.766) * (-484.810) (-490.056) (-501.905) [-475.351] -- 0:03:53
409000 -- (-495.063) [-476.522] (-492.508) (-500.916) * (-488.339) (-489.731) (-491.161) [-470.549] -- 0:03:52
410000 -- (-497.511) [-479.119] (-496.242) (-509.168) * (-495.273) (-497.258) (-491.573) [-475.362] -- 0:03:51
Average standard deviation of split frequencies: 0.010331
411000 -- (-489.945) [-476.030] (-494.517) (-498.781) * (-497.463) (-510.726) (-487.131) [-487.613] -- 0:03:52
412000 -- (-497.030) [-475.769] (-496.747) (-487.385) * (-488.295) (-503.967) (-492.543) [-481.370] -- 0:03:51
413000 -- (-501.783) [-476.148] (-493.287) (-490.755) * (-492.447) (-495.813) (-492.386) [-482.778] -- 0:03:51
414000 -- (-495.965) [-478.756] (-495.882) (-501.512) * (-493.526) (-489.538) (-492.607) [-483.645] -- 0:03:50
415000 -- (-496.119) [-477.605] (-503.459) (-497.197) * (-492.851) (-492.370) (-495.028) [-473.631] -- 0:03:49
Average standard deviation of split frequencies: 0.010652
416000 -- (-497.181) [-481.232] (-489.588) (-502.236) * (-496.694) (-489.217) (-493.793) [-474.114] -- 0:03:50
417000 -- (-496.326) [-474.268] (-493.080) (-494.389) * (-490.727) (-490.420) (-490.977) [-469.674] -- 0:03:49
418000 -- (-503.571) [-477.460] (-492.207) (-488.399) * (-494.012) (-490.458) (-493.702) [-467.478] -- 0:03:49
419000 -- (-493.635) [-471.854] (-497.549) (-490.444) * (-485.008) (-489.013) (-490.301) [-480.989] -- 0:03:48
420000 -- (-505.544) [-472.142] (-505.635) (-495.073) * (-490.325) (-500.482) (-491.443) [-478.558] -- 0:03:47
Average standard deviation of split frequencies: 0.010786
421000 -- (-503.613) [-477.617] (-506.411) (-501.060) * (-485.318) (-504.090) (-493.763) [-481.374] -- 0:03:48
422000 -- (-494.838) [-468.946] (-488.508) (-495.609) * (-490.660) (-498.214) (-498.968) [-477.168] -- 0:03:47
423000 -- (-502.199) [-478.077] (-497.023) (-501.420) * (-488.676) (-491.678) (-500.137) [-473.270] -- 0:03:47
424000 -- (-493.210) [-476.306] (-497.862) (-488.422) * (-488.990) (-487.089) (-493.144) [-474.512] -- 0:03:46
425000 -- (-502.631) [-475.770] (-492.689) (-490.546) * (-493.020) (-494.629) (-496.440) [-476.934] -- 0:03:45
Average standard deviation of split frequencies: 0.011896
426000 -- (-496.970) [-477.340] (-489.461) (-494.336) * (-490.505) (-504.884) (-488.452) [-477.733] -- 0:03:46
427000 -- (-485.351) [-474.714] (-488.798) (-491.883) * (-499.022) (-494.009) (-497.369) [-475.094] -- 0:03:45
428000 -- (-488.789) [-480.852] (-489.923) (-490.415) * (-492.548) (-490.792) (-497.505) [-474.413] -- 0:03:45
429000 -- (-500.330) [-472.640] (-491.694) (-488.129) * (-489.570) (-509.560) (-496.560) [-484.103] -- 0:03:44
430000 -- (-495.201) [-475.357] (-492.562) (-492.863) * (-491.312) (-491.481) (-494.366) [-478.326] -- 0:03:44
Average standard deviation of split frequencies: 0.012588
431000 -- (-503.734) [-475.709] (-496.340) (-488.820) * (-486.413) (-504.332) (-490.622) [-475.377] -- 0:03:44
432000 -- (-507.584) [-474.840] (-505.328) (-487.805) * (-482.492) (-496.944) (-503.557) [-475.457] -- 0:03:43
433000 -- (-499.867) [-476.288] (-501.907) (-485.952) * (-484.365) (-494.438) (-508.127) [-473.209] -- 0:03:43
434000 -- (-490.448) [-475.579] (-499.675) (-493.886) * (-482.932) (-492.901) (-522.450) [-474.625] -- 0:03:43
435000 -- (-489.907) [-477.903] (-500.615) (-500.468) * (-492.360) (-490.509) (-510.862) [-482.929] -- 0:03:42
Average standard deviation of split frequencies: 0.012704
436000 -- (-497.657) [-472.205] (-495.294) (-490.753) * (-486.749) (-494.262) (-504.340) [-475.178] -- 0:03:42
437000 -- (-493.513) [-473.312] (-494.562) (-493.922) * (-495.247) (-490.865) (-502.374) [-482.066] -- 0:03:41
438000 -- (-486.926) [-473.833] (-509.610) (-494.850) * (-487.528) (-487.591) (-498.110) [-475.401] -- 0:03:41
439000 -- (-488.256) [-473.509] (-497.110) (-489.060) * (-493.124) (-489.059) (-506.557) [-478.304] -- 0:03:41
440000 -- (-498.979) [-471.517] (-502.281) (-495.429) * (-489.033) (-490.307) (-506.878) [-473.426] -- 0:03:40
Average standard deviation of split frequencies: 0.012703
441000 -- (-492.456) [-475.788] (-494.491) (-486.338) * (-494.488) (-490.787) (-509.461) [-470.297] -- 0:03:40
442000 -- (-486.708) [-475.201] (-493.026) (-490.754) * (-500.230) (-488.227) (-508.721) [-473.686] -- 0:03:39
443000 -- (-497.065) [-481.104] (-491.585) (-487.845) * (-510.702) (-494.604) (-508.695) [-473.743] -- 0:03:40
444000 -- (-489.560) [-467.563] (-511.017) (-491.103) * (-497.780) (-498.934) (-498.202) [-474.675] -- 0:03:39
445000 -- (-491.202) [-474.210] (-515.336) (-497.826) * (-496.107) (-506.823) (-492.384) [-468.075] -- 0:03:38
Average standard deviation of split frequencies: 0.012155
446000 -- (-485.436) [-474.084] (-503.414) (-485.791) * (-493.092) (-496.167) (-498.522) [-474.604] -- 0:03:38
447000 -- (-501.505) [-468.813] (-499.829) (-495.359) * (-488.116) (-489.535) (-491.106) [-476.985] -- 0:03:37
448000 -- (-489.811) [-473.164] (-508.369) (-497.274) * (-487.468) (-495.477) (-502.889) [-481.633] -- 0:03:38
449000 -- (-495.689) [-475.029] (-501.953) (-490.565) * (-497.516) (-489.645) (-506.854) [-487.406] -- 0:03:37
450000 -- (-493.707) [-472.152] (-498.770) (-501.595) * (-492.684) (-494.609) (-504.054) [-474.496] -- 0:03:36
Average standard deviation of split frequencies: 0.013133
451000 -- (-499.400) [-476.829] (-503.943) (-492.706) * (-508.459) (-500.465) (-499.367) [-480.505] -- 0:03:36
452000 -- (-494.727) [-471.625] (-497.545) (-493.161) * (-506.474) (-486.313) (-497.737) [-475.858] -- 0:03:35
453000 -- (-492.206) [-476.582] (-495.794) (-491.137) * (-494.862) (-486.453) (-518.675) [-472.111] -- 0:03:36
454000 -- (-495.033) [-472.355] (-496.772) (-487.620) * (-488.510) (-493.216) (-506.291) [-472.189] -- 0:03:35
455000 -- (-503.946) [-476.912] (-494.379) (-486.140) * (-503.747) (-501.352) (-495.160) [-470.982] -- 0:03:34
Average standard deviation of split frequencies: 0.011654
456000 -- (-506.244) [-470.501] (-497.091) (-497.699) * (-497.111) (-494.221) (-507.536) [-475.148] -- 0:03:34
457000 -- (-490.975) [-479.322] (-490.783) (-495.527) * (-496.449) (-489.135) (-503.341) [-468.135] -- 0:03:33
458000 -- (-505.782) [-483.069] (-496.763) (-501.495) * (-507.679) (-488.716) (-502.603) [-472.986] -- 0:03:34
459000 -- (-488.946) [-480.883] (-494.888) (-499.331) * (-508.501) (-488.908) (-513.201) [-473.619] -- 0:03:33
460000 -- (-505.251) [-472.454] (-496.367) (-500.260) * (-494.079) (-487.012) (-499.976) [-473.508] -- 0:03:32
Average standard deviation of split frequencies: 0.010347
461000 -- (-503.183) [-469.472] (-497.144) (-491.775) * (-501.539) (-497.451) (-497.720) [-471.310] -- 0:03:32
462000 -- (-495.390) [-479.352] (-500.525) (-482.766) * (-489.276) (-514.718) (-500.790) [-476.736] -- 0:03:31
463000 -- (-499.846) [-469.913] (-505.014) (-488.921) * (-493.979) (-502.301) (-510.879) [-473.048] -- 0:03:32
464000 -- (-494.491) [-470.950] (-492.538) (-494.123) * (-495.764) (-504.940) (-507.130) [-474.372] -- 0:03:31
465000 -- (-494.976) [-472.069] (-499.656) (-496.962) * (-487.106) (-495.071) (-518.289) [-472.798] -- 0:03:30
Average standard deviation of split frequencies: 0.009891
466000 -- (-490.827) [-472.360] (-495.240) (-494.428) * (-502.200) (-496.123) (-498.471) [-478.543] -- 0:03:30
467000 -- (-491.527) [-471.253] (-491.953) (-495.930) * (-497.737) (-494.257) (-505.820) [-474.317] -- 0:03:30
468000 -- (-490.851) [-469.583] (-496.965) (-493.676) * (-497.699) (-487.034) (-494.942) [-474.663] -- 0:03:30
469000 -- (-500.556) [-472.713] (-495.854) (-493.985) * (-491.381) (-495.166) (-502.096) [-474.191] -- 0:03:29
470000 -- (-500.201) [-480.305] (-497.515) (-495.710) * (-481.350) (-493.796) (-498.088) [-467.481] -- 0:03:28
Average standard deviation of split frequencies: 0.010516
471000 -- (-490.108) [-478.591] (-493.770) (-491.944) * (-490.717) (-494.942) (-499.701) [-471.159] -- 0:03:28
472000 -- (-488.924) [-471.451] (-492.184) (-498.227) * (-494.366) (-491.039) (-504.734) [-479.644] -- 0:03:28
473000 -- (-504.653) [-480.752] (-493.828) (-495.921) * (-488.281) (-497.796) (-511.920) [-475.141] -- 0:03:27
474000 -- (-493.636) [-473.334] (-497.027) (-498.555) * (-501.055) (-489.852) (-512.095) [-479.247] -- 0:03:27
475000 -- (-491.431) [-474.001] (-496.128) (-490.977) * (-487.389) (-485.811) (-502.778) [-479.811] -- 0:03:26
Average standard deviation of split frequencies: 0.010399
476000 -- (-491.431) [-476.466] (-494.300) (-488.158) * (-492.336) (-491.751) (-500.329) [-478.564] -- 0:03:26
477000 -- (-492.112) [-473.578] (-499.227) (-494.493) * (-498.601) (-499.563) (-501.779) [-470.965] -- 0:03:26
478000 -- (-499.990) [-476.874] (-493.486) (-490.093) * (-495.014) (-486.399) (-504.894) [-472.016] -- 0:03:25
479000 -- (-487.539) [-473.521] (-498.112) (-490.411) * (-497.482) (-495.335) (-497.128) [-479.363] -- 0:03:25
480000 -- (-486.180) [-480.931] (-495.862) (-492.934) * (-497.992) (-497.405) (-503.365) [-474.257] -- 0:03:24
Average standard deviation of split frequencies: 0.011769
481000 -- (-486.900) [-475.979] (-499.767) (-497.923) * (-502.426) (-486.495) (-492.045) [-479.824] -- 0:03:25
482000 -- (-492.537) [-471.401] (-515.933) (-496.863) * (-504.399) (-501.753) (-496.665) [-472.720] -- 0:03:24
483000 -- (-494.408) [-475.114] (-500.827) (-495.668) * (-485.711) (-492.640) (-498.522) [-476.555] -- 0:03:23
484000 -- (-495.953) [-476.348] (-514.987) (-502.114) * (-487.187) (-490.199) (-506.410) [-476.572] -- 0:03:23
485000 -- (-493.909) [-480.975] (-507.151) (-501.443) * (-489.222) (-488.550) (-495.418) [-476.149] -- 0:03:22
Average standard deviation of split frequencies: 0.011761
486000 -- (-486.069) [-475.390] (-514.994) (-495.585) * (-486.249) (-500.488) (-490.970) [-477.077] -- 0:03:23
487000 -- (-489.075) [-478.425] (-504.248) (-493.425) * (-490.534) (-493.660) (-496.910) [-479.292] -- 0:03:22
488000 -- (-491.984) [-478.385] (-510.752) (-494.713) * (-493.647) (-499.477) (-500.503) [-479.339] -- 0:03:21
489000 -- (-493.573) [-476.953] (-497.532) (-491.892) * (-484.868) (-504.032) (-491.272) [-475.678] -- 0:03:21
490000 -- (-487.489) [-481.977] (-495.312) (-504.272) * (-490.522) (-501.837) (-493.693) [-480.037] -- 0:03:20
Average standard deviation of split frequencies: 0.011666
491000 -- (-488.084) [-478.872] (-493.034) (-490.580) * (-491.012) (-502.963) (-500.322) [-474.327] -- 0:03:21
492000 -- (-493.748) [-471.985] (-496.456) (-503.989) * (-503.044) (-495.513) (-496.504) [-476.041] -- 0:03:20
493000 -- (-495.885) [-470.634] (-489.659) (-499.800) * (-503.399) (-486.592) (-505.203) [-477.742] -- 0:03:19
494000 -- (-507.311) [-482.025] (-504.416) (-497.743) * (-507.818) (-502.816) (-498.835) [-477.516] -- 0:03:19
495000 -- (-492.908) [-475.467] (-495.624) (-487.871) * (-494.005) (-492.781) (-498.853) [-475.872] -- 0:03:18
Average standard deviation of split frequencies: 0.009623
496000 -- (-487.420) [-471.533] (-500.699) (-489.337) * (-496.746) (-494.447) (-496.427) [-479.718] -- 0:03:19
497000 -- (-492.365) [-471.595] (-492.011) (-493.897) * (-500.329) (-497.049) (-510.504) [-479.452] -- 0:03:18
498000 -- (-495.326) [-474.737] (-491.196) (-487.598) * (-495.031) (-493.717) (-500.634) [-476.902] -- 0:03:17
499000 -- (-496.805) [-478.244] (-486.534) (-493.579) * (-495.086) (-490.734) (-497.610) [-476.441] -- 0:03:17
500000 -- (-491.957) [-477.477] (-494.578) (-495.432) * (-496.786) (-495.326) (-491.278) [-478.185] -- 0:03:17
Average standard deviation of split frequencies: 0.009685
501000 -- (-496.209) [-473.081] (-489.164) (-500.623) * (-499.666) (-495.819) (-499.620) [-476.913] -- 0:03:17
502000 -- (-492.895) [-477.223] (-493.415) (-508.942) * (-486.395) (-494.950) (-505.077) [-473.287] -- 0:03:16
503000 -- (-495.635) [-476.291] (-504.063) (-500.076) * (-488.517) (-495.644) (-502.122) [-477.957] -- 0:03:15
504000 -- (-490.723) [-470.591] (-498.273) (-497.902) * (-487.227) (-493.084) (-500.260) [-471.529] -- 0:03:15
505000 -- (-491.419) [-483.190] (-500.864) (-497.577) * (-487.463) (-500.799) (-497.810) [-472.518] -- 0:03:15
Average standard deviation of split frequencies: 0.009083
506000 -- (-495.965) [-484.297] (-502.472) (-491.674) * (-495.636) (-504.111) (-494.032) [-472.883] -- 0:03:15
507000 -- (-491.414) [-480.315] (-506.820) (-503.075) * (-487.697) (-504.047) (-503.232) [-471.912] -- 0:03:14
508000 -- (-488.772) [-479.561] (-501.622) (-506.174) * (-495.836) (-506.281) (-513.473) [-472.749] -- 0:03:13
509000 -- (-503.870) [-475.501] (-495.696) (-504.973) * (-489.272) (-498.586) (-499.951) [-473.200] -- 0:03:13
510000 -- (-491.777) [-473.427] (-494.126) (-493.293) * (-495.140) (-499.210) (-499.626) [-473.074] -- 0:03:13
Average standard deviation of split frequencies: 0.010418
511000 -- (-490.728) [-478.344] (-494.330) (-496.213) * (-487.225) (-505.271) (-497.032) [-476.954] -- 0:03:12
512000 -- (-506.746) [-476.596] (-497.199) (-504.405) * (-487.662) (-513.796) (-511.442) [-472.808] -- 0:03:12
513000 -- (-503.271) [-475.161] (-500.582) (-487.624) * (-492.184) (-506.670) (-497.319) [-476.034] -- 0:03:11
514000 -- (-503.059) [-474.964] (-501.348) (-491.712) * (-494.931) (-499.536) (-505.776) [-472.246] -- 0:03:11
515000 -- (-504.478) [-476.151] (-497.889) (-489.754) * (-502.103) (-491.825) (-497.417) [-482.727] -- 0:03:11
Average standard deviation of split frequencies: 0.012790
516000 -- (-499.859) [-473.629] (-496.335) (-495.402) * (-490.671) (-492.722) (-495.763) [-476.460] -- 0:03:10
517000 -- (-508.763) [-476.023] (-489.910) (-503.013) * (-493.164) (-493.880) (-493.147) [-474.817] -- 0:03:10
518000 -- (-499.212) [-469.975] (-497.514) (-493.673) * (-502.237) (-490.451) (-497.654) [-476.387] -- 0:03:09
519000 -- (-496.725) [-470.795] (-486.988) (-486.637) * (-492.891) (-481.551) (-499.601) [-480.577] -- 0:03:09
520000 -- (-495.044) [-474.217] (-495.345) (-493.655) * (-494.982) (-485.846) (-504.710) [-476.824] -- 0:03:09
Average standard deviation of split frequencies: 0.013581
521000 -- (-493.268) [-475.278] (-491.673) (-487.713) * (-487.290) (-493.954) (-500.592) [-475.814] -- 0:03:08
522000 -- (-487.805) [-473.622] (-489.817) (-508.472) * (-483.827) (-486.273) (-510.308) [-480.649] -- 0:03:08
523000 -- (-494.342) [-475.451] (-492.697) (-506.416) * (-490.450) (-493.692) (-516.607) [-474.230] -- 0:03:07
524000 -- (-496.332) [-473.301] (-489.427) (-505.278) * (-485.251) (-499.770) (-490.660) [-474.885] -- 0:03:07
525000 -- (-496.052) [-478.970] (-495.075) (-508.732) * (-484.197) (-500.990) (-490.101) [-481.386] -- 0:03:07
Average standard deviation of split frequencies: 0.010642
526000 -- (-490.548) [-477.614] (-500.855) (-505.872) * (-485.335) (-495.247) (-498.031) [-482.895] -- 0:03:06
527000 -- (-489.426) [-479.187] (-495.033) (-498.429) * (-490.410) (-494.383) (-496.035) [-481.796] -- 0:03:06
528000 -- (-489.647) [-480.014] (-493.864) (-499.416) * (-495.292) (-498.059) (-496.591) [-481.789] -- 0:03:05
529000 -- (-492.570) [-476.951] (-489.544) (-502.736) * (-488.990) (-498.709) (-497.728) [-481.311] -- 0:03:05
530000 -- (-492.434) [-476.627] (-493.454) (-494.812) * (-505.166) (-500.146) (-507.195) [-479.370] -- 0:03:05
Average standard deviation of split frequencies: 0.012690
531000 -- (-499.012) [-478.072] (-521.684) (-498.690) * (-498.977) (-483.368) (-500.170) [-474.278] -- 0:03:04
532000 -- (-492.194) [-481.301] (-494.879) (-498.660) * (-492.215) (-490.254) (-510.171) [-477.111] -- 0:03:04
533000 -- (-487.814) [-473.001] (-489.306) (-504.143) * (-493.761) (-502.205) (-509.602) [-477.573] -- 0:03:03
534000 -- (-492.430) [-470.602] (-500.367) (-496.008) * (-493.315) (-494.686) (-498.961) [-472.141] -- 0:03:03
535000 -- (-485.715) [-473.207] (-496.159) (-499.329) * (-499.597) (-491.206) (-499.838) [-471.495] -- 0:03:03
Average standard deviation of split frequencies: 0.011685
536000 -- (-484.805) [-475.541] (-493.363) (-493.051) * (-498.544) (-487.287) (-497.431) [-474.096] -- 0:03:02
537000 -- (-494.808) [-480.388] (-491.513) (-495.623) * (-489.040) (-489.634) (-488.623) [-475.022] -- 0:03:02
538000 -- (-489.485) [-482.670] (-493.826) (-496.854) * (-497.768) (-494.252) (-500.636) [-474.075] -- 0:03:02
539000 -- (-494.966) [-479.163] (-492.677) (-490.235) * (-493.414) (-493.254) (-490.394) [-473.601] -- 0:03:01
540000 -- (-503.182) [-473.593] (-495.158) (-508.431) * (-503.488) (-489.171) (-492.098) [-475.966] -- 0:03:01
Average standard deviation of split frequencies: 0.012580
541000 -- (-496.835) [-479.198] (-494.960) (-499.305) * (-490.711) (-491.572) (-492.389) [-472.066] -- 0:03:00
542000 -- (-495.894) [-479.217] (-499.022) (-493.117) * (-488.720) (-489.389) (-497.683) [-471.316] -- 0:03:00
543000 -- (-495.721) [-480.125] (-494.920) (-493.264) * (-500.423) (-494.199) (-496.440) [-474.786] -- 0:03:00
544000 -- (-489.699) [-474.449] (-494.631) (-501.724) * (-491.206) (-494.829) (-494.519) [-477.071] -- 0:02:59
545000 -- (-496.286) [-482.745] (-499.742) (-500.131) * (-497.091) (-497.633) (-504.177) [-472.870] -- 0:02:59
Average standard deviation of split frequencies: 0.011008
546000 -- (-491.638) [-477.679] (-495.152) (-499.972) * (-497.398) (-494.678) (-492.945) [-475.901] -- 0:02:58
547000 -- (-494.739) [-471.966] (-502.507) (-502.696) * (-494.559) (-491.235) (-488.380) [-470.181] -- 0:02:58
548000 -- (-507.101) [-472.749] (-499.855) (-486.167) * (-489.057) (-495.391) (-487.348) [-477.157] -- 0:02:58
549000 -- (-502.364) [-479.505] (-492.490) (-490.812) * (-489.427) (-503.017) (-503.957) [-481.777] -- 0:02:57
550000 -- (-499.789) [-480.814] (-503.491) (-492.175) * (-490.481) (-491.853) (-506.176) [-471.331] -- 0:02:57
Average standard deviation of split frequencies: 0.011985
551000 -- (-493.179) [-481.283] (-499.536) (-495.323) * (-497.866) (-495.253) (-497.641) [-482.199] -- 0:02:56
552000 -- (-488.875) [-470.830] (-506.150) (-493.192) * (-508.918) (-496.302) (-498.561) [-479.855] -- 0:02:56
553000 -- (-490.097) [-475.588] (-498.583) (-503.415) * (-493.878) (-491.352) (-497.029) [-476.349] -- 0:02:56
554000 -- (-501.963) [-479.764] (-498.758) (-498.034) * (-490.001) (-493.676) (-508.749) [-476.120] -- 0:02:55
555000 -- (-492.535) [-475.055] (-499.051) (-504.838) * (-487.935) (-498.394) (-502.215) [-473.634] -- 0:02:55
Average standard deviation of split frequencies: 0.011507
556000 -- (-490.380) [-481.345] (-498.824) (-500.359) * (-485.266) (-497.136) (-503.259) [-478.376] -- 0:02:54
557000 -- (-487.891) [-475.262] (-504.208) (-505.105) * (-484.319) (-488.784) (-507.110) [-477.315] -- 0:02:54
558000 -- (-488.316) [-472.163] (-499.728) (-495.048) * (-500.655) (-491.367) (-500.443) [-477.301] -- 0:02:54
559000 -- (-486.349) [-476.309] (-498.842) (-513.612) * (-500.282) (-494.531) (-495.538) [-480.946] -- 0:02:53
560000 -- (-482.371) [-473.120] (-492.402) (-506.827) * (-486.834) (-490.263) (-495.828) [-479.349] -- 0:02:53
Average standard deviation of split frequencies: 0.012492
561000 -- (-501.173) [-478.615] (-494.762) (-495.864) * (-489.316) (-489.119) (-502.791) [-475.493] -- 0:02:52
562000 -- (-489.611) [-477.039] (-500.166) (-496.285) * (-498.874) (-489.996) (-491.279) [-475.015] -- 0:02:52
563000 -- (-496.049) [-477.059] (-499.298) (-501.866) * (-493.466) (-491.787) (-492.787) [-473.037] -- 0:02:52
564000 -- (-492.385) [-472.356] (-494.043) (-491.266) * (-488.844) (-491.972) (-492.844) [-476.661] -- 0:02:51
565000 -- (-495.184) [-469.930] (-494.750) (-489.572) * (-486.824) (-499.245) (-496.219) [-473.787] -- 0:02:51
Average standard deviation of split frequencies: 0.011660
566000 -- (-490.672) [-476.934] (-493.782) (-499.076) * (-488.014) (-495.983) (-493.977) [-476.150] -- 0:02:50
567000 -- (-496.865) [-471.223] (-495.756) (-493.524) * (-483.124) (-508.005) (-496.297) [-473.186] -- 0:02:50
568000 -- (-487.793) [-472.274] (-499.495) (-486.046) * (-485.275) (-496.477) (-491.718) [-476.391] -- 0:02:50
569000 -- (-492.269) [-472.903] (-501.603) (-493.380) * (-488.740) (-489.326) (-495.522) [-475.817] -- 0:02:49
570000 -- (-496.324) [-476.992] (-503.423) (-495.732) * (-483.468) (-491.948) (-514.068) [-472.638] -- 0:02:49
Average standard deviation of split frequencies: 0.012081
571000 -- (-492.432) [-468.559] (-496.609) (-489.287) * (-483.350) (-496.413) (-496.851) [-471.898] -- 0:02:49
572000 -- (-492.225) [-478.350] (-500.268) (-485.199) * (-487.060) (-498.766) (-492.847) [-471.387] -- 0:02:48
573000 -- (-498.092) [-470.593] (-495.883) (-484.346) * (-484.944) (-486.225) (-493.406) [-477.940] -- 0:02:48
574000 -- (-492.202) [-472.643] (-499.648) (-490.170) * (-486.899) (-492.555) (-493.883) [-476.821] -- 0:02:47
575000 -- (-491.167) [-472.606] (-514.460) (-488.429) * (-487.833) (-486.165) (-493.589) [-475.340] -- 0:02:47
Average standard deviation of split frequencies: 0.011969
576000 -- (-489.293) [-471.675] (-503.380) (-488.334) * (-489.348) (-500.471) (-488.532) [-485.317] -- 0:02:47
577000 -- (-498.346) [-471.004] (-493.753) (-498.233) * (-486.040) (-497.444) (-497.842) [-473.539] -- 0:02:46
578000 -- (-485.563) [-474.196] (-493.641) (-499.551) * (-489.561) (-493.739) (-490.752) [-470.635] -- 0:02:46
579000 -- (-493.091) [-483.031] (-504.642) (-498.736) * (-493.661) (-486.553) (-490.630) [-477.279] -- 0:02:45
580000 -- (-484.267) [-478.982] (-500.974) (-489.046) * (-490.660) (-487.910) (-503.787) [-474.577] -- 0:02:45
Average standard deviation of split frequencies: 0.012482
581000 -- (-492.111) [-473.659] (-499.410) (-491.562) * (-487.633) (-491.625) (-494.142) [-474.550] -- 0:02:45
582000 -- (-496.553) [-479.071] (-509.530) (-495.131) * (-493.425) (-490.798) (-496.174) [-481.633] -- 0:02:44
583000 -- (-488.148) [-478.622] (-502.778) (-490.046) * (-492.524) (-499.527) (-497.575) [-470.118] -- 0:02:44
584000 -- (-492.247) [-475.387] (-493.508) (-493.593) * (-504.667) (-491.059) (-496.785) [-473.675] -- 0:02:43
585000 -- (-487.003) [-475.915] (-497.282) (-489.504) * (-510.908) (-497.001) (-492.937) [-478.128] -- 0:02:43
Average standard deviation of split frequencies: 0.013676
586000 -- (-491.132) [-478.866] (-489.499) (-490.791) * (-489.326) (-488.168) (-495.422) [-476.438] -- 0:02:43
587000 -- (-496.384) [-481.120] (-494.350) (-493.876) * (-488.441) (-488.244) (-492.492) [-477.322] -- 0:02:42
588000 -- (-488.846) [-475.881] (-488.921) (-490.070) * (-488.316) (-490.498) (-494.615) [-473.530] -- 0:02:42
589000 -- (-490.032) [-475.424] (-495.512) (-511.312) * (-483.590) (-485.208) (-492.772) [-475.439] -- 0:02:41
590000 -- (-490.897) [-480.289] (-499.292) (-498.881) * (-485.093) (-488.594) (-503.726) [-477.689] -- 0:02:41
Average standard deviation of split frequencies: 0.013967
591000 -- (-495.407) [-472.643] (-488.287) (-504.035) * (-489.658) (-494.960) (-504.706) [-473.647] -- 0:02:41
592000 -- (-493.480) [-474.577] (-488.797) (-498.464) * (-492.913) (-490.783) (-497.768) [-471.205] -- 0:02:40
593000 -- (-487.781) [-467.408] (-499.948) (-486.693) * (-498.306) (-484.474) (-497.779) [-470.602] -- 0:02:40
594000 -- (-483.443) [-471.428] (-512.603) (-482.932) * (-502.218) (-486.022) (-494.645) [-471.149] -- 0:02:39
595000 -- (-486.679) [-475.877] (-510.142) (-492.114) * (-489.887) (-500.239) (-495.994) [-474.757] -- 0:02:39
Average standard deviation of split frequencies: 0.014463
596000 -- (-491.699) [-486.027] (-496.740) (-495.339) * (-484.026) (-486.352) (-494.010) [-472.182] -- 0:02:39
597000 -- (-488.540) [-475.181] (-505.792) (-506.787) * (-485.556) (-490.063) (-493.173) [-472.872] -- 0:02:38
598000 -- (-504.353) [-477.219] (-504.237) (-492.501) * (-489.490) (-495.221) (-503.462) [-473.894] -- 0:02:38
599000 -- (-488.180) [-471.659] (-493.537) (-484.157) * (-487.525) (-494.904) (-490.399) [-480.144] -- 0:02:37
600000 -- (-505.451) [-468.960] (-503.203) (-498.947) * (-490.664) (-484.400) (-490.660) [-476.098] -- 0:02:37
Average standard deviation of split frequencies: 0.014351
601000 -- (-493.331) [-470.185] (-490.752) (-489.260) * (-492.606) (-487.099) (-491.823) [-473.574] -- 0:02:37
602000 -- (-497.239) [-473.953] (-486.495) (-489.964) * (-496.684) (-495.951) (-488.034) [-470.436] -- 0:02:36
603000 -- (-498.649) [-473.627] (-494.474) (-497.690) * (-494.989) (-494.045) (-490.213) [-475.823] -- 0:02:36
604000 -- (-491.176) [-473.729] (-502.744) (-489.193) * (-479.793) (-501.713) (-489.724) [-478.103] -- 0:02:36
605000 -- (-498.206) [-479.568] (-496.888) (-492.214) * (-494.213) (-499.130) (-498.877) [-476.506] -- 0:02:35
Average standard deviation of split frequencies: 0.014113
606000 -- (-500.458) [-477.032] (-496.703) (-487.732) * (-490.564) (-490.415) (-497.485) [-479.245] -- 0:02:35
607000 -- (-492.226) [-474.127] (-495.282) (-495.503) * (-489.294) (-498.762) (-499.616) [-471.380] -- 0:02:34
608000 -- (-489.487) [-475.706] (-495.424) (-496.252) * (-491.431) (-499.013) (-505.384) [-480.098] -- 0:02:34
609000 -- (-497.868) [-475.742] (-489.956) (-493.165) * (-494.156) (-491.068) (-489.404) [-471.556] -- 0:02:34
610000 -- (-491.626) [-474.137] (-499.262) (-492.420) * (-491.488) (-491.948) (-492.166) [-474.043] -- 0:02:33
Average standard deviation of split frequencies: 0.014336
611000 -- (-485.678) [-479.499] (-494.833) (-499.745) * (-490.396) (-491.230) (-494.406) [-474.412] -- 0:02:33
612000 -- (-485.338) [-476.958] (-496.974) (-494.331) * (-491.317) (-491.447) (-499.080) [-471.234] -- 0:02:32
613000 -- (-488.658) [-472.906] (-498.853) (-492.931) * (-492.131) (-495.456) (-497.395) [-485.590] -- 0:02:32
614000 -- (-486.455) [-477.547] (-488.767) (-490.975) * (-491.372) (-495.330) (-492.759) [-475.389] -- 0:02:32
615000 -- (-484.369) [-469.417] (-495.090) (-506.168) * (-496.537) (-502.722) (-494.092) [-478.853] -- 0:02:31
Average standard deviation of split frequencies: 0.015305
616000 -- (-486.569) [-475.039] (-494.446) (-509.507) * (-491.431) (-494.017) (-498.991) [-469.657] -- 0:02:31
617000 -- (-491.910) [-471.049] (-500.716) (-500.554) * (-487.951) (-487.684) (-498.456) [-474.359] -- 0:02:30
618000 -- (-494.124) [-472.866] (-503.482) (-496.211) * (-490.366) (-489.015) (-493.894) [-477.182] -- 0:02:30
619000 -- (-494.676) [-468.725] (-506.309) (-500.062) * (-490.829) (-498.319) (-495.163) [-472.908] -- 0:02:30
620000 -- (-489.453) [-473.126] (-509.524) (-500.917) * (-496.173) (-497.495) (-492.263) [-477.999] -- 0:02:29
Average standard deviation of split frequencies: 0.014526
621000 -- (-490.148) [-477.238] (-502.986) (-492.735) * (-488.877) (-499.264) (-493.606) [-472.811] -- 0:02:29
622000 -- (-500.753) [-471.435] (-495.574) (-491.944) * (-495.291) (-500.759) (-493.689) [-476.818] -- 0:02:28
623000 -- (-504.817) [-471.031] (-495.860) (-498.284) * (-487.484) (-503.756) (-499.515) [-469.202] -- 0:02:28
624000 -- (-493.804) [-475.973] (-494.001) (-496.401) * (-485.018) (-491.263) (-506.170) [-480.689] -- 0:02:28
625000 -- (-490.246) [-474.198] (-491.317) (-499.471) * (-499.376) (-493.349) (-498.241) [-477.063] -- 0:02:27
Average standard deviation of split frequencies: 0.014214
626000 -- (-496.955) [-477.833] (-495.234) (-490.871) * (-491.671) (-497.584) (-498.610) [-479.142] -- 0:02:27
627000 -- (-491.692) [-473.782] (-500.385) (-496.608) * (-492.715) (-490.850) (-501.479) [-473.495] -- 0:02:26
628000 -- (-481.150) [-474.366] (-490.230) (-499.019) * (-497.732) (-483.521) (-499.349) [-472.763] -- 0:02:26
629000 -- (-501.984) [-469.008] (-502.374) (-507.012) * (-491.554) (-489.943) (-497.035) [-478.871] -- 0:02:26
630000 -- (-499.881) [-475.825] (-500.135) (-494.368) * (-487.927) (-494.419) (-493.828) [-473.642] -- 0:02:25
Average standard deviation of split frequencies: 0.013174
631000 -- (-492.336) [-480.007] (-496.019) (-497.972) * (-488.757) (-494.861) (-502.490) [-473.670] -- 0:02:25
632000 -- (-493.367) [-473.242] (-501.717) (-496.486) * (-485.447) (-499.380) (-499.764) [-470.698] -- 0:02:24
633000 -- (-492.400) [-471.588] (-493.884) (-491.529) * (-486.009) (-500.170) (-493.936) [-470.303] -- 0:02:24
634000 -- (-485.147) [-471.477] (-497.233) (-498.806) * (-483.040) (-503.676) (-493.349) [-476.992] -- 0:02:24
635000 -- (-487.204) [-474.101] (-498.692) (-483.770) * (-490.100) (-501.182) (-498.875) [-474.689] -- 0:02:23
Average standard deviation of split frequencies: 0.014612
636000 -- (-488.263) [-472.467] (-505.108) (-487.301) * (-487.586) (-501.652) (-499.240) [-468.411] -- 0:02:23
637000 -- (-495.645) [-479.447] (-506.607) (-495.414) * (-490.079) (-508.089) (-499.600) [-470.002] -- 0:02:23
638000 -- (-482.726) [-479.672] (-504.607) (-488.215) * (-488.749) (-498.973) (-494.985) [-474.311] -- 0:02:22
639000 -- (-494.691) [-473.217] (-499.464) (-488.010) * (-495.541) (-490.624) (-499.015) [-476.788] -- 0:02:22
640000 -- (-494.268) [-475.625] (-514.194) (-494.897) * (-489.525) (-493.282) (-491.145) [-476.018] -- 0:02:21
Average standard deviation of split frequencies: 0.013665
641000 -- (-495.373) [-470.756] (-515.466) (-492.867) * (-485.893) (-503.432) (-486.005) [-480.055] -- 0:02:21
642000 -- (-490.401) [-476.305] (-511.391) (-488.449) * (-486.711) (-503.625) (-497.697) [-471.579] -- 0:02:21
643000 -- (-494.540) [-472.568] (-513.599) (-484.737) * (-493.262) (-497.936) (-504.222) [-477.611] -- 0:02:20
644000 -- (-489.557) [-476.277] (-501.544) (-489.408) * (-493.941) (-503.125) (-500.072) [-473.992] -- 0:02:20
645000 -- (-495.649) [-473.015] (-506.355) (-485.331) * (-485.083) (-497.891) (-498.510) [-476.481] -- 0:02:19
Average standard deviation of split frequencies: 0.012478
646000 -- (-492.032) [-478.965] (-503.323) (-490.376) * (-492.110) (-490.961) (-502.353) [-479.206] -- 0:02:19
647000 -- (-487.452) [-482.852] (-504.083) (-493.728) * (-489.131) (-493.233) (-494.215) [-473.800] -- 0:02:19
648000 -- (-487.170) [-473.899] (-497.286) (-490.536) * (-492.174) (-502.634) (-496.550) [-467.441] -- 0:02:18
649000 -- (-501.431) [-475.480] (-497.954) (-491.986) * (-492.611) (-489.615) (-490.777) [-469.208] -- 0:02:18
650000 -- (-494.914) [-480.922] (-496.292) (-492.046) * (-488.377) (-489.455) (-499.377) [-478.308] -- 0:02:17
Average standard deviation of split frequencies: 0.012389
651000 -- (-492.007) [-475.947] (-503.041) (-484.284) * (-497.116) (-494.708) (-498.112) [-474.569] -- 0:02:17
652000 -- (-489.855) [-472.331] (-505.371) (-486.715) * (-497.565) (-487.927) (-510.655) [-473.877] -- 0:02:17
653000 -- (-492.083) [-473.597] (-500.485) (-492.174) * (-486.859) (-495.020) (-497.703) [-477.675] -- 0:02:16
654000 -- (-494.570) [-473.838] (-498.373) (-484.827) * (-487.523) (-490.220) (-496.135) [-475.751] -- 0:02:16
655000 -- (-504.374) [-474.910] (-502.162) (-493.400) * (-483.290) (-482.227) (-496.993) [-476.367] -- 0:02:15
Average standard deviation of split frequencies: 0.013414
656000 -- (-499.791) [-475.077] (-492.126) (-491.449) * (-491.476) (-496.155) (-502.484) [-476.526] -- 0:02:15
657000 -- (-493.113) [-473.869] (-499.088) (-499.878) * (-491.894) (-504.388) (-499.607) [-484.840] -- 0:02:15
658000 -- (-490.995) [-481.751] (-491.732) (-503.300) * (-503.561) (-493.191) (-497.347) [-469.973] -- 0:02:14
659000 -- (-495.143) [-474.889] (-495.045) (-495.572) * (-496.819) (-491.538) (-494.414) [-471.754] -- 0:02:14
660000 -- (-496.411) [-479.173] (-494.800) (-488.883) * (-498.872) (-486.544) (-489.186) [-469.500] -- 0:02:13
Average standard deviation of split frequencies: 0.011773
661000 -- (-493.157) [-479.484] (-500.442) (-491.452) * (-488.915) (-499.186) (-491.232) [-471.095] -- 0:02:13
662000 -- (-498.951) [-484.441] (-497.850) (-487.383) * (-499.643) (-493.551) (-489.489) [-482.559] -- 0:02:13
663000 -- (-501.592) [-471.584] (-498.542) (-489.326) * (-489.000) (-493.834) (-492.109) [-477.349] -- 0:02:12
664000 -- (-494.159) [-477.098] (-494.675) (-486.261) * (-495.685) (-489.908) (-491.620) [-475.816] -- 0:02:12
665000 -- (-502.358) [-477.871] (-500.955) (-487.246) * (-491.642) (-493.861) (-493.489) [-471.272] -- 0:02:11
Average standard deviation of split frequencies: 0.012583
666000 -- (-496.752) [-479.195] (-503.157) (-491.021) * (-494.674) (-491.279) (-495.056) [-473.192] -- 0:02:11
667000 -- (-499.450) [-479.693] (-502.507) (-488.544) * (-497.441) (-487.011) (-503.889) [-472.063] -- 0:02:11
668000 -- (-503.593) [-473.546] (-496.633) (-496.695) * (-490.724) (-492.360) (-490.094) [-474.340] -- 0:02:10
669000 -- (-491.540) [-470.666] (-494.512) (-486.903) * (-490.148) (-498.448) (-503.508) [-472.054] -- 0:02:10
670000 -- (-500.423) [-474.408] (-502.219) (-489.679) * (-481.937) (-497.412) (-497.394) [-472.930] -- 0:02:10
Average standard deviation of split frequencies: 0.012213
671000 -- (-493.748) [-469.806] (-508.677) (-499.867) * (-483.527) (-493.175) (-498.590) [-475.196] -- 0:02:09
672000 -- (-496.387) [-472.110] (-491.356) (-493.379) * (-488.581) (-491.238) (-500.133) [-471.158] -- 0:02:09
673000 -- (-492.126) [-478.221] (-498.547) (-491.707) * (-485.086) (-490.480) (-506.092) [-474.249] -- 0:02:08
674000 -- (-489.947) [-480.234] (-499.835) (-488.685) * (-503.315) (-491.660) (-507.061) [-476.051] -- 0:02:08
675000 -- (-494.781) [-474.461] (-502.446) (-493.599) * (-483.620) (-486.870) (-491.460) [-472.250] -- 0:02:08
Average standard deviation of split frequencies: 0.012242
676000 -- (-494.338) [-471.994] (-494.915) (-483.303) * (-487.623) (-492.357) (-494.893) [-473.200] -- 0:02:07
677000 -- (-500.800) [-475.832] (-492.496) (-493.252) * (-495.246) (-505.980) (-493.958) [-475.870] -- 0:02:07
678000 -- (-505.464) [-473.269] (-494.159) (-492.400) * (-490.020) (-491.100) (-488.556) [-480.103] -- 0:02:06
679000 -- (-499.905) [-477.347] (-488.838) (-507.170) * (-492.905) (-496.918) (-499.169) [-470.761] -- 0:02:06
680000 -- (-496.900) [-477.370] (-494.191) (-488.864) * (-483.901) (-496.058) (-499.727) [-472.490] -- 0:02:06
Average standard deviation of split frequencies: 0.012033
681000 -- (-510.992) [-478.804] (-495.832) (-486.278) * (-494.202) (-493.708) (-494.402) [-474.586] -- 0:02:05
682000 -- (-514.925) [-470.675] (-497.557) (-497.141) * (-498.274) (-505.155) (-502.371) [-472.521] -- 0:02:05
683000 -- (-500.550) [-472.559] (-497.985) (-496.265) * (-494.177) (-500.217) (-494.972) [-471.876] -- 0:02:04
684000 -- (-497.962) [-476.463] (-500.608) (-491.100) * (-496.442) (-493.341) (-493.516) [-472.563] -- 0:02:04
685000 -- (-498.711) [-476.266] (-499.100) (-491.297) * (-492.889) (-490.788) (-492.857) [-474.639] -- 0:02:04
Average standard deviation of split frequencies: 0.012675
686000 -- (-511.242) [-474.024] (-502.804) (-488.340) * (-497.265) (-498.176) (-495.736) [-472.794] -- 0:02:03
687000 -- (-504.949) [-481.566] (-506.529) (-489.152) * (-492.571) (-494.566) (-507.309) [-474.424] -- 0:02:03
688000 -- (-497.925) [-474.464] (-515.782) (-488.743) * (-494.873) (-494.603) (-504.415) [-470.483] -- 0:02:02
689000 -- (-495.648) [-473.170] (-501.846) (-494.316) * (-495.243) (-490.450) (-507.736) [-472.962] -- 0:02:02
690000 -- (-491.459) [-478.793] (-509.042) (-487.095) * (-507.881) (-492.980) (-490.705) [-473.333] -- 0:02:02
Average standard deviation of split frequencies: 0.012361
691000 -- (-492.534) [-479.140] (-504.080) (-493.584) * (-488.690) (-492.320) (-489.654) [-478.111] -- 0:02:01
692000 -- (-493.272) [-476.475] (-511.002) (-495.738) * (-494.615) (-493.770) (-500.139) [-474.158] -- 0:02:01
693000 -- (-494.759) [-473.343] (-512.191) (-494.846) * (-496.095) (-506.014) (-501.817) [-476.307] -- 0:02:00
694000 -- (-493.254) [-474.518] (-500.574) (-493.990) * (-490.834) (-499.683) (-493.513) [-479.387] -- 0:02:00
695000 -- (-490.404) [-473.501] (-497.942) (-497.785) * (-488.051) (-497.827) (-495.421) [-477.711] -- 0:02:00
Average standard deviation of split frequencies: 0.012191
696000 -- (-491.469) [-475.932] (-503.644) (-496.643) * (-483.371) (-495.847) (-504.032) [-479.333] -- 0:01:59
697000 -- (-501.123) [-474.400] (-501.454) (-507.138) * (-483.062) (-495.958) (-502.567) [-484.448] -- 0:01:59
698000 -- (-501.679) [-475.044] (-497.124) (-506.872) * (-491.065) (-492.289) (-495.226) [-483.128] -- 0:01:58
699000 -- (-492.547) [-485.038] (-493.922) (-492.702) * (-486.015) (-487.682) (-496.135) [-483.243] -- 0:01:58
700000 -- (-491.706) [-475.706] (-495.066) (-499.410) * (-485.363) (-488.276) (-497.098) [-485.649] -- 0:01:58
Average standard deviation of split frequencies: 0.013523
701000 -- (-488.476) [-483.755] (-500.823) (-496.999) * (-486.980) (-487.354) (-508.926) [-484.322] -- 0:01:57
702000 -- (-486.724) [-479.618] (-492.929) (-496.111) * (-492.293) (-493.450) (-507.347) [-479.900] -- 0:01:57
703000 -- (-491.861) [-474.734] (-494.885) (-512.694) * (-488.044) (-514.378) (-505.848) [-473.739] -- 0:01:57
704000 -- (-492.490) [-472.136] (-500.760) (-501.076) * (-490.719) (-494.847) (-498.184) [-470.827] -- 0:01:56
705000 -- (-496.756) [-475.326] (-490.448) (-492.817) * (-501.934) (-500.199) (-495.516) [-474.028] -- 0:01:55
Average standard deviation of split frequencies: 0.013415
706000 -- (-497.897) [-474.201] (-495.777) (-489.342) * (-491.526) (-495.925) (-499.804) [-475.985] -- 0:01:55
707000 -- (-490.107) [-471.695] (-490.064) (-487.961) * (-488.346) (-492.855) (-494.705) [-475.927] -- 0:01:55
708000 -- (-495.658) [-474.135] (-489.466) (-490.000) * (-496.555) (-496.889) (-503.927) [-476.638] -- 0:01:55
709000 -- (-496.865) [-470.761] (-494.171) (-495.633) * (-490.910) (-507.576) (-500.701) [-471.617] -- 0:01:54
710000 -- (-486.467) [-471.824] (-490.358) (-502.116) * (-495.269) (-492.578) (-501.780) [-474.721] -- 0:01:53
Average standard deviation of split frequencies: 0.012677
711000 -- (-494.946) [-473.527] (-491.642) (-492.133) * (-496.845) (-487.438) (-501.024) [-476.381] -- 0:01:53
712000 -- (-487.243) [-470.570] (-493.910) (-495.684) * (-496.188) (-497.395) (-504.972) [-477.269] -- 0:01:53
713000 -- (-497.974) [-474.826] (-495.631) (-501.409) * (-487.926) (-493.119) (-507.493) [-474.081] -- 0:01:53
714000 -- (-488.824) [-472.702] (-509.392) (-485.873) * (-486.926) (-491.265) (-500.037) [-478.015] -- 0:01:52
715000 -- (-493.662) [-473.893] (-515.592) (-497.030) * (-492.103) (-500.393) (-502.641) [-477.853] -- 0:01:52
Average standard deviation of split frequencies: 0.012656
716000 -- (-499.906) [-480.214] (-517.245) (-493.683) * (-482.952) (-499.144) (-504.316) [-475.674] -- 0:01:51
717000 -- (-490.932) [-473.461] (-504.246) (-502.346) * (-492.366) (-500.324) (-501.165) [-473.348] -- 0:01:51
718000 -- (-493.770) [-479.097] (-499.424) (-499.965) * (-488.351) (-497.734) (-505.833) [-475.311] -- 0:01:51
719000 -- (-496.829) [-480.164] (-502.909) (-493.265) * (-489.499) (-487.775) (-502.656) [-472.049] -- 0:01:50
720000 -- (-510.076) [-476.904] (-498.694) (-497.010) * (-489.417) (-489.729) (-497.552) [-471.070] -- 0:01:50
Average standard deviation of split frequencies: 0.013246
721000 -- (-497.916) [-471.504] (-500.224) (-493.439) * (-504.646) (-491.798) (-501.646) [-474.836] -- 0:01:49
722000 -- (-500.464) [-477.646] (-502.302) (-491.354) * (-485.472) (-493.505) (-500.068) [-473.719] -- 0:01:49
723000 -- (-508.899) [-480.596] (-504.548) (-484.642) * (-487.759) (-498.248) (-498.185) [-483.107] -- 0:01:48
724000 -- (-512.532) [-469.314] (-503.426) (-492.012) * (-486.947) (-500.044) (-503.553) [-474.502] -- 0:01:48
725000 -- (-492.772) [-476.775] (-505.696) (-491.320) * (-486.359) (-494.284) (-496.514) [-475.790] -- 0:01:48
Average standard deviation of split frequencies: 0.012662
726000 -- (-491.235) [-472.908] (-512.182) (-487.207) * (-495.184) (-491.199) (-498.559) [-475.363] -- 0:01:47
727000 -- (-496.294) [-477.615] (-506.544) (-485.102) * (-487.056) (-506.631) (-496.453) [-475.241] -- 0:01:47
728000 -- (-490.368) [-481.669] (-491.061) (-489.309) * (-484.480) (-488.763) (-500.365) [-468.923] -- 0:01:46
729000 -- (-491.295) [-473.442] (-503.567) (-491.246) * (-489.935) (-485.950) (-503.685) [-476.012] -- 0:01:46
730000 -- (-499.286) [-471.731] (-494.282) (-489.802) * (-489.205) (-490.545) (-504.336) [-472.738] -- 0:01:46
Average standard deviation of split frequencies: 0.012839
731000 -- (-495.278) [-473.184] (-510.925) (-488.410) * (-495.465) (-503.024) (-491.634) [-474.990] -- 0:01:45
732000 -- (-492.158) [-475.399] (-512.434) (-491.569) * (-499.479) (-496.491) (-496.023) [-474.727] -- 0:01:45
733000 -- (-499.923) [-478.080] (-511.213) (-496.982) * (-496.628) (-495.788) (-499.397) [-473.120] -- 0:01:44
734000 -- (-504.223) [-475.101] (-496.391) (-489.509) * (-492.104) (-492.159) (-497.204) [-473.170] -- 0:01:44
735000 -- (-498.073) [-473.853] (-510.596) (-485.196) * (-488.704) (-491.766) (-503.140) [-481.568] -- 0:01:44
Average standard deviation of split frequencies: 0.012868
736000 -- (-489.545) [-477.369] (-502.131) (-492.627) * (-483.059) (-498.883) (-495.175) [-471.601] -- 0:01:43
737000 -- (-490.351) [-474.324] (-505.703) (-493.082) * (-486.650) (-490.881) (-494.962) [-476.990] -- 0:01:43
738000 -- (-489.920) [-477.430] (-506.634) (-493.734) * (-485.857) (-490.836) (-500.964) [-469.331] -- 0:01:42
739000 -- (-497.730) [-478.323] (-504.510) (-491.917) * (-487.545) (-488.824) (-518.706) [-473.845] -- 0:01:42
740000 -- (-501.291) [-472.520] (-505.236) (-493.983) * (-495.952) (-489.992) (-513.510) [-474.792] -- 0:01:42
Average standard deviation of split frequencies: 0.013302
741000 -- (-498.356) [-472.423] (-493.309) (-489.684) * (-491.466) (-490.416) (-497.876) [-473.950] -- 0:01:41
742000 -- (-498.340) [-472.917] (-485.763) (-491.676) * (-487.518) (-491.532) (-495.195) [-472.284] -- 0:01:41
743000 -- (-502.050) [-470.709] (-497.233) (-491.130) * (-487.454) (-495.556) (-499.354) [-474.511] -- 0:01:41
744000 -- (-493.646) [-480.638] (-499.210) (-494.493) * (-486.189) (-494.131) (-506.451) [-472.868] -- 0:01:40
745000 -- (-499.924) [-475.708] (-499.611) (-496.039) * (-495.937) (-499.548) (-497.657) [-472.926] -- 0:01:40
Average standard deviation of split frequencies: 0.013207
746000 -- (-502.453) [-474.541] (-489.243) (-494.363) * (-496.263) (-512.132) (-502.018) [-472.986] -- 0:01:39
747000 -- (-493.130) [-479.878] (-503.988) (-503.746) * (-501.630) (-508.372) (-498.826) [-472.485] -- 0:01:39
748000 -- (-488.825) [-472.354] (-500.081) (-500.879) * (-510.379) (-507.137) (-514.056) [-477.048] -- 0:01:39
749000 -- (-496.615) [-474.165] (-505.338) (-495.171) * (-507.463) (-492.819) (-495.195) [-477.931] -- 0:01:38
750000 -- (-488.404) [-474.548] (-503.568) (-495.381) * (-494.548) (-503.307) (-499.032) [-475.310] -- 0:01:38
Average standard deviation of split frequencies: 0.012936
751000 -- (-503.619) [-472.458] (-499.458) (-493.853) * (-493.110) (-507.784) (-493.595) [-477.907] -- 0:01:37
752000 -- (-499.208) [-474.550] (-498.364) (-495.535) * (-497.354) (-506.529) (-499.607) [-484.112] -- 0:01:37
753000 -- (-497.314) [-473.269] (-494.340) (-497.977) * (-494.768) (-495.337) (-492.235) [-474.843] -- 0:01:37
754000 -- (-496.097) [-472.354] (-491.341) (-503.271) * (-504.153) (-498.599) (-488.297) [-473.502] -- 0:01:36
755000 -- (-495.654) [-473.231] (-492.050) (-498.481) * (-482.682) (-500.082) (-496.831) [-477.886] -- 0:01:36
Average standard deviation of split frequencies: 0.012698
756000 -- (-491.250) [-473.514] (-497.107) (-492.028) * (-481.036) (-504.140) (-498.467) [-478.432] -- 0:01:35
757000 -- (-489.358) [-470.788] (-489.020) (-486.417) * (-492.270) (-496.691) (-492.559) [-479.473] -- 0:01:35
758000 -- (-487.639) [-475.538] (-490.859) (-495.131) * (-495.890) (-502.846) (-493.384) [-472.687] -- 0:01:35
759000 -- (-488.330) [-473.117] (-493.001) (-497.514) * (-490.862) (-490.749) (-490.269) [-473.821] -- 0:01:34
760000 -- (-489.608) [-474.107] (-488.740) (-500.089) * (-486.950) (-501.495) (-495.435) [-474.565] -- 0:01:34
Average standard deviation of split frequencies: 0.013076
761000 -- (-490.736) [-480.354] (-496.002) (-495.982) * (-492.488) (-509.126) (-486.897) [-479.002] -- 0:01:33
762000 -- (-494.020) [-477.957] (-489.038) (-487.504) * (-488.078) (-497.965) (-492.456) [-477.021] -- 0:01:33
763000 -- (-498.661) [-476.043] (-495.010) (-494.134) * (-488.073) (-503.820) (-489.191) [-468.766] -- 0:01:33
764000 -- (-519.283) [-476.175] (-501.669) (-491.447) * (-487.407) (-491.592) (-495.506) [-472.318] -- 0:01:32
765000 -- (-510.625) [-481.590] (-494.865) (-491.528) * (-486.167) (-495.569) (-488.741) [-475.855] -- 0:01:32
Average standard deviation of split frequencies: 0.012616
766000 -- (-504.745) [-474.120] (-495.118) (-490.454) * (-487.422) (-494.334) (-492.018) [-472.436] -- 0:01:31
767000 -- (-498.408) [-475.435] (-495.413) (-493.781) * (-482.765) (-496.423) (-488.288) [-475.938] -- 0:01:31
768000 -- (-492.249) [-476.467] (-486.467) (-496.973) * (-486.687) (-494.628) (-498.771) [-471.163] -- 0:01:31
769000 -- (-497.898) [-478.686] (-496.530) (-495.650) * (-480.113) (-500.994) (-501.604) [-473.180] -- 0:01:31
770000 -- (-513.169) [-469.590] (-494.319) (-495.485) * (-491.905) (-492.418) (-503.831) [-475.212] -- 0:01:30
Average standard deviation of split frequencies: 0.012456
771000 -- (-497.641) [-474.157] (-498.103) (-493.905) * (-497.094) (-495.422) (-497.822) [-480.526] -- 0:01:29
772000 -- (-494.216) [-479.004] (-489.679) (-489.671) * (-487.657) (-497.246) (-500.239) [-481.446] -- 0:01:29
773000 -- (-487.091) [-477.088] (-489.924) (-505.494) * (-490.638) (-499.057) (-490.795) [-471.375] -- 0:01:29
774000 -- (-495.927) [-476.744] (-495.369) (-498.953) * (-492.531) (-496.443) (-497.589) [-474.070] -- 0:01:29
775000 -- (-492.712) [-474.282] (-493.594) (-496.468) * (-489.407) (-493.549) (-488.201) [-470.551] -- 0:01:28
Average standard deviation of split frequencies: 0.012315
776000 -- (-495.577) [-475.571] (-506.839) (-498.255) * (-484.434) (-490.250) (-496.183) [-476.871] -- 0:01:28
777000 -- (-487.557) [-478.458] (-500.741) (-494.404) * (-489.407) (-495.918) (-491.059) [-475.303] -- 0:01:27
778000 -- (-499.797) [-480.255] (-493.685) (-491.652) * (-491.414) (-499.553) (-490.168) [-479.683] -- 0:01:27
779000 -- (-506.319) [-468.504] (-496.267) (-488.895) * (-481.511) (-503.769) (-494.173) [-473.286] -- 0:01:26
780000 -- (-497.443) [-470.710] (-498.567) (-488.809) * (-485.924) (-508.742) (-497.755) [-474.904] -- 0:01:26
Average standard deviation of split frequencies: 0.012614
781000 -- (-492.148) [-469.408] (-504.601) (-493.610) * (-485.792) (-501.256) (-500.805) [-475.908] -- 0:01:26
782000 -- (-497.977) [-473.988] (-504.933) (-498.309) * (-497.308) (-495.155) (-500.766) [-477.988] -- 0:01:25
783000 -- (-498.014) [-476.677] (-502.272) (-494.455) * (-506.210) (-499.255) (-489.719) [-476.607] -- 0:01:25
784000 -- (-490.918) [-476.655] (-510.787) (-492.379) * (-488.323) (-510.945) (-484.682) [-472.290] -- 0:01:24
785000 -- (-493.610) [-475.118] (-515.056) (-491.834) * (-491.623) (-505.845) (-488.280) [-474.658] -- 0:01:24
Average standard deviation of split frequencies: 0.012661
786000 -- (-500.423) [-477.337] (-496.291) (-490.230) * (-486.792) (-515.362) (-491.373) [-477.118] -- 0:01:24
787000 -- (-490.861) [-471.530] (-495.748) (-505.739) * (-488.006) (-494.287) (-511.572) [-472.940] -- 0:01:23
788000 -- (-491.996) [-476.082] (-497.272) (-495.407) * (-484.556) (-496.813) (-496.334) [-472.042] -- 0:01:23
789000 -- (-492.427) [-473.572] (-502.052) (-490.037) * (-491.479) (-497.856) (-493.249) [-474.832] -- 0:01:22
790000 -- (-489.030) [-479.372] (-498.817) (-498.026) * (-488.107) (-497.458) (-488.529) [-475.198] -- 0:01:22
Average standard deviation of split frequencies: 0.012918
791000 -- (-494.744) [-466.839] (-497.779) (-498.051) * (-498.710) (-507.540) (-491.988) [-472.955] -- 0:01:22
792000 -- (-498.305) [-475.335] (-494.128) (-490.867) * (-500.213) (-510.112) (-489.883) [-472.350] -- 0:01:21
793000 -- (-492.103) [-478.906] (-504.311) (-497.475) * (-495.995) (-506.421) (-492.146) [-475.479] -- 0:01:21
794000 -- (-489.009) [-469.809] (-495.763) (-500.010) * (-486.809) (-499.363) (-491.096) [-472.651] -- 0:01:20
795000 -- (-497.412) [-473.139] (-508.340) (-505.568) * (-483.617) (-494.826) (-496.663) [-471.307] -- 0:01:20
Average standard deviation of split frequencies: 0.012568
796000 -- (-497.955) [-472.314] (-504.563) (-507.117) * (-485.629) (-506.687) (-509.696) [-473.393] -- 0:01:20
797000 -- (-498.403) [-471.568] (-495.620) (-499.933) * (-496.492) (-493.470) (-507.866) [-480.257] -- 0:01:19
798000 -- (-491.601) [-472.386] (-497.927) (-487.991) * (-494.312) (-491.711) (-504.570) [-477.158] -- 0:01:19
799000 -- (-494.566) [-475.972] (-509.965) (-499.126) * (-484.406) (-486.836) (-491.677) [-478.360] -- 0:01:18
800000 -- (-491.159) [-477.451] (-508.301) (-497.874) * (-490.724) (-498.774) (-501.485) [-475.575] -- 0:01:18
Average standard deviation of split frequencies: 0.013174
801000 -- (-488.830) [-480.063] (-499.998) (-492.982) * (-488.130) (-496.910) (-505.902) [-474.403] -- 0:01:18
802000 -- (-486.881) [-473.451] (-493.564) (-492.492) * (-494.143) (-498.232) (-502.482) [-476.661] -- 0:01:18
803000 -- (-496.229) [-475.364] (-498.760) (-491.653) * (-495.195) (-506.615) (-505.258) [-474.735] -- 0:01:17
804000 -- (-498.768) [-479.521] (-491.876) (-490.601) * (-491.087) (-498.577) (-507.537) [-470.805] -- 0:01:17
805000 -- (-493.592) [-477.771] (-493.223) (-492.169) * (-489.378) (-504.673) (-497.681) [-474.544] -- 0:01:16
Average standard deviation of split frequencies: 0.013517
806000 -- (-486.798) [-471.869] (-493.969) (-493.460) * (-485.534) (-496.309) (-489.583) [-476.812] -- 0:01:16
807000 -- (-496.193) [-475.578] (-489.797) (-490.827) * (-484.659) (-493.663) (-492.202) [-472.608] -- 0:01:16
808000 -- (-485.385) [-478.218] (-493.700) (-494.495) * (-487.380) (-499.375) (-497.903) [-471.922] -- 0:01:15
809000 -- (-489.453) [-475.347] (-491.815) (-491.900) * (-490.274) (-493.153) (-495.717) [-475.511] -- 0:01:15
810000 -- (-493.898) [-480.106] (-488.633) (-497.377) * (-485.732) (-495.735) (-494.403) [-476.859] -- 0:01:14
Average standard deviation of split frequencies: 0.013504
811000 -- (-489.280) [-474.767] (-487.894) (-494.985) * (-503.687) (-500.877) (-497.142) [-471.572] -- 0:01:14
812000 -- (-487.050) [-476.950] (-500.253) (-488.746) * (-496.619) (-504.332) (-502.377) [-471.047] -- 0:01:14
813000 -- (-489.387) [-477.851] (-500.619) (-502.135) * (-495.155) (-504.308) (-491.372) [-474.235] -- 0:01:13
814000 -- (-487.986) [-472.363] (-509.944) (-486.877) * (-497.828) (-505.563) (-494.289) [-473.061] -- 0:01:13
815000 -- (-487.058) [-476.531] (-514.927) (-492.337) * (-487.862) (-505.538) (-487.810) [-469.446] -- 0:01:12
Average standard deviation of split frequencies: 0.013351
816000 -- (-484.412) [-479.909] (-514.683) (-496.534) * (-498.721) (-490.183) (-489.186) [-469.452] -- 0:01:12
817000 -- (-495.876) [-471.916] (-514.491) (-497.823) * (-500.418) (-500.766) (-494.581) [-469.512] -- 0:01:12
818000 -- (-493.063) [-474.342] (-493.363) (-501.695) * (-494.624) (-487.714) (-494.337) [-473.261] -- 0:01:11
819000 -- (-493.522) [-470.834] (-496.773) (-487.281) * (-502.705) (-505.016) (-500.558) [-470.718] -- 0:01:11
820000 -- (-491.596) [-471.410] (-503.207) (-493.734) * (-492.470) (-498.167) (-492.455) [-470.003] -- 0:01:10
Average standard deviation of split frequencies: 0.013722
821000 -- (-492.868) [-474.595] (-499.603) (-491.076) * (-494.570) (-498.583) (-491.269) [-474.681] -- 0:01:10
822000 -- (-507.039) [-476.948] (-498.681) (-484.102) * (-497.175) (-494.123) (-491.869) [-473.185] -- 0:01:09
823000 -- (-498.253) [-471.688] (-492.606) (-493.918) * (-493.947) (-492.570) (-511.864) [-472.991] -- 0:01:09
824000 -- (-501.784) [-474.396] (-505.897) (-497.964) * (-486.723) (-489.565) (-506.250) [-475.554] -- 0:01:09
825000 -- (-494.092) [-469.916] (-496.826) (-503.203) * (-491.260) (-501.281) (-505.827) [-475.124] -- 0:01:08
Average standard deviation of split frequencies: 0.013126
826000 -- (-490.298) [-477.233] (-496.129) (-490.494) * (-483.255) (-507.165) (-503.426) [-477.472] -- 0:01:08
827000 -- (-512.011) [-472.707] (-491.245) (-498.980) * (-487.742) (-519.719) (-500.790) [-475.933] -- 0:01:07
828000 -- (-506.345) [-476.830] (-492.498) (-492.610) * (-484.466) (-499.516) (-502.779) [-475.105] -- 0:01:07
829000 -- (-492.231) [-480.019] (-491.878) (-488.817) * (-489.715) (-511.521) (-504.475) [-477.927] -- 0:01:07
830000 -- (-497.034) [-477.886] (-493.009) (-492.576) * (-485.341) (-506.672) (-493.118) [-472.798] -- 0:01:06
Average standard deviation of split frequencies: 0.012926
831000 -- (-496.481) [-478.584] (-495.467) (-487.780) * (-491.483) (-500.334) (-500.938) [-470.282] -- 0:01:06
832000 -- (-497.648) [-484.293] (-496.788) (-488.666) * (-499.740) (-496.432) (-496.728) [-474.575] -- 0:01:06
833000 -- (-498.833) [-483.815] (-499.345) (-496.814) * (-489.653) (-493.859) (-490.561) [-478.389] -- 0:01:05
834000 -- (-492.670) [-471.684] (-493.964) (-491.336) * (-488.649) (-502.392) (-491.566) [-471.294] -- 0:01:05
835000 -- (-487.846) [-479.793] (-484.217) (-494.087) * (-486.793) (-505.649) (-486.336) [-475.608] -- 0:01:05
Average standard deviation of split frequencies: 0.012844
836000 -- (-487.544) [-470.379] (-495.838) (-487.457) * (-489.792) (-497.932) (-490.670) [-473.672] -- 0:01:04
837000 -- (-485.299) [-475.924] (-494.361) (-496.344) * (-500.104) (-500.570) (-486.377) [-485.664] -- 0:01:04
838000 -- (-487.918) [-475.883] (-499.757) (-498.925) * (-497.290) (-506.458) (-490.859) [-474.222] -- 0:01:03
839000 -- (-496.487) [-476.434] (-484.268) (-491.835) * (-501.000) (-501.963) (-484.828) [-474.781] -- 0:01:03
840000 -- (-493.516) [-475.458] (-485.247) (-496.592) * (-491.941) (-490.986) (-488.506) [-471.105] -- 0:01:03
Average standard deviation of split frequencies: 0.013645
841000 -- (-507.232) [-475.264] (-482.620) (-491.562) * (-493.034) (-495.994) (-496.257) [-474.777] -- 0:01:02
842000 -- (-511.270) [-470.734] (-495.303) (-502.889) * (-485.619) (-504.624) (-491.343) [-475.507] -- 0:01:02
843000 -- (-494.037) [-476.502] (-491.196) (-493.279) * (-490.055) (-498.052) (-488.329) [-475.027] -- 0:01:01
844000 -- (-495.168) [-472.474] (-493.525) (-492.041) * (-509.055) (-486.245) (-490.394) [-470.220] -- 0:01:01
845000 -- (-494.703) [-469.757] (-489.771) (-489.452) * (-488.703) (-492.351) (-493.181) [-471.606] -- 0:01:00
Average standard deviation of split frequencies: 0.013002
846000 -- (-492.009) [-473.199] (-491.118) (-488.899) * (-501.544) (-491.613) (-492.062) [-475.826] -- 0:01:00
847000 -- (-489.861) [-476.371] (-488.829) (-483.974) * (-500.500) (-502.636) (-489.113) [-468.622] -- 0:01:00
848000 -- (-496.247) [-476.785] (-485.666) (-492.952) * (-494.769) (-488.692) (-503.547) [-477.040] -- 0:00:59
849000 -- (-518.647) [-480.317] (-490.379) (-498.184) * (-493.117) (-501.983) (-501.972) [-469.714] -- 0:00:59
850000 -- (-505.749) [-481.894] (-504.002) (-499.956) * (-490.079) (-499.624) (-497.754) [-473.707] -- 0:00:58
Average standard deviation of split frequencies: 0.012992
851000 -- (-502.113) [-477.783] (-497.685) (-497.663) * (-491.936) (-500.289) (-497.269) [-473.673] -- 0:00:58
852000 -- (-489.334) [-472.134] (-492.158) (-491.936) * (-492.436) (-500.645) (-501.750) [-481.896] -- 0:00:58
853000 -- (-490.967) [-478.850] (-493.021) (-496.789) * (-501.547) (-502.083) (-504.396) [-477.748] -- 0:00:57
854000 -- (-492.967) [-473.812] (-488.359) (-490.367) * (-502.497) (-493.904) (-497.098) [-477.279] -- 0:00:57
855000 -- (-483.418) [-470.166] (-487.425) (-501.191) * (-494.535) (-488.626) (-489.989) [-472.581] -- 0:00:56
Average standard deviation of split frequencies: 0.012666
856000 -- (-486.682) [-476.290] (-491.072) (-501.168) * (-492.418) (-496.417) (-488.356) [-472.152] -- 0:00:56
857000 -- (-497.959) [-472.437] (-496.614) (-492.320) * (-484.976) (-484.817) (-495.000) [-477.457] -- 0:00:56
858000 -- (-491.817) [-474.860] (-504.887) (-496.513) * (-501.675) (-491.231) (-491.923) [-477.546] -- 0:00:55
859000 -- (-492.039) [-479.947] (-491.503) (-491.102) * (-490.732) (-491.183) (-492.827) [-473.782] -- 0:00:55
860000 -- (-487.176) [-477.654] (-491.319) (-495.727) * (-489.544) (-493.582) (-502.304) [-477.615] -- 0:00:55
Average standard deviation of split frequencies: 0.012537
861000 -- (-496.632) [-477.147] (-498.492) (-487.099) * (-488.534) (-496.189) (-499.829) [-471.169] -- 0:00:54
862000 -- (-498.150) [-480.810] (-503.694) (-488.153) * (-488.420) (-493.866) (-517.919) [-477.824] -- 0:00:54
863000 -- (-496.504) [-483.857] (-497.426) (-498.387) * (-506.797) (-488.426) (-495.077) [-475.325] -- 0:00:53
864000 -- (-500.652) [-472.206] (-497.082) (-492.983) * (-501.132) (-493.557) (-494.111) [-472.210] -- 0:00:53
865000 -- (-497.087) [-472.863] (-494.347) (-493.431) * (-493.685) (-491.519) (-493.846) [-470.642] -- 0:00:53
Average standard deviation of split frequencies: 0.012822
866000 -- (-484.197) [-478.248] (-490.861) (-491.705) * (-488.232) (-489.247) (-486.126) [-474.262] -- 0:00:52
867000 -- (-487.191) [-493.355] (-487.564) (-487.830) * (-483.633) (-495.313) (-495.047) [-474.771] -- 0:00:52
868000 -- (-490.999) [-482.311] (-493.483) (-493.446) * (-495.666) (-497.969) (-506.290) [-470.479] -- 0:00:51
869000 -- (-495.895) [-479.672] (-500.893) (-494.631) * (-491.262) (-504.353) (-495.926) [-475.552] -- 0:00:51
870000 -- (-493.254) [-473.179] (-500.696) (-503.593) * (-481.879) (-499.143) (-507.670) [-474.483] -- 0:00:51
Average standard deviation of split frequencies: 0.012020
871000 -- (-497.066) [-482.385] (-499.494) (-486.686) * (-484.392) (-497.695) (-494.609) [-475.724] -- 0:00:50
872000 -- (-505.199) [-475.305] (-494.795) (-486.632) * (-490.598) (-497.243) (-494.280) [-474.494] -- 0:00:50
873000 -- (-489.623) [-475.113] (-507.657) (-493.350) * (-491.667) (-495.930) (-502.248) [-483.772] -- 0:00:49
874000 -- (-500.357) [-474.130] (-505.836) (-493.227) * (-490.553) (-502.847) (-491.741) [-483.209] -- 0:00:49
875000 -- (-496.010) [-471.136] (-503.842) (-493.953) * (-490.209) (-504.209) (-490.918) [-470.466] -- 0:00:49
Average standard deviation of split frequencies: 0.012162
876000 -- (-501.779) [-468.571] (-495.111) (-503.910) * (-488.492) (-488.396) (-495.021) [-472.290] -- 0:00:48
877000 -- (-490.698) [-476.278] (-497.285) (-491.262) * (-489.226) (-491.072) (-504.503) [-473.293] -- 0:00:48
878000 -- (-493.519) [-476.533] (-497.790) (-506.073) * (-487.846) (-496.416) (-499.291) [-472.016] -- 0:00:47
879000 -- (-488.267) [-474.403] (-486.119) (-498.295) * (-499.398) (-501.766) (-491.893) [-471.602] -- 0:00:47
880000 -- (-502.572) [-471.729] (-488.227) (-496.775) * (-489.853) (-497.143) (-499.762) [-473.710] -- 0:00:47
Average standard deviation of split frequencies: 0.012133
881000 -- (-488.041) [-479.460] (-486.800) (-495.145) * (-496.009) (-495.632) (-491.040) [-469.974] -- 0:00:46
882000 -- (-488.978) [-473.779] (-501.393) (-492.864) * (-500.966) (-500.569) (-502.680) [-475.266] -- 0:00:46
883000 -- (-486.982) [-473.855] (-491.750) (-494.213) * (-483.344) (-500.455) (-497.948) [-477.251] -- 0:00:45
884000 -- (-496.455) [-475.081] (-488.554) (-498.357) * (-497.497) (-505.797) (-493.778) [-477.524] -- 0:00:45
885000 -- (-487.519) [-478.983] (-490.839) (-485.519) * (-495.288) (-495.070) (-503.326) [-474.059] -- 0:00:45
Average standard deviation of split frequencies: 0.011971
886000 -- (-490.140) [-476.577] (-501.739) (-492.666) * (-494.980) (-495.881) (-504.257) [-476.433] -- 0:00:44
887000 -- (-494.258) [-474.824] (-500.934) (-488.120) * (-488.599) (-492.987) (-488.275) [-476.612] -- 0:00:44
888000 -- (-487.618) [-478.777] (-492.485) (-504.827) * (-485.920) (-496.235) (-514.532) [-473.398] -- 0:00:44
889000 -- (-494.514) [-474.988] (-486.200) (-497.157) * (-495.741) (-492.880) (-499.696) [-477.037] -- 0:00:43
890000 -- (-488.494) [-474.940] (-485.667) (-496.339) * (-486.853) (-494.277) (-495.478) [-475.920] -- 0:00:43
Average standard deviation of split frequencies: 0.011909
891000 -- (-495.973) [-469.953] (-487.257) (-502.705) * (-487.017) (-496.006) (-500.029) [-476.134] -- 0:00:42
892000 -- (-491.420) [-471.469] (-486.438) (-490.820) * (-496.016) (-493.350) (-508.330) [-479.116] -- 0:00:42
893000 -- (-496.506) [-469.954] (-498.092) (-492.753) * (-503.895) (-500.222) (-498.445) [-473.938] -- 0:00:42
894000 -- (-493.947) [-478.750] (-496.723) (-487.243) * (-504.857) (-507.925) (-486.846) [-474.955] -- 0:00:41
895000 -- (-487.009) [-473.088] (-494.842) (-486.885) * (-499.862) (-492.579) (-493.232) [-475.516] -- 0:00:41
Average standard deviation of split frequencies: 0.012101
896000 -- (-493.138) [-471.332] (-502.561) (-493.883) * (-498.698) (-498.377) (-490.789) [-474.268] -- 0:00:40
897000 -- (-497.641) [-474.789] (-486.102) (-498.635) * (-491.274) (-492.382) (-492.657) [-475.212] -- 0:00:40
898000 -- (-503.903) [-484.811] (-482.434) (-493.783) * (-490.768) (-488.683) (-493.381) [-480.947] -- 0:00:40
899000 -- (-493.287) [-480.287] (-487.106) (-487.057) * (-488.106) (-491.925) (-486.645) [-471.914] -- 0:00:39
900000 -- (-505.683) [-479.906] (-504.349) (-501.391) * (-498.868) (-490.330) (-493.346) [-475.711] -- 0:00:39
Average standard deviation of split frequencies: 0.012431
901000 -- (-498.755) [-483.839] (-495.798) (-493.116) * (-488.316) (-493.630) (-486.956) [-472.839] -- 0:00:38
902000 -- (-498.320) [-474.597] (-502.204) (-489.192) * (-483.380) (-490.012) (-492.427) [-473.882] -- 0:00:38
903000 -- (-493.138) [-478.103] (-501.111) (-497.515) * (-496.156) (-499.635) (-494.213) [-472.575] -- 0:00:38
904000 -- (-488.900) [-481.992] (-495.598) (-494.645) * (-490.182) (-499.287) (-491.749) [-474.680] -- 0:00:37
905000 -- (-499.927) [-478.203] (-493.742) (-489.153) * (-488.126) (-502.070) (-497.014) [-477.177] -- 0:00:37
Average standard deviation of split frequencies: 0.012083
906000 -- (-487.925) [-470.337] (-490.832) (-491.653) * (-492.672) (-497.838) (-494.271) [-473.800] -- 0:00:36
907000 -- (-481.789) [-473.764] (-498.428) (-500.152) * (-494.434) (-499.407) (-492.728) [-471.128] -- 0:00:36
908000 -- (-493.580) [-477.608] (-508.405) (-491.638) * (-489.486) (-495.554) (-486.105) [-475.397] -- 0:00:36
909000 -- (-488.493) [-475.272] (-510.548) (-496.997) * (-485.973) (-499.554) (-491.413) [-474.949] -- 0:00:35
910000 -- (-490.298) [-477.981] (-500.471) (-495.538) * (-487.116) (-504.831) (-494.817) [-472.906] -- 0:00:35
Average standard deviation of split frequencies: 0.011906
911000 -- (-493.413) [-476.941] (-500.107) (-492.294) * (-489.632) (-508.059) (-494.556) [-475.263] -- 0:00:34
912000 -- (-491.789) [-470.941] (-488.288) (-488.691) * (-495.679) (-496.686) (-490.795) [-476.421] -- 0:00:34
913000 -- (-492.000) [-481.905] (-497.747) (-489.489) * (-486.221) (-503.931) (-501.624) [-484.577] -- 0:00:34
914000 -- (-500.538) [-479.595] (-489.115) (-493.720) * (-483.572) (-498.187) (-499.954) [-477.574] -- 0:00:33
915000 -- (-486.020) [-479.490] (-495.425) (-486.836) * (-489.311) (-492.804) (-493.910) [-484.416] -- 0:00:33
Average standard deviation of split frequencies: 0.012180
916000 -- (-489.559) [-475.573] (-490.149) (-489.678) * (-488.899) (-498.046) (-496.927) [-473.858] -- 0:00:33
917000 -- (-486.332) [-474.928] (-491.548) (-493.322) * (-487.998) (-496.236) (-494.802) [-476.717] -- 0:00:32
918000 -- (-502.628) [-476.278] (-486.787) (-491.199) * (-493.018) (-499.623) (-495.302) [-479.102] -- 0:00:32
919000 -- (-488.504) [-477.567] (-488.181) (-494.073) * (-487.775) (-493.618) (-493.587) [-477.080] -- 0:00:31
920000 -- (-488.256) [-477.657] (-493.226) (-497.276) * (-490.592) (-496.109) (-495.128) [-474.812] -- 0:00:31
Average standard deviation of split frequencies: 0.012175
921000 -- (-495.946) [-469.388] (-498.918) (-503.779) * (-493.295) (-498.079) (-498.351) [-474.006] -- 0:00:31
922000 -- (-495.725) [-472.412] (-484.549) (-503.186) * (-495.294) (-499.599) (-494.139) [-480.361] -- 0:00:30
923000 -- (-494.066) [-471.661] (-490.685) (-510.342) * (-494.325) (-505.460) (-509.062) [-475.551] -- 0:00:30
924000 -- (-498.411) [-473.624] (-498.969) (-504.264) * (-486.124) (-494.445) (-496.085) [-469.319] -- 0:00:29
925000 -- (-502.593) [-472.353] (-483.761) (-493.348) * (-484.473) (-499.735) (-495.663) [-473.401] -- 0:00:29
Average standard deviation of split frequencies: 0.012105
926000 -- (-499.927) [-472.144] (-491.468) (-488.294) * (-494.748) (-497.597) (-490.687) [-474.901] -- 0:00:29
927000 -- (-501.211) [-476.071] (-488.871) (-492.275) * (-492.510) (-502.916) (-490.010) [-474.323] -- 0:00:28
928000 -- (-503.911) [-477.894] (-486.454) (-494.695) * (-495.832) (-512.617) (-491.342) [-476.313] -- 0:00:28
929000 -- (-496.223) [-472.215] (-487.726) (-489.611) * (-497.292) (-506.071) (-486.399) [-470.240] -- 0:00:27
930000 -- (-493.838) [-476.675] (-487.711) (-494.350) * (-495.962) (-499.795) (-490.611) [-473.095] -- 0:00:27
Average standard deviation of split frequencies: 0.011988
931000 -- (-491.693) [-475.708] (-514.369) (-486.273) * (-489.313) (-508.728) (-484.338) [-470.893] -- 0:00:27
932000 -- (-492.171) [-473.842] (-496.360) (-492.676) * (-505.058) (-495.702) (-498.560) [-473.561] -- 0:00:26
933000 -- (-499.186) [-471.627] (-483.948) (-491.749) * (-496.789) (-495.867) (-497.867) [-471.855] -- 0:00:26
934000 -- (-495.766) [-472.180] (-488.386) (-494.480) * (-498.415) (-495.435) (-501.896) [-479.067] -- 0:00:25
935000 -- (-500.255) [-474.341] (-497.937) (-489.441) * (-500.412) (-497.751) (-492.025) [-478.611] -- 0:00:25
Average standard deviation of split frequencies: 0.011696
936000 -- (-489.435) [-480.266] (-491.065) (-488.998) * (-489.835) (-496.670) (-500.505) [-472.359] -- 0:00:25
937000 -- (-487.947) [-476.116] (-495.694) (-497.979) * (-498.354) (-512.602) (-508.445) [-473.833] -- 0:00:24
938000 -- (-489.504) [-475.134] (-502.357) (-485.803) * (-496.068) (-506.028) (-492.913) [-476.860] -- 0:00:24
939000 -- (-487.358) [-473.787] (-500.175) (-491.409) * (-499.826) (-498.849) (-487.252) [-473.139] -- 0:00:23
940000 -- (-496.050) [-474.569] (-501.466) (-496.023) * (-502.006) (-501.640) (-488.517) [-471.926] -- 0:00:23
Average standard deviation of split frequencies: 0.011526
941000 -- (-498.951) [-476.100] (-501.408) (-483.578) * (-500.797) (-499.170) (-491.574) [-474.522] -- 0:00:23
942000 -- (-502.983) [-480.039] (-502.791) (-497.334) * (-496.155) (-492.425) (-486.381) [-473.253] -- 0:00:22
943000 -- (-498.648) [-476.365] (-502.359) (-488.988) * (-484.152) (-493.601) (-491.495) [-472.887] -- 0:00:22
944000 -- (-514.916) [-474.273] (-505.923) (-497.628) * (-484.298) (-499.332) (-499.973) [-475.357] -- 0:00:22
945000 -- (-499.975) [-469.617] (-514.982) (-489.391) * (-489.863) (-503.497) (-488.245) [-471.055] -- 0:00:21
Average standard deviation of split frequencies: 0.011517
946000 -- (-496.155) [-469.213] (-510.273) (-495.769) * (-496.150) (-489.101) (-487.532) [-473.095] -- 0:00:21
947000 -- (-494.971) [-475.369] (-494.577) (-505.971) * (-500.834) (-504.680) (-492.600) [-474.336] -- 0:00:20
948000 -- (-498.877) [-472.076] (-495.736) (-501.458) * (-484.704) (-493.819) (-499.093) [-473.211] -- 0:00:20
949000 -- (-487.103) [-474.195] (-495.727) (-499.372) * (-484.260) (-496.823) (-490.620) [-473.121] -- 0:00:20
950000 -- (-497.789) [-468.865] (-505.571) (-494.587) * (-487.312) (-509.180) (-489.973) [-470.954] -- 0:00:19
Average standard deviation of split frequencies: 0.010847
951000 -- (-501.285) [-479.777] (-491.483) (-500.771) * (-485.379) (-499.490) (-499.331) [-474.894] -- 0:00:19
952000 -- (-504.169) [-480.011] (-491.409) (-497.981) * (-492.894) (-504.501) (-488.267) [-470.183] -- 0:00:18
953000 -- (-495.139) [-480.072] (-490.516) (-511.455) * (-482.043) (-502.984) (-485.864) [-478.304] -- 0:00:18
954000 -- (-498.472) [-475.786] (-497.656) (-501.767) * (-490.944) (-502.587) (-491.207) [-476.221] -- 0:00:18
955000 -- (-497.349) [-479.255] (-485.547) (-497.224) * (-487.329) (-495.974) (-490.847) [-472.527] -- 0:00:17
Average standard deviation of split frequencies: 0.010971
956000 -- (-492.101) [-480.656] (-487.529) (-493.556) * (-488.638) (-492.405) (-489.759) [-473.251] -- 0:00:17
957000 -- (-492.232) [-478.910] (-488.967) (-487.853) * (-491.144) (-496.964) (-490.219) [-476.961] -- 0:00:16
958000 -- (-493.916) [-476.806] (-492.932) (-488.438) * (-487.621) (-488.479) (-488.269) [-475.606] -- 0:00:16
959000 -- (-518.068) [-472.998] (-502.908) (-491.708) * (-499.374) (-497.159) (-496.085) [-471.816] -- 0:00:16
960000 -- (-513.034) [-474.694] (-498.776) (-485.422) * (-510.283) (-492.537) (-499.949) [-473.335] -- 0:00:15
Average standard deviation of split frequencies: 0.010375
961000 -- (-507.528) [-477.262] (-487.918) (-486.217) * (-492.336) (-496.240) (-497.713) [-473.591] -- 0:00:15
962000 -- (-505.530) [-474.327] (-489.700) (-492.322) * (-484.395) (-489.715) (-508.627) [-471.198] -- 0:00:14
963000 -- (-504.128) [-477.227] (-492.478) (-484.726) * (-503.163) (-487.536) (-494.689) [-475.438] -- 0:00:14
964000 -- (-514.188) [-478.103] (-496.537) (-489.004) * (-487.333) (-494.260) (-491.281) [-473.591] -- 0:00:14
965000 -- (-494.807) [-474.693] (-493.197) (-486.071) * (-483.379) (-504.760) (-491.940) [-468.778] -- 0:00:13
Average standard deviation of split frequencies: 0.011061
966000 -- (-489.361) [-475.292] (-486.631) (-489.099) * (-502.227) (-497.906) (-494.251) [-476.084] -- 0:00:13
967000 -- (-488.314) [-473.543] (-492.801) (-493.058) * (-494.003) (-497.872) (-497.561) [-478.320] -- 0:00:12
968000 -- (-488.206) [-471.141] (-488.326) (-491.011) * (-482.834) (-495.554) (-488.791) [-475.443] -- 0:00:12
969000 -- (-492.110) [-474.643] (-492.058) (-490.421) * (-488.497) (-491.357) (-489.032) [-471.711] -- 0:00:12
970000 -- (-497.536) [-475.382] (-495.393) (-486.152) * (-486.940) (-490.430) (-491.494) [-471.781] -- 0:00:11
Average standard deviation of split frequencies: 0.010624
971000 -- (-495.844) [-472.445] (-489.553) (-491.918) * (-486.709) (-493.936) (-483.688) [-471.718] -- 0:00:11
972000 -- (-493.736) [-468.713] (-491.441) (-493.365) * (-488.432) (-495.898) (-494.694) [-473.865] -- 0:00:11
973000 -- (-494.489) [-476.614] (-494.068) (-498.010) * (-484.843) (-492.788) (-490.322) [-475.015] -- 0:00:10
974000 -- (-499.937) [-480.228] (-496.134) (-493.734) * (-482.382) (-495.677) (-497.630) [-473.672] -- 0:00:10
975000 -- (-490.695) [-472.951] (-495.957) (-498.539) * (-488.414) (-495.521) (-491.846) [-475.404] -- 0:00:09
Average standard deviation of split frequencies: 0.010384
976000 -- (-490.914) [-472.471] (-503.932) (-498.057) * (-494.820) (-490.215) (-493.438) [-476.066] -- 0:00:09
977000 -- (-494.121) [-473.697] (-520.769) (-493.081) * (-485.532) (-495.226) (-498.466) [-477.804] -- 0:00:09
978000 -- (-490.707) [-476.378] (-490.674) (-486.579) * (-492.541) (-489.163) (-500.247) [-475.221] -- 0:00:08
979000 -- (-493.507) [-477.129] (-501.138) (-486.009) * (-505.058) (-494.981) (-499.347) [-475.105] -- 0:00:08
980000 -- (-492.832) [-473.148] (-494.458) (-489.877) * (-491.887) (-496.657) (-485.653) [-470.755] -- 0:00:07
Average standard deviation of split frequencies: 0.010035
981000 -- (-496.192) [-474.846] (-488.813) (-491.624) * (-488.320) (-487.152) (-483.898) [-470.963] -- 0:00:07
982000 -- (-490.097) [-473.989] (-501.950) (-488.841) * (-496.279) (-496.565) (-490.256) [-476.130] -- 0:00:07
983000 -- (-499.318) [-474.371] (-491.233) (-485.858) * (-494.534) (-500.254) (-488.082) [-470.703] -- 0:00:06
984000 -- (-496.657) [-474.176] (-499.516) (-484.645) * (-502.506) (-507.264) (-491.847) [-470.010] -- 0:00:06
985000 -- (-504.086) [-474.049] (-498.622) (-486.238) * (-490.921) (-487.220) (-483.783) [-475.269] -- 0:00:05
Average standard deviation of split frequencies: 0.010100
986000 -- (-491.842) [-483.412] (-494.730) (-489.921) * (-491.759) (-490.371) (-487.658) [-473.871] -- 0:00:05
987000 -- (-498.242) [-476.375] (-496.931) (-489.767) * (-491.097) (-489.726) (-502.963) [-472.110] -- 0:00:05
988000 -- (-493.618) [-477.451] (-493.041) (-491.303) * (-495.027) (-488.992) (-501.204) [-474.161] -- 0:00:04
989000 -- (-496.658) [-475.099] (-500.668) (-490.175) * (-485.520) (-493.946) (-500.784) [-471.205] -- 0:00:04
990000 -- (-501.333) [-474.763] (-487.390) (-488.954) * (-492.565) (-487.667) (-496.639) [-473.431] -- 0:00:03
Average standard deviation of split frequencies: 0.010171
991000 -- (-504.115) [-471.895] (-485.758) (-484.302) * (-486.860) (-487.112) (-500.940) [-473.070] -- 0:00:03
992000 -- (-504.671) [-469.393] (-493.223) (-487.993) * (-490.836) (-492.494) (-485.964) [-484.214] -- 0:00:03
993000 -- (-505.526) [-476.643] (-494.273) (-490.051) * (-494.900) (-491.936) (-489.953) [-486.389] -- 0:00:02
994000 -- (-503.903) [-479.438] (-500.808) (-489.919) * (-491.220) (-494.182) (-497.428) [-474.296] -- 0:00:02
995000 -- (-499.974) [-472.528] (-496.005) (-489.677) * (-498.708) (-491.385) (-500.743) [-471.936] -- 0:00:01
Average standard deviation of split frequencies: 0.009880
996000 -- (-490.111) [-472.850] (-497.741) (-495.075) * (-501.162) (-491.274) (-509.882) [-471.352] -- 0:00:01
997000 -- (-495.823) [-475.053] (-494.460) (-488.163) * (-496.486) (-490.296) (-491.756) [-476.770] -- 0:00:01
998000 -- (-489.411) [-471.157] (-496.101) (-494.598) * (-493.054) (-487.112) (-496.687) [-472.607] -- 0:00:00
999000 -- (-494.222) [-476.215] (-486.759) (-493.298) * (-485.565) (-491.396) (-493.045) [-483.915] -- 0:00:00
1000000 -- (-508.570) [-481.127] (-495.081) (-493.154) * (-488.304) (-492.457) (-497.458) [-468.636] -- 0:00:00
Average standard deviation of split frequencies: 0.010305
Analysis completed in 6 mins 33 seconds
Analysis used 392.22 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -465.44
Likelihood of best state for "cold" chain of run 2 was -466.48
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 73 %) Dirichlet(Revmat{all})
89.5 % ( 91 %) Slider(Revmat{all})
41.1 % ( 33 %) Dirichlet(Pi{all})
41.4 % ( 32 %) Slider(Pi{all})
81.4 % ( 65 %) Multiplier(Alpha{1,2})
77.1 % ( 59 %) Multiplier(Alpha{3})
91.5 % ( 77 %) Slider(Pinvar{all})
88.5 % ( 87 %) ExtSPR(Tau{all},V{all})
86.9 % ( 87 %) ExtTBR(Tau{all},V{all})
92.9 % ( 93 %) NNI(Tau{all},V{all})
65.7 % ( 68 %) ParsSPR(Tau{all},V{all})
27.9 % ( 21 %) Multiplier(V{all})
91.3 % ( 90 %) Nodeslider(V{all})
29.3 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.7 % ( 78 %) Dirichlet(Revmat{all})
89.5 % ( 84 %) Slider(Revmat{all})
42.0 % ( 30 %) Dirichlet(Pi{all})
41.2 % ( 34 %) Slider(Pi{all})
82.5 % ( 63 %) Multiplier(Alpha{1,2})
77.3 % ( 49 %) Multiplier(Alpha{3})
92.1 % ( 87 %) Slider(Pinvar{all})
88.4 % ( 89 %) ExtSPR(Tau{all},V{all})
86.6 % ( 86 %) ExtTBR(Tau{all},V{all})
92.6 % ( 92 %) NNI(Tau{all},V{all})
65.6 % ( 71 %) ParsSPR(Tau{all},V{all})
27.7 % ( 23 %) Multiplier(V{all})
91.1 % ( 85 %) Nodeslider(V{all})
29.1 % ( 34 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.00 0.00 0.00
2 | 166579 0.19 0.02
3 | 166415 166972 0.32
4 | 167492 166563 165979
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.00 0.00 0.00
2 | 166025 0.18 0.02
3 | 166341 167013 0.32
4 | 166923 167011 166687
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -472.50
| 2 2 |
| 1 2 2 |
|2 1 11 121 2 1 2 1* |
|1 *22 2 1 2 22 2 22 212 1 * 2 2 22 |
| 2 1 2 2 1 1 1 11 21 1 2 * |
| 112 12 2 1 1 1 *|
| 2 1 1 121 1 2 22 211 2 1 2 2 2 1 |
| 21 1 1 1 * 1 1 1 2 1 |
| * 2 2 1 1 1 1 2 |
| 1 1 2 1 1 |
| 2 2 1 |
| 2 2 2 |
| 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -479.72
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -471.49 -486.06
2 -471.23 -483.96
--------------------------------------
TOTAL -471.35 -485.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.042151 0.000238 0.016822 0.071223 0.040234 1450.57 1461.43 1.000
r(A<->C){all} 0.258675 0.012177 0.062585 0.474071 0.249302 89.15 92.46 1.000
r(A<->G){all} 0.206307 0.011463 0.033201 0.421811 0.191887 77.30 78.77 1.002
r(A<->T){all} 0.097765 0.004288 0.002584 0.227955 0.084308 131.55 135.51 1.001
r(C<->G){all} 0.152767 0.009051 0.008037 0.337393 0.136455 87.29 94.61 1.000
r(C<->T){all} 0.169334 0.008304 0.023298 0.352702 0.155434 65.37 78.38 1.001
r(G<->T){all} 0.115152 0.006079 0.006809 0.272199 0.098304 76.43 91.67 1.001
pi(A){all} 0.280122 0.000655 0.226439 0.327264 0.279794 771.04 802.53 1.002
pi(C){all} 0.208239 0.000553 0.162933 0.253367 0.207324 670.24 766.57 1.000
pi(G){all} 0.188624 0.000510 0.142772 0.231314 0.188297 875.58 905.70 1.000
pi(T){all} 0.323015 0.000745 0.266821 0.373418 0.323932 735.79 780.48 1.002
alpha{1,2} 0.746129 0.717937 0.000327 2.329224 0.466153 614.90 647.20 1.000
alpha{3} 1.167151 1.061900 0.002381 3.152054 0.892139 512.64 753.98 1.000
pinvar{all} 0.487687 0.065718 0.022602 0.879274 0.504656 216.68 229.71 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C10
2 -- C11
3 -- C13
4 -- C15
5 -- C18
6 -- C19
7 -- C2
8 -- C20
9 -- C21
10 -- C26
11 -- C27
12 -- C29
13 -- C30
14 -- C39
15 -- C4
16 -- C40
17 -- C42
18 -- C43
19 -- C45
20 -- C48
21 -- C49
22 -- C52
23 -- C54
24 -- C56
25 -- C57
26 -- C58
27 -- C59
28 -- C6
29 -- C8
30 -- C9
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
------------------------------------
1 -- .*****************************
2 -- .*............................
3 -- ..*...........................
4 -- ...*..........................
5 -- ....*.........................
6 -- .....*........................
7 -- ......*.......................
8 -- .......*......................
9 -- ........*.....................
10 -- .........*....................
11 -- ..........*...................
12 -- ...........*..................
13 -- ............*.................
14 -- .............*................
15 -- ..............*...............
16 -- ...............*..............
17 -- ................*.............
18 -- .................*............
19 -- ..................*...........
20 -- ...................*..........
21 -- ....................*.........
22 -- .....................*........
23 -- ......................*.......
24 -- .......................*......
25 -- ........................*.....
26 -- .........................*....
27 -- ..........................*...
28 -- ...........................*..
29 -- ............................*.
30 -- .............................*
31 -- .*****.*..*.***********..****.
32 -- ........**....................
33 -- ......*.................*.....
34 -- .......................**.....
35 -- .*****.***********************
36 -- .......................*.....*
37 -- ......*....*..................
38 -- ...........*............*.....
------------------------------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
31 2846 0.948035 0.003769 0.945370 0.950700 2
32 2774 0.924051 0.002827 0.922052 0.926049 2
33 299 0.099600 0.008009 0.093937 0.105263 2
34 289 0.096269 0.008951 0.089940 0.102598 2
35 281 0.093604 0.017430 0.081279 0.105929 2
36 279 0.092938 0.010835 0.085276 0.100600 2
37 273 0.090939 0.014604 0.080613 0.101266 2
38 268 0.089274 0.016017 0.077948 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.000618 0.000000 0.000000 0.001986 0.000397 1.000 2
length{all}[2] 0.001251 0.000001 0.000025 0.003168 0.000982 1.000 2
length{all}[3] 0.000656 0.000001 0.000000 0.002018 0.000435 1.000 2
length{all}[4] 0.000636 0.000000 0.000000 0.002015 0.000409 1.000 2
length{all}[5] 0.000612 0.000000 0.000000 0.001967 0.000396 1.000 2
length{all}[6] 0.000622 0.000000 0.000000 0.001939 0.000406 1.001 2
length{all}[7] 0.000620 0.000001 0.000001 0.001889 0.000395 1.000 2
length{all}[8] 0.000615 0.000000 0.000000 0.001925 0.000391 1.001 2
length{all}[9] 0.001901 0.000002 0.000082 0.004484 0.001586 1.000 2
length{all}[10] 0.001287 0.000001 0.000005 0.003299 0.001018 1.000 2
length{all}[11] 0.000599 0.000000 0.000000 0.001880 0.000397 1.000 2
length{all}[12] 0.000630 0.000001 0.000000 0.002051 0.000403 1.000 2
length{all}[13] 0.000628 0.000001 0.000000 0.002052 0.000384 1.000 2
length{all}[14] 0.000597 0.000000 0.000000 0.001892 0.000395 1.000 2
length{all}[15] 0.000631 0.000000 0.000000 0.002065 0.000416 1.000 2
length{all}[16] 0.000626 0.000000 0.000000 0.001930 0.000411 1.000 2
length{all}[17] 0.000642 0.000001 0.000000 0.001994 0.000412 1.000 2
length{all}[18] 0.000623 0.000000 0.000000 0.001865 0.000414 1.000 2
length{all}[19] 0.000658 0.000001 0.000000 0.002023 0.000442 1.001 2
length{all}[20] 0.000573 0.000000 0.000000 0.001752 0.000379 1.000 2
length{all}[21] 0.000623 0.000000 0.000000 0.001891 0.000402 1.000 2
length{all}[22] 0.000652 0.000001 0.000001 0.002041 0.000422 1.000 2
length{all}[23] 0.000638 0.000001 0.000001 0.001959 0.000406 1.000 2
length{all}[24] 0.000651 0.000000 0.000000 0.002031 0.000429 1.000 2
length{all}[25] 0.000615 0.000000 0.000000 0.001948 0.000390 1.000 2
length{all}[26] 0.000639 0.000000 0.000001 0.001962 0.000425 1.000 2
length{all}[27] 0.000628 0.000000 0.000000 0.002010 0.000407 1.000 2
length{all}[28] 0.001922 0.000002 0.000072 0.004304 0.001641 1.000 2
length{all}[29] 0.001863 0.000002 0.000139 0.004310 0.001571 1.001 2
length{all}[30] 0.000649 0.000001 0.000000 0.002079 0.000420 1.000 2
length{all}[31] 0.001253 0.000001 0.000039 0.003163 0.001004 1.000 2
length{all}[32] 0.001286 0.000001 0.000029 0.003368 0.001013 1.000 2
length{all}[33] 0.000586 0.000000 0.000001 0.001855 0.000362 1.006 2
length{all}[34] 0.000679 0.000001 0.000003 0.002260 0.000434 0.998 2
length{all}[35] 0.000545 0.000000 0.000002 0.001603 0.000352 1.002 2
length{all}[36] 0.000676 0.000001 0.000001 0.002201 0.000480 0.997 2
length{all}[37] 0.000581 0.000000 0.000001 0.001780 0.000402 0.999 2
length{all}[38] 0.000664 0.000001 0.000000 0.002355 0.000414 1.019 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010305
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values (excluding NA and >10.0) = 1.001
Maximum PSRF for parameter values = 1.019
Clade credibility values:
/---------------------------------------------------------------------- C10 (1)
|
|---------------------------------------------------------------------- C2 (7)
|
|---------------------------------------------------------------------- C29 (12)
|
|---------------------------------------------------------------------- C56 (24)
|
|---------------------------------------------------------------------- C57 (25)
|
|---------------------------------------------------------------------- C9 (30)
|
| /----------------------------------- C11 (2)
| |
| |----------------------------------- C13 (3)
| |
| |----------------------------------- C15 (4)
| |
| |----------------------------------- C18 (5)
| |
| |----------------------------------- C19 (6)
| |
| |----------------------------------- C20 (8)
| |
| |----------------------------------- C27 (11)
| |
| |----------------------------------- C30 (13)
| |
| |----------------------------------- C39 (14)
+ |
| |----------------------------------- C4 (15)
| |
| |----------------------------------- C40 (16)
|----------------95----------------+
| |----------------------------------- C42 (17)
| |
| |----------------------------------- C43 (18)
| |
| |----------------------------------- C45 (19)
| |
| |----------------------------------- C48 (20)
| |
| |----------------------------------- C49 (21)
| |
| |----------------------------------- C52 (22)
| |
| |----------------------------------- C54 (23)
| |
| |----------------------------------- C58 (26)
| |
| |----------------------------------- C59 (27)
| |
| |----------------------------------- C6 (28)
| |
| \----------------------------------- C8 (29)
|
| /----------------------------------- C21 (9)
\----------------92----------------+
\----------------------------------- C26 (10)
Phylogram (based on average branch lengths):
/----------- C10 (1)
|
|----------- C2 (7)
|
|----------- C29 (12)
|
|------------ C56 (24)
|
|---------- C57 (25)
|
|----------- C9 (30)
|
| /-------------------------- C11 (2)
| |
| |------------ C13 (3)
| |
| |----------- C15 (4)
| |
| |----------- C18 (5)
| |
| |----------- C19 (6)
| |
| |---------- C20 (8)
| |
| |----------- C27 (11)
| |
| |---------- C30 (13)
| |
| |----------- C39 (14)
+ |
| |----------- C4 (15)
| |
| |----------- C40 (16)
|--------------------------+
| |----------- C42 (17)
| |
| |----------- C43 (18)
| |
| |------------ C45 (19)
| |
| |---------- C48 (20)
| |
| |----------- C49 (21)
| |
| |----------- C52 (22)
| |
| |----------- C54 (23)
| |
| |----------- C58 (26)
| |
| |----------- C59 (27)
| |
| |-------------------------------------------- C6 (28)
| |
| \------------------------------------------ C8 (29)
|
| /------------------------------------------- C21 (9)
\--------------------------+
\---------------------------- C26 (10)
|------------| 0.001 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3002 trees sampled):
50 % credible set contains 1501 trees
90 % credible set contains 2702 trees
95 % credible set contains 2852 trees
99 % credible set contains 2972 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
-- Starting log on Tue Nov 08 20:15:04 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result--
-- Starting log on Tue Nov 08 21:33:44 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result/original_alignment/codeml,NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result.1--
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 1 2 7 8
processing fasta file
reading seq# 1 C52 282 sites
reading seq# 2 C59 282 sites
reading seq# 3 C58 282 sites
reading seq# 4 C4 282 sites
reading seq# 5 C2 282 sites
reading seq# 6 C6 282 sites
reading seq# 7 C48 282 sites
reading seq# 8 C13 282 sites
reading seq# 9 C9 282 sites
reading seq#10 C11 282 sites
reading seq#11 C54 282 sites
reading seq#12 C43 282 sites
reading seq#13 C20 282 sites
reading seq#14 C42 282 sites
reading seq#15 C21 282 sites
reading seq#16 C26 282 sites
reading seq#17 C8 282 sites
reading seq#18 C56 282 sites
reading seq#19 C19 282 sites
reading seq#20 C40 282 sites
reading seq#21 C30 282 sites
reading seq#22 C29 282 sites
reading seq#23 C15 282 sites
reading seq#24 C10 282 sites
reading seq#25 C45 282 sites
reading seq#26 C57 282 sites
reading seq#27 C18 282 sites
reading seq#28 C27 282 sites
reading seq#29 C49 282 sites
reading seq#30 C39 282 sitesns = 30 ls = 282
Reading sequences, sequential format..
Reading seq # 1: C52
Reading seq # 2: C59
Reading seq # 3: C58
Reading seq # 4: C4
Reading seq # 5: C2
Reading seq # 6: C6
Reading seq # 7: C48
Reading seq # 8: C13
Reading seq # 9: C9
Reading seq #10: C11
Reading seq #11: C54
Reading seq #12: C43
Reading seq #13: C20
Reading seq #14: C42
Reading seq #15: C21
Reading seq #16: C26
Reading seq #17: C8
Reading seq #18: C56
Reading seq #19: C19
Reading seq #20: C40
Reading seq #21: C30
Reading seq #22: C29
Reading seq #23: C15
Reading seq #24: C10
Reading seq #25: C45
Reading seq #26: C57
Reading seq #27: C18
Reading seq #28: C27
Reading seq #29: C49
Reading seq #30: C39
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 94 / 94 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 94 / 94 sites (100.0%), 0:00
Counting codons..
3480 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 1: NearlyNeutral
TREE # 1
(24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
74664 bytes for conP, adjusted
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
32
0.045990 0.107459 0.024232 0.107924 0.019434 0.085634 0.062483 0.050869 0.057873 0.066538 0.012894 0.063501 0.102088 0.067242 0.034849 0.081331 0.089595 0.047269 0.047844 0.089213 0.074242 0.049703 0.063148 0.072368 0.077355 0.083602 0.058717 0.011053 0.062607 0.046163 0.077070 0.054828 0.300000 0.867230 0.340324
ntime & nrate & np: 32 2 35
Bounds (np=35):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.945400
np = 35
lnL0 = -594.689663
Iterating by ming2
Initial: fx= 594.689663
x= 0.04599 0.10746 0.02423 0.10792 0.01943 0.08563 0.06248 0.05087 0.05787 0.06654 0.01289 0.06350 0.10209 0.06724 0.03485 0.08133 0.08959 0.04727 0.04784 0.08921 0.07424 0.04970 0.06315 0.07237 0.07736 0.08360 0.05872 0.01105 0.06261 0.04616 0.07707 0.05483 0.30000 0.86723 0.34032
1 h-m-p 0.0000 0.0002 447.7295 ++ 564.198763 m 0.0002 40 | 1/35
2 h-m-p 0.0000 0.0000 4524.4458 ++ 549.998324 m 0.0000 78 | 2/35
3 h-m-p 0.0000 0.0000 8873.1672 ++ 540.493614 m 0.0000 116 | 3/35
4 h-m-p 0.0000 0.0002 475.1077 ++ 521.083093 m 0.0002 154 | 4/35
5 h-m-p 0.0000 0.0001 839.7153 ++ 501.297143 m 0.0001 192 | 5/35
6 h-m-p 0.0000 0.0001 176.8868 ++ 498.832962 m 0.0001 230 | 6/35
7 h-m-p 0.0000 0.0000 570.6160 ++ 497.941758 m 0.0000 268 | 7/35
8 h-m-p 0.0000 0.0000 221670.6280 ++ 495.148661 m 0.0000 306 | 8/35
9 h-m-p 0.0000 0.0000 918.0687 ++ 482.665610 m 0.0000 344 | 9/35
10 h-m-p 0.0000 0.0000 6605.5806 ++ 481.407228 m 0.0000 382 | 10/35
11 h-m-p 0.0000 0.0000 1377.8752 ++ 474.948570 m 0.0000 420 | 11/35
12 h-m-p 0.0000 0.0000 971.9432 ++ 474.460319 m 0.0000 458 | 12/35
13 h-m-p 0.0000 0.0000 9513.7741 ++ 470.559571 m 0.0000 496 | 13/35
14 h-m-p 0.0000 0.0000 1321.8861 ++ 469.703318 m 0.0000 534 | 14/35
15 h-m-p 0.0000 0.0000 2174.8918 ++ 463.929111 m 0.0000 572 | 15/35
16 h-m-p 0.0000 0.0000 1759.6727 ++ 461.885354 m 0.0000 610 | 16/35
17 h-m-p 0.0000 0.0000 993.8484 ++ 458.915737 m 0.0000 648 | 17/35
18 h-m-p 0.0000 0.0000 518.8203 ++ 455.468197 m 0.0000 686 | 18/35
19 h-m-p 0.0000 0.0000 13626.9522 ++ 453.720186 m 0.0000 724 | 19/35
20 h-m-p 0.0000 0.0000 385.4892 ++ 453.050588 m 0.0000 762 | 20/35
21 h-m-p 0.0000 0.0000 37326.3745 ++ 450.495949 m 0.0000 800 | 21/35
22 h-m-p 0.0000 0.0000 323.5432 ++ 450.325886 m 0.0000 838 | 22/35
23 h-m-p 0.0000 0.0000 3738.8332 ++ 446.114774 m 0.0000 876 | 23/35
24 h-m-p 0.0000 0.0000 214.1368 ++ 445.150725 m 0.0000 914 | 24/35
25 h-m-p 0.0000 0.0000 344.1963 ++ 445.097886 m 0.0000 952 | 25/35
26 h-m-p 0.0001 0.0451 8.0582 ++++YYYCC 443.795702 4 0.0218 999 | 25/35
27 h-m-p 0.0067 0.0336 7.9823 YCCCC 443.336490 4 0.0140 1044 | 25/35
28 h-m-p 0.0158 0.0792 4.2083 CCC 443.171391 2 0.0177 1086 | 25/35
29 h-m-p 0.0286 0.1465 2.6103 YCCC 443.098258 3 0.0170 1129 | 25/35
30 h-m-p 0.0796 0.3982 0.4638 YCC 443.069282 2 0.0357 1170 | 25/35
31 h-m-p 0.1071 1.0124 0.1547 CCC 442.980943 2 0.1656 1222 | 25/35
32 h-m-p 0.0399 0.5709 0.6420 +YYYYCCCC 442.696585 7 0.1674 1281 | 25/35
33 h-m-p 0.1636 0.8178 0.2554 YCYCCC 442.503599 5 0.3996 1337 | 25/35
34 h-m-p 0.4152 2.0760 0.1263 +YCCC 442.231393 3 1.2905 1391 | 25/35
35 h-m-p 1.6000 8.0000 0.0267 CYCC 442.069846 3 1.9058 1444 | 25/35
36 h-m-p 0.1090 0.5452 0.0587 ++ 441.972985 m 0.5452 1492 | 26/35
37 h-m-p 0.5399 8.0000 0.0437 YCCC 441.961619 3 0.2789 1545 | 26/35
38 h-m-p 0.0351 3.2919 0.3469 ++YYCC 441.889974 3 0.5248 1598 | 26/35
39 h-m-p 1.6000 8.0000 0.1024 YYC 441.851995 2 1.3291 1647 | 26/35
40 h-m-p 1.6000 8.0000 0.0206 YC 441.845635 1 1.1212 1695 | 26/35
41 h-m-p 1.6000 8.0000 0.0072 CC 441.843891 1 1.7802 1744 | 26/35
42 h-m-p 1.6000 8.0000 0.0050 YC 441.843733 1 1.0942 1792 | 26/35
43 h-m-p 1.6000 8.0000 0.0007 Y 441.843727 0 1.0128 1839 | 26/35
44 h-m-p 1.6000 8.0000 0.0000 Y 441.843727 0 1.0991 1886 | 26/35
45 h-m-p 1.5636 8.0000 0.0000 Y 441.843727 0 0.9547 1933 | 26/35
46 h-m-p 1.6000 8.0000 0.0000 C 441.843727 0 1.6000 1980 | 26/35
47 h-m-p 1.6000 8.0000 0.0000 Y 441.843727 0 0.2560 2027 | 26/35
48 h-m-p 0.3650 8.0000 0.0000 Y 441.843727 0 0.0912 2074 | 26/35
49 h-m-p 0.0966 8.0000 0.0000 --------------.. | 26/35
50 h-m-p 0.0160 8.0000 0.0003 ------------- | 26/35
51 h-m-p 0.0160 8.0000 0.0003 -------------
Out..
lnL = -441.843727
2250 lfun, 6750 eigenQcodon, 144000 P(t)
end of tree file.
Time used: 0:39
Model 2: PositiveSelection
TREE # 1
(24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
32
0.100794 0.087335 0.073798 0.060435 0.035375 0.067563 0.013641 0.096878 0.104039 0.108494 0.104289 0.078992 0.034295 0.029107 0.077920 0.108827 0.090862 0.090643 0.069131 0.106709 0.084676 0.103103 0.037169 0.067875 0.062648 0.062878 0.049405 0.046354 0.057883 0.057487 0.093207 0.039532 0.836746 1.250280 0.291652 0.293755 1.330769
ntime & nrate & np: 32 3 37
Bounds (np=37):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.509427
np = 37
lnL0 = -593.989875
Iterating by ming2
Initial: fx= 593.989875
x= 0.10079 0.08734 0.07380 0.06044 0.03538 0.06756 0.01364 0.09688 0.10404 0.10849 0.10429 0.07899 0.03429 0.02911 0.07792 0.10883 0.09086 0.09064 0.06913 0.10671 0.08468 0.10310 0.03717 0.06787 0.06265 0.06288 0.04940 0.04635 0.05788 0.05749 0.09321 0.03953 0.83675 1.25028 0.29165 0.29375 1.33077
1 h-m-p 0.0000 0.0005 351.9591 +++ 538.621641 m 0.0005 80 | 1/37
2 h-m-p 0.0000 0.0000 4268.7883 ++ 529.847147 m 0.0000 157 | 2/37
3 h-m-p 0.0000 0.0000 1627.7733 ++ 528.157036 m 0.0000 233 | 3/37
4 h-m-p 0.0000 0.0001 278.1647 ++ 525.436824 m 0.0001 308 | 4/37
5 h-m-p 0.0001 0.0009 107.5042 ++ 510.850512 m 0.0009 382 | 5/37
6 h-m-p 0.0000 0.0001 618.3935 ++ 497.859209 m 0.0001 455 | 6/37
7 h-m-p 0.0000 0.0000 2643.9190 ++ 494.310794 m 0.0000 527 | 7/37
8 h-m-p 0.0000 0.0000 250.4509 ++ 494.075150 m 0.0000 598 | 8/37
9 h-m-p 0.0000 0.0002 227.3981 +++ 489.593649 m 0.0002 669 | 9/37
10 h-m-p 0.0000 0.0000 2482.0811 ++ 488.271637 m 0.0000 738 | 10/37
11 h-m-p 0.0000 0.0000 6357.1677 ++ 486.919579 m 0.0000 806 | 11/37
12 h-m-p 0.0000 0.0000 1101.1597 ++ 483.369739 m 0.0000 873 | 12/37
13 h-m-p 0.0000 0.0000 3861.4192 ++ 478.583914 m 0.0000 939 | 13/37
14 h-m-p 0.0000 0.0000 1489.0872 ++ 477.678053 m 0.0000 1004 | 14/37
15 h-m-p 0.0000 0.0000 10886.1731 ++ 473.311105 m 0.0000 1068 | 15/37
16 h-m-p 0.0000 0.0000 1429.0647 ++ 472.633403 m 0.0000 1131 | 16/37
17 h-m-p 0.0000 0.0000 50117.3251 ++ 469.503976 m 0.0000 1193 | 17/37
18 h-m-p 0.0000 0.0000 1280.7304 ++ 469.381167 m 0.0000 1254 | 18/37
19 h-m-p 0.0000 0.0000 49003499.1885 ++ 465.614143 m 0.0000 1314 | 19/37
20 h-m-p 0.0000 0.0000 1062.2064 ++ 463.724141 m 0.0000 1373 | 20/37
21 h-m-p 0.0000 0.0000 28656.2077 ++ 463.398913 m 0.0000 1431 | 21/37
22 h-m-p 0.0000 0.0000 798.4044 ++ 463.328171 m 0.0000 1488 | 22/37
23 h-m-p 0.0000 0.0000 3261.4280 ++ 462.816965 m 0.0000 1544 | 23/37
24 h-m-p 0.0000 0.0000 436.9376 ++ 462.557598 m 0.0000 1599 | 24/37
25 h-m-p 0.0000 0.0000 371.3936 ++ 462.532533 m 0.0000 1653 | 25/37
26 h-m-p 0.0000 0.0045 24.4778 +++CYYYYC 459.787580 5 0.0037 1716 | 25/37
27 h-m-p 0.0053 0.0363 16.8456 +CYYCYCCCC 452.663002 8 0.0301 1782 | 25/37
28 h-m-p 0.0012 0.0061 26.6239 ++ 450.720630 m 0.0061 1834 | 26/37
29 h-m-p 0.0042 0.0211 12.7495 +YYYYCCC 447.402309 6 0.0163 1895 | 26/37
30 h-m-p 0.0030 0.0152 5.7020 +YYCYCCC 446.432749 6 0.0101 1956 | 26/37
31 h-m-p 0.0323 0.2701 1.7846 +YCYYYCCC 443.534560 7 0.1922 2018 | 26/37
32 h-m-p 0.1527 0.7635 0.8002 CCC 443.098354 2 0.2164 2073 | 26/37
33 h-m-p 0.1337 0.8755 1.2955 CCYC 442.751611 3 0.1375 2129 | 26/37
34 h-m-p 0.0858 0.4292 1.1375 CCC 442.576769 2 0.0962 2184 | 26/37
35 h-m-p 0.2859 3.3797 0.3827 +YYYC 442.215874 3 1.0244 2239 | 26/37
36 h-m-p 0.3822 1.9109 0.7536 CCCC 441.873126 3 0.6257 2296 | 26/37
37 h-m-p 0.6273 3.8388 0.7517 CYCC 441.694032 3 0.4725 2352 | 26/37
38 h-m-p 0.4531 4.5664 0.7840 YCCC 441.525534 3 0.7780 2408 | 25/37
39 h-m-p 0.0226 0.1131 26.8461 YCCC 441.499079 3 0.0036 2464 | 25/37
40 h-m-p 0.1156 8.0000 0.8285 ++YCYC 441.278679 3 1.4317 2522 | 25/37
41 h-m-p 1.3123 7.8240 0.9039 CCC 441.104526 2 1.5527 2578 | 25/37
42 h-m-p 1.4053 8.0000 0.9987 YYC 440.981272 2 1.1232 2632 | 25/37
43 h-m-p 1.6000 8.0000 0.4873 CCC 440.907770 2 2.3217 2688 | 25/37
44 h-m-p 1.0218 8.0000 1.1073 YCC 440.882172 2 0.8075 2743 | 25/37
45 h-m-p 1.5339 8.0000 0.5829 YC 440.824935 1 3.1486 2796 | 25/37
46 h-m-p 1.6000 8.0000 0.9226 CYC 440.791778 2 1.6791 2851 | 25/37
47 h-m-p 1.6000 8.0000 0.4278 YCC 440.779345 2 2.7080 2906 | 25/37
48 h-m-p 1.6000 8.0000 0.0986 +CC 440.761521 1 5.5655 2961 | 25/37
49 h-m-p 0.7197 8.0000 0.7626 +YCC 440.719075 2 2.2189 3017 | 25/37
50 h-m-p 1.6000 8.0000 0.4322 +YCCC 440.612956 3 4.7338 3075 | 25/37
51 h-m-p 1.6000 8.0000 1.0125 YC 440.550193 1 2.7902 3128 | 25/37
52 h-m-p 1.6000 8.0000 0.1169 YCC 440.532913 2 1.1850 3183 | 25/37
53 h-m-p 0.1628 8.0000 0.8512 +YC 440.523341 1 1.3068 3237 | 25/37
54 h-m-p 1.6000 8.0000 0.4036 C 440.522150 0 1.6567 3289 | 25/37
55 h-m-p 1.6000 8.0000 0.0579 YC 440.521977 1 0.9812 3342 | 25/37
56 h-m-p 1.6000 8.0000 0.0187 Y 440.521959 0 1.2341 3394 | 25/37
57 h-m-p 1.2476 8.0000 0.0185 C 440.521954 0 1.7229 3446 | 25/37
58 h-m-p 1.6000 8.0000 0.0009 C 440.521954 0 1.8654 3498 | 25/37
59 h-m-p 1.6000 8.0000 0.0006 ++ 440.521952 m 8.0000 3550 | 25/37
60 h-m-p 0.2589 8.0000 0.0201 +Y 440.521941 0 2.2282 3603 | 25/37
61 h-m-p 1.6000 8.0000 0.0199 ++ 440.521858 m 8.0000 3655 | 25/37
62 h-m-p 0.1833 8.0000 0.8666 ++CYC 440.521503 2 2.2294 3712 | 25/37
63 h-m-p 1.6000 8.0000 0.1879 C 440.521442 0 1.7578 3764 | 25/37
64 h-m-p 1.3266 8.0000 0.2490 YC 440.521412 1 2.9801 3817 | 25/37
65 h-m-p 1.6000 8.0000 0.2439 YC 440.521396 1 3.8222 3870 | 25/37
66 h-m-p 1.6000 8.0000 0.3160 C 440.521390 0 2.5329 3922 | 25/37
67 h-m-p 1.6000 8.0000 0.3254 Y 440.521387 0 2.8655 3974 | 25/37
68 h-m-p 1.6000 8.0000 0.3420 C 440.521386 0 2.2461 4026 | 25/37
69 h-m-p 1.6000 8.0000 0.2985 Y 440.521385 0 3.0674 4078 | 25/37
70 h-m-p 1.6000 8.0000 0.3544 C 440.521385 0 2.4785 4130 | 25/37
71 h-m-p 1.6000 8.0000 0.3278 C 440.521385 0 2.4868 4182 | 25/37
72 h-m-p 1.6000 8.0000 0.3415 Y 440.521385 0 2.9833 4234 | 25/37
73 h-m-p 1.6000 8.0000 0.3395 C 440.521385 0 2.1366 4286 | 25/37
74 h-m-p 1.6000 8.0000 0.3603 Y 440.521385 0 3.5240 4338 | 25/37
75 h-m-p 1.6000 8.0000 0.2708 C 440.521385 0 1.6000 4390 | 25/37
76 h-m-p 1.2043 8.0000 0.3598 ++ 440.521385 m 8.0000 4442 | 25/37
77 h-m-p 1.6000 8.0000 0.1650 C 440.521385 0 1.6000 4494 | 25/37
78 h-m-p 1.6000 8.0000 0.1130 ----------------.. | 25/37
79 h-m-p 0.0160 8.0000 0.0001 -Y 440.521385 0 0.0007 4613
Out..
lnL = -440.521385
4614 lfun, 18456 eigenQcodon, 442944 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -447.099072 S = -429.228300 -26.084799
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 2:42
did 20 / 51 patterns 2:42
did 30 / 51 patterns 2:42
did 40 / 51 patterns 2:42
did 50 / 51 patterns 2:42
did 51 / 51 patterns 2:42end of tree file.
Time used: 2:42
Model 7: beta
TREE # 1
(24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
32
0.100446 0.017414 0.107735 0.050973 0.061904 0.038974 0.026766 0.045184 0.017456 0.011940 0.021671 0.104902 0.028220 0.064179 0.105838 0.027308 0.024719 0.014450 0.093237 0.037174 0.011490 0.053016 0.090481 0.032474 0.069647 0.076840 0.054796 0.018157 0.012067 0.090312 0.060112 0.076557 0.871362 0.309144 1.474421
ntime & nrate & np: 32 1 35
Bounds (np=35):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.461213
np = 35
lnL0 = -555.523878
Iterating by ming2
Initial: fx= 555.523878
x= 0.10045 0.01741 0.10773 0.05097 0.06190 0.03897 0.02677 0.04518 0.01746 0.01194 0.02167 0.10490 0.02822 0.06418 0.10584 0.02731 0.02472 0.01445 0.09324 0.03717 0.01149 0.05302 0.09048 0.03247 0.06965 0.07684 0.05480 0.01816 0.01207 0.09031 0.06011 0.07656 0.87136 0.30914 1.47442
1 h-m-p 0.0000 0.0002 378.5121 +++ 532.953166 m 0.0002 76 | 1/35
2 h-m-p 0.0000 0.0000 11356.6940 ++ 532.114861 m 0.0000 149 | 2/35
3 h-m-p 0.0000 0.0000 762.9939 ++ 527.184452 m 0.0000 221 | 3/35
4 h-m-p 0.0000 0.0001 314.3310 ++ 521.257554 m 0.0001 292 | 4/35
5 h-m-p 0.0000 0.0000 451.2271 ++ 520.996703 m 0.0000 362 | 5/35
6 h-m-p 0.0000 0.0001 754.3110 ++ 514.360663 m 0.0001 431 | 6/35
7 h-m-p 0.0000 0.0000 615.8442 ++ 509.829953 m 0.0000 499 | 7/35
8 h-m-p 0.0000 0.0000 1885.2645 ++ 506.198890 m 0.0000 566 | 8/35
9 h-m-p 0.0000 0.0000 405.0659 ++ 505.207966 m 0.0000 632 | 9/35
10 h-m-p 0.0001 0.0003 137.6177 ++ 500.580075 m 0.0003 697 | 10/35
11 h-m-p 0.0000 0.0000 1000791.3213 ++ 495.751373 m 0.0000 761 | 11/35
12 h-m-p 0.0000 0.0000 13573.2053 ++ 494.484085 m 0.0000 824 | 12/35
13 h-m-p 0.0000 0.0000 6299.5269 ++ 484.049522 m 0.0000 886 | 13/35
14 h-m-p 0.0000 0.0000 2711.9485 ++ 481.686359 m 0.0000 947 | 14/35
15 h-m-p 0.0000 0.0000 10180.9707 ++ 480.347137 m 0.0000 1007 | 15/35
16 h-m-p 0.0000 0.0000 35458.5193 ++ 476.319630 m 0.0000 1066 | 16/35
17 h-m-p 0.0000 0.0000 13366.0075 ++ 474.184906 m 0.0000 1124 | 17/35
18 h-m-p 0.0000 0.0000 23421.3818 ++ 471.224679 m 0.0000 1181 | 18/35
19 h-m-p 0.0000 0.0000 5578.8700 ++ 467.795601 m 0.0000 1237 | 19/35
20 h-m-p 0.0000 0.0000 12509.5469 ++ 462.224903 m 0.0000 1292 | 20/35
21 h-m-p 0.0000 0.0000 4385.2835 ++ 461.286069 m 0.0000 1346 | 21/35
22 h-m-p 0.0000 0.0000 2397.9852 ++ 459.912816 m 0.0000 1399 | 22/35
23 h-m-p 0.0000 0.0000 1113.7928 ++ 458.554781 m 0.0000 1451 | 23/35
24 h-m-p 0.0000 0.0000 771.6032 ++ 458.474930 m 0.0000 1502 | 24/35
25 h-m-p 0.0000 0.0000 253.2706 ++ 458.448246 m 0.0000 1552 | 25/35
26 h-m-p 0.0000 0.0097 23.0714 ++++YCCYC 448.553204 4 0.0090 1612 | 25/35
27 h-m-p 0.0185 0.0923 2.0389 +YYYYCYCCCC 445.166648 9 0.0768 1674 | 25/35
28 h-m-p 0.0236 0.1179 2.7936 +YCYCCC 443.631492 5 0.0692 1732 | 25/35
29 h-m-p 0.0305 0.1523 3.6109 YCYCCC 442.975401 5 0.0761 1788 | 25/35
30 h-m-p 0.0699 0.3494 2.0594 CCCC 442.404624 3 0.1058 1842 | 25/35
31 h-m-p 0.0292 0.1459 1.2902 CYYCCC 442.167827 5 0.0694 1899 | 25/35
32 h-m-p 0.0462 0.2309 1.5713 YCCCC 441.999427 4 0.0916 1954 | 25/35
33 h-m-p 0.0355 0.1773 0.8520 +CYC 441.947114 2 0.1383 2006 | 25/35
34 h-m-p 0.9054 4.5270 0.0281 YC 441.938535 1 0.4117 2055 | 25/35
35 h-m-p 0.2934 1.4668 0.0368 YC 441.932565 1 0.6640 2104 | 25/35
36 h-m-p 0.5655 2.8276 0.0103 C
QuantileBeta(0.05, 0.00758, 0.06594) = 4.190148e-161 2000 rounds
C 441.931789 1 0.4793 2154 | 25/35
37 h-m-p 0.4618 2.9821 0.0106 YC 441.930927 1 1.0779 2203 | 25/35
38 h-m-p 0.6119 3.0593 0.0043 YC 441.930853 1 0.3659 2252 | 25/35
39 h-m-p 0.3900 6.6508 0.0040 +YC 441.930787 1 1.2371 2302 | 25/35
40 h-m-p 0.6413 3.2066 0.0052 C 441.930761 0 0.5173 2350 | 25/35
41 h-m-p 1.6000 8.0000 0.0008 Y 441.930755 0 0.9044 2398 | 25/35
42 h-m-p 1.6000 8.0000 0.0002 Y 441.930754 0 1.1449 2446 | 25/35
43 h-m-p 0.4567 8.0000 0.0006 +++ 441.930728 m 8.0000 2495 | 25/35
44 h-m-p 0.2812 1.4061 0.0066 -------------C 441.930728 0 0.0000 2556 | 25/35
45 h-m-p 0.0160 8.0000 0.0024 +++Y 441.930706 0 0.6450 2607 | 25/35
46 h-m-p 1.0031 8.0000 0.0015
QuantileBeta(0.05, 0.00754, 0.05296) = 1.436022e-160 2000 rounds
Y 441.930702 0 0.2508 2655 | 25/35
47 h-m-p 0.6067 8.0000 0.0006 Y 441.930698 0 1.1966 2703 | 25/35
48 h-m-p 1.6000 8.0000 0.0004 C 441.930697 0 1.7222 2751 | 25/35
49 h-m-p 1.6000 8.0000 0.0000 C 441.930697 0 0.5165 2799 | 25/35
50 h-m-p 1.6000 8.0000 0.0000 -C 441.930697 0 0.1229 2848 | 25/35
51 h-m-p 0.1367 8.0000 0.0000 --C 441.930697 0 0.0021 2898 | 25/35
52 h-m-p 0.0160 8.0000 0.0000 -------------.. | 25/35
53 h-m-p 0.0021 1.0570 0.0063 -Y 441.930697 0 0.0001 3006 | 25/35
54 h-m-p 0.0023 1.1614 0.0024 ------C 441.930697 0 0.0000 3060 | 25/35
55 h-m-p 0.0026 1.2841 0.0019 ------------.. | 25/35
56 h-m-p 0.0025 1.2282 0.0028 ----------C 441.930697 0 0.0000 3176 | 25/35
57 h-m-p 0.0001 0.0290 0.1104 ---------.. | 25/35
58 h-m-p 0.0025 1.2282 0.0028 ------------
Out..
lnL = -441.930697
3290 lfun, 36190 eigenQcodon, 1052800 P(t)
end of tree file.
Time used: 7:26
Model 8: beta&w>1
TREE # 1
(24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
1 node(s) used for scaling (Yang 2000 J Mol Evol 51:423-432):
32
0.088433 0.097852 0.072168 0.066453 0.038697 0.069027 0.026850 0.042711 0.020297 0.094761 0.043646 0.020941 0.073462 0.098694 0.042590 0.062648 0.033682 0.028501 0.024518 0.079697 0.032357 0.063202 0.025972 0.099982 0.100868 0.096174 0.064234 0.086118 0.020260 0.042266 0.102189 0.093103 0.797224 0.900000 0.437021 1.824846 1.300000
ntime & nrate & np: 32 2 37
Bounds (np=37):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.797420
np = 37
lnL0 = -557.277670
Iterating by ming2
Initial: fx= 557.277670
x= 0.08843 0.09785 0.07217 0.06645 0.03870 0.06903 0.02685 0.04271 0.02030 0.09476 0.04365 0.02094 0.07346 0.09869 0.04259 0.06265 0.03368 0.02850 0.02452 0.07970 0.03236 0.06320 0.02597 0.09998 0.10087 0.09617 0.06423 0.08612 0.02026 0.04227 0.10219 0.09310 0.79722 0.90000 0.43702 1.82485 1.30000
1 h-m-p 0.0000 0.0003 324.5116 +++ 522.162425 m 0.0003 80 | 1/37
2 h-m-p 0.0000 0.0000 3016.1554 ++ 521.171323 m 0.0000 157 | 2/37
3 h-m-p 0.0000 0.0000 857.8415 ++ 515.541230 m 0.0000 233 | 3/37
4 h-m-p 0.0000 0.0001 161.8310 ++ 513.173596 m 0.0001 308 | 4/37
5 h-m-p 0.0000 0.0000 3868.7285 ++ 509.150213 m 0.0000 382 | 5/37
6 h-m-p 0.0000 0.0000 1006.4644 ++ 503.518651 m 0.0000 455 | 6/37
7 h-m-p 0.0000 0.0000 431.4614 ++ 501.971580 m 0.0000 527 | 7/37
8 h-m-p 0.0000 0.0000 11394.3965 ++ 496.821259 m 0.0000 598 | 8/37
9 h-m-p 0.0000 0.0000 7736.6205 ++ 492.513403 m 0.0000 668 | 9/37
10 h-m-p 0.0000 0.0000 1612.1705 ++ 491.510269 m 0.0000 737 | 10/37
11 h-m-p 0.0000 0.0000 124268.7889 ++ 474.381333 m 0.0000 805 | 11/37
12 h-m-p 0.0000 0.0000 993.4216 ++ 473.913505 m 0.0000 872 | 12/37
13 h-m-p 0.0000 0.0000 37574.0563 ++ 473.119601 m 0.0000 938 | 13/37
14 h-m-p 0.0000 0.0000 1561.4664 ++ 472.129919 m 0.0000 1003 | 14/37
15 h-m-p 0.0000 0.0000 2176665.3462 ++ 470.459887 m 0.0000 1067 | 15/37
16 h-m-p 0.0000 0.0000 2836.7001 ++ 468.605261 m 0.0000 1130 | 16/37
17 h-m-p 0.0000 0.0000 4085114.6714 ++ 467.396050 m 0.0000 1192 | 17/37
18 h-m-p 0.0000 0.0000 2473.5445 ++ 464.418534 m 0.0000 1253 | 18/37
19 h-m-p 0.0000 0.0000 321601.3608 ++ 461.345682 m 0.0000 1313 | 19/37
20 h-m-p 0.0000 0.0000 13331.8819 ++ 458.682064 m 0.0000 1372 | 20/37
21 h-m-p 0.0000 0.0000 67002.3765 ++ 458.287675 m 0.0000 1430 | 21/37
22 h-m-p 0.0000 0.0000 3318.5259 ++ 458.243750 m 0.0000 1487 | 22/37
23 h-m-p 0.0000 0.0000 988.2211 ++ 457.873793 m 0.0000 1543 | 23/37
24 h-m-p 0.0000 0.0000 983.2953 ++ 457.742927 m 0.0000 1598 | 24/37
25 h-m-p 0.0000 0.0000 365.6034 ++ 457.701299 m 0.0000 1652 | 25/37
26 h-m-p 0.0000 0.0006 855.4923 +++ 449.393457 m 0.0006 1706 | 25/37
27 h-m-p 0.0013 0.0063 11.5534 +YYCCCC 446.050833 5 0.0040 1767 | 25/37
28 h-m-p 0.0032 0.0414 14.2862 CYCCC 445.830248 4 0.0022 1826 | 25/37
29 h-m-p 0.0108 0.2510 2.9346 YCCC 445.767529 3 0.0054 1883 | 25/37
30 h-m-p 0.0048 0.1845 3.2653 ++CCCCC 444.703402 4 0.1358 1946 | 25/37
31 h-m-p 0.0025 0.0123 13.1726 ++ 444.376525 m 0.0123 1998 | 26/37
32 h-m-p 0.1483 0.7414 0.2515 +YCYCCC 443.608635 5 0.4303 2059 | 26/37
33 h-m-p 0.0587 0.2935 0.8698 +YCYCCC 442.893247 5 0.1666 2119 | 26/37
34 h-m-p 0.1932 2.3449 0.7504 +YCCC 442.618209 3 0.5290 2176 | 26/37
35 h-m-p 0.3887 1.9434 0.3306 CCCCC 442.507388 4 0.4710 2235 | 26/37
36 h-m-p 0.6964 6.0190 0.2236 +YCCCC 442.180529 4 1.9982 2294 | 26/37
37 h-m-p 1.6000 8.0000 0.2724 CCCC 441.816353 3 2.2218 2351 | 26/37
38 h-m-p 1.0612 8.0000 0.5702
QuantileBeta(0.15, 0.00500, 3.10995) = 7.841793e-161 2000 rounds
CYCCC 441.641729 4 0.8332 2409 | 26/37
39 h-m-p 0.6163 3.0813 0.5980 CCCCC 441.499773 4 0.8666 2468 | 26/37
40 h-m-p 1.6000 8.0000 0.2798
QuantileBeta(0.15, 0.00500, 2.25967) = 1.154678e-160 2000 rounds
CYC 441.404657 2 1.5158 2522 | 26/37
41 h-m-p 1.5677 8.0000 0.2705
QuantileBeta(0.15, 0.00500, 2.33428) = 1.108855e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.22451) = 1.177597e-160 2000 rounds
YC 441.378450 2 1.4507 2576 | 26/37
42 h-m-p 1.6000 8.0000 0.0740
QuantileBeta(0.15, 0.00500, 2.16573) = 1.217988e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33508) = 1.108380e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15564) = 1.225198e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.13246) = 1.242086e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15349) = 1.226745e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14298) = 1.234368e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
C 441.372429 2 1.2505 2631
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15352) = 1.226723e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15328) = 1.226897e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15340) = 1.226810e-160 2000 rounds
| 26/37
43 h-m-p 1.6000 8.0000 0.0509
QuantileBeta(0.15, 0.00500, 2.16699) = 1.217097e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20774) = 1.188850e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17522) = 1.211286e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
C 441.368936 1 2.5513 2683
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17518) = 1.211309e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17494) = 1.211479e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17506) = 1.211394e-160 2000 rounds
| 26/37
44 h-m-p 1.6000 8.0000 0.0319
QuantileBeta(0.15, 0.00500, 2.15181) = 1.227960e-160 2000 rounds
++ 441.352719 m 8.0000 2734 | 26/37
45 h-m-p 0.4667 6.3431 0.5472 +YYC 441.326580 2 1.5164 2788 | 26/37
46 h-m-p 1.6000 8.0000 0.0312 CC 441.319686 1 1.5680 2841 | 26/37
47 h-m-p 1.6000 8.0000 0.0162 C 441.319383 0 1.4117 2892 | 26/37
48 h-m-p 1.6000 8.0000 0.0023 C 441.319342 0 1.7393 2943 | 25/37
49 h-m-p 0.3065 8.0000 0.0129 +YCYC 441.300619 3 2.2828 2999 | 25/37
50 h-m-p 0.0160 8.0000 2.4221 ---C 441.300618 0 0.0001 3054 | 25/37
51 h-m-p 0.0160 8.0000 0.0120 +++++ 441.297714 m 8.0000 3109 | 25/37
52 h-m-p 0.1243 7.0094 0.7695 ++YYCYCYC 441.201771 6 3.6411 3172 | 25/37
53 h-m-p 0.1350 0.6751 4.0664 YYYYC 441.189123 4 0.1293 3228 | 25/37
54 h-m-p 0.7905 4.9552 0.6652 YCYCCC 441.025986 5 1.8628 3288 | 25/37
55 h-m-p 0.3947 1.9735 0.7392 CCC 440.915676 2 0.4303 3344 | 25/37
56 h-m-p 0.5158 7.1405 0.6167 +YYCC 440.879315 3 1.5641 3401 | 25/37
57 h-m-p 1.6000 8.0000 0.4888 +YCC 440.803924 2 4.2630 3457 | 25/37
58 h-m-p 1.6000 8.0000 1.1337 CC 440.727396 1 1.5959 3511 | 25/37
59 h-m-p 0.5812 5.8162 3.1128 YCCC 440.603934 3 1.5176 3568 | 25/37
60 h-m-p 1.6000 8.0000 1.8526 CYC 440.563920 2 1.8930 3623 | 25/37
61 h-m-p 1.6000 8.0000 2.1205 YCCC 440.554262 3 0.8724 3680 | 25/37
62 h-m-p 1.6000 8.0000 0.2713 YC 440.547416 1 3.8877 3733 | 25/37
63 h-m-p 1.6000 8.0000 0.1011 YC 440.539042 1 3.8239 3786 | 25/37
64 h-m-p 1.4064 8.0000 0.2749 CC 440.536085 1 1.6272 3840 | 25/37
65 h-m-p 1.0486 8.0000 0.4267 CC 440.535188 1 1.6293 3894 | 25/37
66 h-m-p 1.6000 8.0000 0.0426 C 440.535096 0 1.4203 3946 | 25/37
67 h-m-p 1.6000 8.0000 0.0291 C 440.535077 0 2.0821 3998 | 25/37
68 h-m-p 1.6000 8.0000 0.0049 C 440.535075 0 1.6131 4050 | 25/37
69 h-m-p 1.6000 8.0000 0.0012 +Y 440.535073 0 4.9100 4103 | 25/37
70 h-m-p 1.6000 8.0000 0.0029 ++ 440.535063 m 8.0000 4155 | 25/37
71 h-m-p 0.2621 8.0000 0.0883 +YC 440.534979 1 2.5833 4209 | 25/37
72 h-m-p 1.6000 8.0000 0.0731 ++ 440.534226 m 8.0000 4261 | 25/37
73 h-m-p 0.1287 8.0000 4.5458 ++CYC 440.528838 2 2.5810 4318 | 25/37
74 h-m-p 1.6000 8.0000 2.4024 CYC 440.526839 2 1.8591 4373 | 25/37
75 h-m-p 1.3925 8.0000 3.2073 +YC 440.525353 1 3.5538 4427 | 25/37
76 h-m-p 1.6000 8.0000 4.1509 +YC 440.524161 1 4.0726 4481 | 25/37
77 h-m-p 1.0768 5.3841 8.4481 YC 440.523318 1 2.6838 4534 | 25/37
78 h-m-p 0.3933 1.9663 11.6003 ++ 440.522791 m 1.9663 4586 | 26/37
79 h-m-p 1.6000 8.0000 1.1088 --------------C 440.522791 0 0.0000 4652 | 26/37
80 h-m-p 0.0160 8.0000 0.0595 ++Y 440.522788 0 0.6247 4705 | 26/37
81 h-m-p 1.6000 8.0000 0.0169 C 440.522788 0 0.4208 4756 | 26/37
82 h-m-p 1.6000 8.0000 0.0005 --------C 440.522788 0 0.0000 4815
Out..
lnL = -440.522788
4816 lfun, 57792 eigenQcodon, 1695232 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -446.397634 S = -429.228147 -35.167035
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 15:13
did 20 / 51 patterns 15:14
did 30 / 51 patterns 15:14
did 40 / 51 patterns 15:14
did 50 / 51 patterns 15:14
did 51 / 51 patterns 15:14end of tree file.
Time used: 15:14
The loglikelihoods for models M1, M2, M7 and M8 are -441.843727 -440.521385 -441.930697 -440.522788 respectively
CLUSTAL W (1.8) multiple sequence alignment (ALTER 1.3.3)
USA_Minnesota442_2014_NA_AML40779_1_2014_03_06_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Ohio444_2014_NA_AML40884_1_2014_03_26_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_NorthCarolina452_2014_NA_AML40856_1_2014_05_06_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
CHN_JS_2014_NS6_AKC54445_1_2014_12_20_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
CHN_HB_2014_NS6_AKC54438_1_2014_12_26_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
CHN_Tianjin_2016_NS6_APG38201_1_2016_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKLHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Michigan448_2014_NA_AML40800_1_2014_04_02_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
KY4813_NS6_AIA60990_1_2014_03_07_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
HKU15_44_NS6_YP_005352834_1_2009_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
IN2847_NS6_AHN16230_1_2014_02_13_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKL
USA_Minnesota455_2014_NA_AML40835_1_2014_05_21_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Illinois273_2014_NA_AML40849_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
PA3148_NS6_AIA60997_1_2014_02_18_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_IL_2014_026PDV_P11_NS6_AKA97941_1_NA_USA_Unknown_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
P1_16_BTL_0115_PDCoV_2016_Lao_NA_AOM53030_1_2016_01_20_Laos_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
PDCoV_Swine_Vietnam_HaNoi6_2015_NS6_APZ76693_1_2015_10_10_Viet_Nam_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKQHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
HKU15_155_NS6_AFD29197_1_2010_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Nebraska209_2014_NA_AML40870_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
OH1987_NS6_AHN16223_1_2014_01_31_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Illinois272_2014_NA_AML40842_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
PDCoV_USA_Illinois136_2014_NS6_AIB07803_1_2014_01_11_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
PDCoV_USA_Illinois133_2014_NS6_AIB07788_1_2014_01_08_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
Michigan_8977_2014_NS6_AIP90489_1_2014_03_17_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
IL2768_NS6_AIA60976_1_2014_02_12_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Indiana453_2014_NA_AML40807_1_2014_05_13_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Nebraska210_2014_NA_AML40877_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
OH11846_NA_ALJ32188_1_2014_05_07_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
PDCoV_USA_Illinois121_2014_NS6_AHL45010_1_2014_01_04_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Minnesota214_2014_NA_AML40786_1_2014_03_14_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
USA_Arkansas61_2015_NA_AML40607_1_2015_03_24_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKI
***************** ****:************************************:
USA_Minnesota442_2014_NA_AML40779_1_2014_03_06_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Ohio444_2014_NA_AML40884_1_2014_03_26_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_NorthCarolina452_2014_NA_AML40856_1_2014_05_06_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
CHN_JS_2014_NS6_AKC54445_1_2014_12_20_China_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
CHN_HB_2014_NS6_AKC54438_1_2014_12_26_China_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
CHN_Tianjin_2016_NS6_APG38201_1_2016_China_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Michigan448_2014_NA_AML40800_1_2014_04_02_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
KY4813_NS6_AIA60990_1_2014_03_07_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
HKU15_44_NS6_YP_005352834_1_2009_China_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
IN2847_NS6_AHN16230_1_2014_02_13_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Minnesota455_2014_NA_AML40835_1_2014_05_21_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Illinois273_2014_NA_AML40849_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
PA3148_NS6_AIA60997_1_2014_02_18_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_IL_2014_026PDV_P11_NS6_AKA97941_1_NA_USA_Unknown_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
P1_16_BTL_0115_PDCoV_2016_Lao_NA_AOM53030_1_2016_01_20_Laos_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
PDCoV_Swine_Vietnam_HaNoi6_2015_NS6_APZ76693_1_2015_10_10_Viet_Nam_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
HKU15_155_NS6_AFD29197_1_2010_China_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Nebraska209_2014_NA_AML40870_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
OH1987_NS6_AHN16223_1_2014_01_31_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Illinois272_2014_NA_AML40842_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
PDCoV_USA_Illinois136_2014_NS6_AIB07803_1_2014_01_11_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
PDCoV_USA_Illinois133_2014_NS6_AIB07788_1_2014_01_08_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
Michigan_8977_2014_NS6_AIP90489_1_2014_03_17_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
IL2768_NS6_AIA60976_1_2014_02_12_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Indiana453_2014_NA_AML40807_1_2014_05_13_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Nebraska210_2014_NA_AML40877_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
OH11846_NA_ALJ32188_1_2014_05_07_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
PDCoV_USA_Illinois121_2014_NS6_AHL45010_1_2014_01_04_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Minnesota214_2014_NA_AML40786_1_2014_03_14_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
USA_Arkansas61_2015_NA_AML40607_1_2015_03_24_USA_Swine_Porcine_coronavirus_HKU15 LINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
**********************************
>USA_Minnesota442_2014_NA_AML40779_1_2014_03_06_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Ohio444_2014_NA_AML40884_1_2014_03_26_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_NorthCarolina452_2014_NA_AML40856_1_2014_05_06_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >CHN_JS_2014_NS6_AKC54445_1_2014_12_20_China_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >CHN_HB_2014_NS6_AKC54438_1_2014_12_26_China_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >CHN_Tianjin_2016_NS6_APG38201_1_2016_China_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCTGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTAGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Michigan448_2014_NA_AML40800_1_2014_04_02_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >KY4813_NS6_AIA60990_1_2014_03_07_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >HKU15_44_NS6_YP_005352834_1_2009_China_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >IN2847_NS6_AHN16230_1_2014_02_13_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAACTTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Minnesota455_2014_NA_AML40835_1_2014_05_21_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Illinois273_2014_NA_AML40849_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >PA3148_NS6_AIA60997_1_2014_02_18_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_IL_2014_026PDV_P11_NS6_AKA97941_1_NA_USA_Unknown_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >P1_16_BTL_0115_PDCoV_2016_Lao_NA_AOM53030_1_2016_01_20_Laos_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCAAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGCGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCACTCCAAGTCATTCTTGAAGATGAATTAAAT >PDCoV_Swine_Vietnam_HaNoi6_2015_NS6_APZ76693_1_2015_10_10_Viet_Nam_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCAGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCAAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >HKU15_155_NS6_AFD29197_1_2010_China_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCCGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGATTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Nebraska209_2014_NA_AML40870_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >OH1987_NS6_AHN16223_1_2014_01_31_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Illinois272_2014_NA_AML40842_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >PDCoV_USA_Illinois136_2014_NS6_AIB07803_1_2014_01_11_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >PDCoV_USA_Illinois133_2014_NS6_AIB07788_1_2014_01_08_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >Michigan_8977_2014_NS6_AIP90489_1_2014_03_17_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >IL2768_NS6_AIA60976_1_2014_02_12_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Indiana453_2014_NA_AML40807_1_2014_05_13_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Nebraska210_2014_NA_AML40877_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGACGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >OH11846_NA_ALJ32188_1_2014_05_07_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >PDCoV_USA_Illinois121_2014_NS6_AHL45010_1_2014_01_04_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Minnesota214_2014_NA_AML40786_1_2014_03_14_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT >USA_Arkansas61_2015_NA_AML40607_1_2015_03_24_USA_Swine_Porcine_coronavirus_HKU15 ATGTGCAACTGCCATCTGCAGCTGCGAGATTTATATAGATTGTGCAATAAGCGGCACATCAGAAGAGAGGATGTTCCTGAGCTTATTGACCCTCTCGTTAAAACTCGCTGTTTTGCTTACAGTCTCGTGGTTCTTGCTAATGCTAATCCAATTGCATTTAGCATACTACCTCGGAAAATTCTTATCAATGGTGAGCCTTTACTGCTTGAATATGGTAGCATATATGGTAAAGACTTTATCATTCGACCATCGCTCCAAGTCATTCTTGAAGATGAATTAAAT
>USA_Minnesota442_2014_NA_AML40779_1_2014_03_06_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Ohio444_2014_NA_AML40884_1_2014_03_26_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_NorthCarolina452_2014_NA_AML40856_1_2014_05_06_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >CHN_JS_2014_NS6_AKC54445_1_2014_12_20_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >CHN_HB_2014_NS6_AKC54438_1_2014_12_26_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >CHN_Tianjin_2016_NS6_APG38201_1_2016_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKLHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Michigan448_2014_NA_AML40800_1_2014_04_02_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >KY4813_NS6_AIA60990_1_2014_03_07_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >HKU15_44_NS6_YP_005352834_1_2009_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >IN2847_NS6_AHN16230_1_2014_02_13_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKLLINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Minnesota455_2014_NA_AML40835_1_2014_05_21_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Illinois273_2014_NA_AML40849_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >PA3148_NS6_AIA60997_1_2014_02_18_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_IL_2014_026PDV_P11_NS6_AKA97941_1_NA_USA_Unknown_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >P1_16_BTL_0115_PDCoV_2016_Lao_NA_AOM53030_1_2016_01_20_Laos_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >PDCoV_Swine_Vietnam_HaNoi6_2015_NS6_APZ76693_1_2015_10_10_Viet_Nam_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKQHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >HKU15_155_NS6_AFD29197_1_2010_China_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Nebraska209_2014_NA_AML40870_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >OH1987_NS6_AHN16223_1_2014_01_31_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Illinois272_2014_NA_AML40842_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >PDCoV_USA_Illinois136_2014_NS6_AIB07803_1_2014_01_11_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >PDCoV_USA_Illinois133_2014_NS6_AIB07788_1_2014_01_08_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >Michigan_8977_2014_NS6_AIP90489_1_2014_03_17_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >IL2768_NS6_AIA60976_1_2014_02_12_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Indiana453_2014_NA_AML40807_1_2014_05_13_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Nebraska210_2014_NA_AML40877_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >OH11846_NA_ALJ32188_1_2014_05_07_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >PDCoV_USA_Illinois121_2014_NS6_AHL45010_1_2014_01_04_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Minnesota214_2014_NA_AML40786_1_2014_03_14_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN >USA_Arkansas61_2015_NA_AML40607_1_2015_03_24_USA_Swine_Porcine_coronavirus_HKU15 MCNCHLQLRDLYRLCNKRHIRREDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
Reading sequence file /data//pss_subsets/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result/original_alignment/codeml/fasta/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result.1
Found 30 sequences of length 282
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 0.4%
Found 2 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 1
Too few informative sites to use normal approximation.
Try doing a permutation test or increasing alignment length
Can also try decreasing windowsize.
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 6 polymorphic sites
**p-Value(s)**
----------
NSS: 1.00e+00 (1000 permutations)
Max Chi^2: 7.63e-01 (1000 permutations)
PHI (Permutation): 1.00e+00 (1000 permutations)
PHI (Normal): --
#NEXUS
[ID: 9222146143]
begin taxa;
dimensions ntax=30;
taxlabels
IL2768_NS6_AIA60976_1_2014_02_12_USA_Swine_Porcine_coronavirus_HKU15
IN2847_NS6_AHN16230_1_2014_02_13_USA_Swine_Porcine_coronavirus_HKU15
KY4813_NS6_AIA60990_1_2014_03_07_USA_Swine_Porcine_coronavirus_HKU15
Michigan_8977_2014_NS6_AIP90489_1_2014_03_17_USA_Swine_Porcine_coronavirus_HKU15
OH11846_NA_ALJ32188_1_2014_05_07_USA_Swine_Porcine_coronavirus_HKU15
OH1987_NS6_AHN16223_1_2014_01_31_USA_Swine_Porcine_coronavirus_HKU15
CHN_HB_2014_NS6_AKC54438_1_2014_12_26_China_Swine_Porcine_coronavirus_HKU15
PA3148_NS6_AIA60997_1_2014_02_18_USA_Swine_Porcine_coronavirus_HKU15
P1_16_BTL_0115_PDCoV_2016_Lao_NA_AOM53030_1_2016_01_20_Laos_Swine_Porcine_coronavirus_HKU15
PDCoV_Swine_Vietnam_HaNoi6_2015_NS6_APZ76693_1_2015_10_10_Viet_Nam_Swine_Porcine_coronavirus_HKU15
PDCoV_USA_Illinois121_2014_NS6_AHL45010_1_2014_01_04_USA_Swine_Porcine_coronavirus_HKU15
PDCoV_USA_Illinois133_2014_NS6_AIB07788_1_2014_01_08_USA_Swine_Porcine_coronavirus_HKU15
PDCoV_USA_Illinois136_2014_NS6_AIB07803_1_2014_01_11_USA_Swine_Porcine_coronavirus_HKU15
USA_Arkansas61_2015_NA_AML40607_1_2015_03_24_USA_Swine_Porcine_coronavirus_HKU15
CHN_JS_2014_NS6_AKC54445_1_2014_12_20_China_Swine_Porcine_coronavirus_HKU15
USA_Illinois272_2014_NA_AML40842_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15
USA_IL_2014_026PDV_P11_NS6_AKA97941_1_NA_USA_Unknown_Porcine_coronavirus_HKU15
USA_Illinois273_2014_NA_AML40849_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15
USA_Indiana453_2014_NA_AML40807_1_2014_05_13_USA_Swine_Porcine_coronavirus_HKU15
USA_Michigan448_2014_NA_AML40800_1_2014_04_02_USA_Swine_Porcine_coronavirus_HKU15
USA_Minnesota214_2014_NA_AML40786_1_2014_03_14_USA_Swine_Porcine_coronavirus_HKU15
USA_Minnesota442_2014_NA_AML40779_1_2014_03_06_USA_Swine_Porcine_coronavirus_HKU15
USA_Minnesota455_2014_NA_AML40835_1_2014_05_21_USA_Swine_Porcine_coronavirus_HKU15
USA_Nebraska209_2014_NA_AML40870_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15
USA_Nebraska210_2014_NA_AML40877_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15
USA_NorthCarolina452_2014_NA_AML40856_1_2014_05_06_USA_Swine_Porcine_coronavirus_HKU15
USA_Ohio444_2014_NA_AML40884_1_2014_03_26_USA_Swine_Porcine_coronavirus_HKU15
CHN_Tianjin_2016_NS6_APG38201_1_2016_China_Swine_Porcine_coronavirus_HKU15
HKU15_155_NS6_AFD29197_1_2010_China_Swine_Porcine_coronavirus_HKU15
HKU15_44_NS6_YP_005352834_1_2009_China_Swine_Porcine_coronavirus_HKU15
;
end;
begin trees;
translate
1 IL2768_NS6_AIA60976_1_2014_02_12_USA_Swine_Porcine_coronavirus_HKU15,
2 IN2847_NS6_AHN16230_1_2014_02_13_USA_Swine_Porcine_coronavirus_HKU15,
3 KY4813_NS6_AIA60990_1_2014_03_07_USA_Swine_Porcine_coronavirus_HKU15,
4 Michigan_8977_2014_NS6_AIP90489_1_2014_03_17_USA_Swine_Porcine_coronavirus_HKU15,
5 OH11846_NA_ALJ32188_1_2014_05_07_USA_Swine_Porcine_coronavirus_HKU15,
6 OH1987_NS6_AHN16223_1_2014_01_31_USA_Swine_Porcine_coronavirus_HKU15,
7 CHN_HB_2014_NS6_AKC54438_1_2014_12_26_China_Swine_Porcine_coronavirus_HKU15,
8 PA3148_NS6_AIA60997_1_2014_02_18_USA_Swine_Porcine_coronavirus_HKU15,
9 P1_16_BTL_0115_PDCoV_2016_Lao_NA_AOM53030_1_2016_01_20_Laos_Swine_Porcine_coronavirus_HKU15,
10 PDCoV_Swine_Vietnam_HaNoi6_2015_NS6_APZ76693_1_2015_10_10_Viet_Nam_Swine_Porcine_coronavirus_HKU15,
11 PDCoV_USA_Illinois121_2014_NS6_AHL45010_1_2014_01_04_USA_Swine_Porcine_coronavirus_HKU15,
12 PDCoV_USA_Illinois133_2014_NS6_AIB07788_1_2014_01_08_USA_Swine_Porcine_coronavirus_HKU15,
13 PDCoV_USA_Illinois136_2014_NS6_AIB07803_1_2014_01_11_USA_Swine_Porcine_coronavirus_HKU15,
14 USA_Arkansas61_2015_NA_AML40607_1_2015_03_24_USA_Swine_Porcine_coronavirus_HKU15,
15 CHN_JS_2014_NS6_AKC54445_1_2014_12_20_China_Swine_Porcine_coronavirus_HKU15,
16 USA_Illinois272_2014_NA_AML40842_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15,
17 USA_IL_2014_026PDV_P11_NS6_AKA97941_1_NA_USA_Unknown_Porcine_coronavirus_HKU15,
18 USA_Illinois273_2014_NA_AML40849_1_2014_02_23_USA_Swine_Porcine_coronavirus_HKU15,
19 USA_Indiana453_2014_NA_AML40807_1_2014_05_13_USA_Swine_Porcine_coronavirus_HKU15,
20 USA_Michigan448_2014_NA_AML40800_1_2014_04_02_USA_Swine_Porcine_coronavirus_HKU15,
21 USA_Minnesota214_2014_NA_AML40786_1_2014_03_14_USA_Swine_Porcine_coronavirus_HKU15,
22 USA_Minnesota442_2014_NA_AML40779_1_2014_03_06_USA_Swine_Porcine_coronavirus_HKU15,
23 USA_Minnesota455_2014_NA_AML40835_1_2014_05_21_USA_Swine_Porcine_coronavirus_HKU15,
24 USA_Nebraska209_2014_NA_AML40870_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15,
25 USA_Nebraska210_2014_NA_AML40877_1_2014_02_05_USA_Swine_Porcine_coronavirus_HKU15,
26 USA_NorthCarolina452_2014_NA_AML40856_1_2014_05_06_USA_Swine_Porcine_coronavirus_HKU15,
27 USA_Ohio444_2014_NA_AML40884_1_2014_03_26_USA_Swine_Porcine_coronavirus_HKU15,
28 CHN_Tianjin_2016_NS6_APG38201_1_2016_China_Swine_Porcine_coronavirus_HKU15,
29 HKU15_155_NS6_AFD29197_1_2010_China_Swine_Porcine_coronavirus_HKU15,
30 HKU15_44_NS6_YP_005352834_1_2009_China_Swine_Porcine_coronavirus_HKU15
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:3.970361e-04,7:3.951377e-04,12:4.025295e-04,24:4.291152e-04,25:3.903228e-04,30:4.203632e-04,(2:9.821370e-04,3:4.348935e-04,4:4.091739e-04,5:3.963058e-04,6:4.055982e-04,8:3.912352e-04,11:3.965380e-04,13:3.844451e-04,14:3.949098e-04,15:4.156208e-04,16:4.105210e-04,17:4.118667e-04,18:4.135807e-04,19:4.421451e-04,20:3.791781e-04,21:4.024354e-04,22:4.219680e-04,23:4.062789e-04,26:4.254058e-04,27:4.074487e-04,28:1.640625e-03,29:1.571498e-03)0.948:1.003739e-03,(9:1.586019e-03,10:1.017941e-03)0.924:1.012577e-03);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:3.970361e-04,7:3.951377e-04,12:4.025295e-04,24:4.291152e-04,25:3.903228e-04,30:4.203632e-04,(2:9.821370e-04,3:4.348935e-04,4:4.091739e-04,5:3.963058e-04,6:4.055982e-04,8:3.912352e-04,11:3.965380e-04,13:3.844451e-04,14:3.949098e-04,15:4.156208e-04,16:4.105210e-04,17:4.118667e-04,18:4.135807e-04,19:4.421451e-04,20:3.791781e-04,21:4.024354e-04,22:4.219680e-04,23:4.062789e-04,26:4.254058e-04,27:4.074487e-04,28:1.640625e-03,29:1.571498e-03):1.003739e-03,(9:1.586019e-03,10:1.017941e-03):1.012577e-03);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -471.49 -486.06
2 -471.23 -483.96
--------------------------------------
TOTAL -471.35 -485.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.042151 0.000238 0.016822 0.071223 0.040234 1450.57 1461.43 1.000
r(A<->C){all} 0.258675 0.012177 0.062585 0.474071 0.249302 89.15 92.46 1.000
r(A<->G){all} 0.206307 0.011463 0.033201 0.421811 0.191887 77.30 78.77 1.002
r(A<->T){all} 0.097765 0.004288 0.002584 0.227955 0.084308 131.55 135.51 1.001
r(C<->G){all} 0.152767 0.009051 0.008037 0.337393 0.136455 87.29 94.61 1.000
r(C<->T){all} 0.169334 0.008304 0.023298 0.352702 0.155434 65.37 78.38 1.001
r(G<->T){all} 0.115152 0.006079 0.006809 0.272199 0.098304 76.43 91.67 1.001
pi(A){all} 0.280122 0.000655 0.226439 0.327264 0.279794 771.04 802.53 1.002
pi(C){all} 0.208239 0.000553 0.162933 0.253367 0.207324 670.24 766.57 1.000
pi(G){all} 0.188624 0.000510 0.142772 0.231314 0.188297 875.58 905.70 1.000
pi(T){all} 0.323015 0.000745 0.266821 0.373418 0.323932 735.79 780.48 1.002
alpha{1,2} 0.746129 0.717937 0.000327 2.329224 0.466153 614.90 647.20 1.000
alpha{3} 1.167151 1.061900 0.002381 3.152054 0.892139 512.64 753.98 1.000
pinvar{all} 0.487687 0.065718 0.022602 0.879274 0.504656 216.68 229.71 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
CODONML (in paml version 4.9h, March 2018) /data/fasta_checked/NH_NS6_ANA78467_1_2015_12_30_China_Unknown_Porcine_coronavirus_HKU15.result.1
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 30 ls = 94
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 1
CTG 3 3 3 3 3 4 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 5 5 5 5 5 5 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 3 3 3 3 3 4
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 2 2 2 3 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 3 3 3 3 2 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 6 5 5 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 4 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 5 5 5 5 5 5 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 3 3 3 3 3 3
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 2 3 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 3 3 2 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 1 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 0 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 3 2
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 1 1 1 2 1 1 | CGG 2 2 2 1 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 5 5 5 5 5 5 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 3 3 3 3 2 3
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 2 2 3 3 | Asp GAT 3 3 3 3 4 3 | Gly GGT 3 3 2 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 2 3 3 1 3 | GGC 0 0 1 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 2 2 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 3 3 2 2 3 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 5 5 5 5 5 5 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 3 3 3 3 3 3
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 2 2 3 2 3 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 3 3 3 2 3 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 4 4 4 4 4 4 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 5 5 5 5 5 5 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 3 3 3 3 3 3
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 2 3 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 1 1 1 1 1 1 | GCG 0 0 0 0 0 0 | GAG 3 2 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: C52
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#2: C59
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#3: C58
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#4: C4
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#5: C2
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.20213 A:0.22340 G:0.13830
Average T:0.32624 C:0.20567 A:0.27660 G:0.19149
#6: C6
position 1: T:0.17021 C:0.27660 A:0.30851 G:0.24468
position 2: T:0.38298 C:0.12766 A:0.30851 G:0.18085
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32979 C:0.19858 A:0.28014 G:0.19149
#7: C48
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#8: C13
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#9: C9
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.20213 A:0.22340 G:0.13830
Average T:0.32624 C:0.20567 A:0.27660 G:0.19149
#10: C11
position 1: T:0.17021 C:0.29787 A:0.28723 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20567 A:0.27305 G:0.19504
#11: C54
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#12: C43
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#13: C20
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#14: C42
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#15: C21
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.41489 C:0.21277 A:0.24468 G:0.12766
Average T:0.31915 C:0.20922 A:0.28369 G:0.18794
#16: C26
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.31915 G:0.18085
position 3: T:0.42553 C:0.20213 A:0.23404 G:0.13830
Average T:0.32270 C:0.20567 A:0.28369 G:0.18794
#17: C8
position 1: T:0.17021 C:0.29787 A:0.28723 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.44681 C:0.18085 A:0.22340 G:0.14894
Average T:0.32979 C:0.20213 A:0.27305 G:0.19504
#18: C56
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.20213 A:0.22340 G:0.13830
Average T:0.32624 C:0.20567 A:0.27660 G:0.19149
#19: C19
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#20: C40
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#21: C30
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#22: C29
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.20213 A:0.22340 G:0.13830
Average T:0.32624 C:0.20567 A:0.27660 G:0.19149
#23: C15
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#24: C10
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.20213 A:0.22340 G:0.13830
Average T:0.32624 C:0.20567 A:0.27660 G:0.19149
#25: C45
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#26: C57
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.20213 A:0.22340 G:0.13830
Average T:0.32624 C:0.20567 A:0.27660 G:0.19149
#27: C18
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#28: C27
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#29: C49
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
#30: C39
position 1: T:0.17021 C:0.28723 A:0.29787 G:0.24468
position 2: T:0.37234 C:0.12766 A:0.30851 G:0.19149
position 3: T:0.43617 C:0.19149 A:0.22340 G:0.14894
Average T:0.32624 C:0.20213 A:0.27660 G:0.19504
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 90 | Ser S TCT 0 | Tyr Y TAT 90 | Cys C TGT 30
TTC 0 | TCC 0 | TAC 30 | TGC 90
Leu L TTA 90 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 29 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 151 | Pro P CCT 120 | His H CAT 30 | Arg R CGT 0
CTC 90 | CCC 0 | CAC 30 | CGC 30
CTA 30 | CCA 60 | Gln Q CAA 30 | CGA 60
CTG 91 | CCG 0 | CAG 31 | CGG 58
------------------------------------------------------------------------------
Ile I ATT 149 | Thr T ACT 30 | Asn N AAT 150 | Ser S AGT 30
ATC 90 | ACC 0 | AAC 30 | AGC 60
ATA 60 | ACA 0 | Lys K AAA 90 | Arg R AGA 90
Met M ATG 30 | ACG 0 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 90 | Ala A GCT 88 | Asp D GAT 91 | Gly G GGT 89
GTC 30 | GCC 0 | GAC 67 | GGC 1
GTA 0 | GCA 32 | Glu E GAA 90 | GGA 0
GTG 30 | GCG 0 | GAG 82 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17021 C:0.28759 A:0.29752 G:0.24468
position 2: T:0.37270 C:0.12766 A:0.30887 G:0.19078
position 3: T:0.43546 C:0.19433 A:0.22447 G:0.14574
Average T:0.32612 C:0.20319 A:0.27695 G:0.19374
Model 1: NearlyNeutral (2 categories)
TREE # 1: (24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
check convergence..
lnL(ntime: 32 np: 35): -441.843727 +0.000000
31..24 31..5 31..22 31..18 31..26 31..9 31..32 32..10 32..8 32..23 32..27 32..19 32..13 32..28 32..21 32..30 32..4 32..20 32..14 32..12 32..25 32..7 32..29 32..1 32..11 32..3 32..2 32..6 32..17 31..33 33..15 33..16
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.011124 0.011167 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.022295 0.022261 0.011083 0.022348 0.011070 0.836746 0.867271 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.111448
(24: 0.000004, 5: 0.000004, 22: 0.000004, 18: 0.000004, 26: 0.000004, 9: 0.000004, (10: 0.011167, 8: 0.000004, 23: 0.000004, 27: 0.000004, 19: 0.000004, 13: 0.000004, 28: 0.000004, 21: 0.000004, 30: 0.000004, 4: 0.000004, 20: 0.000004, 14: 0.000004, 12: 0.000004, 25: 0.000004, 7: 0.000004, 29: 0.000004, 1: 0.000004, 11: 0.000004, 3: 0.000004, 2: 0.000004, 6: 0.022295, 17: 0.022261): 0.011124, (15: 0.022348, 16: 0.011070): 0.011083);
(C10: 0.000004, C2: 0.000004, C29: 0.000004, C56: 0.000004, C57: 0.000004, C9: 0.000004, (C11: 0.011167, C13: 0.000004, C15: 0.000004, C18: 0.000004, C19: 0.000004, C20: 0.000004, C27: 0.000004, C30: 0.000004, C39: 0.000004, C4: 0.000004, C40: 0.000004, C42: 0.000004, C43: 0.000004, C45: 0.000004, C48: 0.000004, C49: 0.000004, C52: 0.000004, C54: 0.000004, C58: 0.000004, C59: 0.000004, C6: 0.022295, C8: 0.022261): 0.011124, (C21: 0.022348, C26: 0.011070): 0.011083);
Detailed output identifying parameters
kappa (ts/tv) = 0.83675
MLEs of dN/dS (w) for site classes (K=2)
p: 0.86727 0.13273
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..24 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
31..5 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
31..22 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
31..18 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
31..26 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
31..9 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
31..32 0.011 224.3 57.7 0.1327 0.0016 0.0120 0.4 0.7
32..10 0.011 224.3 57.7 0.1327 0.0016 0.0120 0.4 0.7
32..8 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..23 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..27 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..19 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..13 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..28 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..21 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..30 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..4 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..20 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..14 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..12 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..25 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..7 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..29 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..1 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..11 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..3 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..2 0.000 224.3 57.7 0.1327 0.0000 0.0000 0.0 0.0
32..6 0.022 224.3 57.7 0.1327 0.0032 0.0240 0.7 1.4
32..17 0.022 224.3 57.7 0.1327 0.0032 0.0239 0.7 1.4
31..33 0.011 224.3 57.7 0.1327 0.0016 0.0119 0.4 0.7
33..15 0.022 224.3 57.7 0.1327 0.0032 0.0240 0.7 1.4
33..16 0.011 224.3 57.7 0.1327 0.0016 0.0119 0.4 0.7
Time used: 0:39
Model 2: PositiveSelection (3 categories)
TREE # 1: (24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
lnL(ntime: 32 np: 37): -440.521385 +0.000000
31..24 31..5 31..22 31..18 31..26 31..9 31..32 32..10 32..8 32..23 32..27 32..19 32..13 32..28 32..21 32..30 32..4 32..20 32..14 32..12 32..25 32..7 32..29 32..1 32..11 32..3 32..2 32..6 32..17 31..33 33..15 33..16
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.014982 0.014941 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.030317 0.030162 0.015661 0.030970 0.013177 0.871362 0.988545 0.000000 0.084636 22.009706
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.150310
(24: 0.000004, 5: 0.000004, 22: 0.000004, 18: 0.000004, 26: 0.000004, 9: 0.000004, (10: 0.014941, 8: 0.000004, 23: 0.000004, 27: 0.000004, 19: 0.000004, 13: 0.000004, 28: 0.000004, 21: 0.000004, 30: 0.000004, 4: 0.000004, 20: 0.000004, 14: 0.000004, 12: 0.000004, 25: 0.000004, 7: 0.000004, 29: 0.000004, 1: 0.000004, 11: 0.000004, 3: 0.000004, 2: 0.000004, 6: 0.030317, 17: 0.030162): 0.014982, (15: 0.030970, 16: 0.013177): 0.015661);
(C10: 0.000004, C2: 0.000004, C29: 0.000004, C56: 0.000004, C57: 0.000004, C9: 0.000004, (C11: 0.014941, C13: 0.000004, C15: 0.000004, C18: 0.000004, C19: 0.000004, C20: 0.000004, C27: 0.000004, C30: 0.000004, C39: 0.000004, C4: 0.000004, C40: 0.000004, C42: 0.000004, C43: 0.000004, C45: 0.000004, C48: 0.000004, C49: 0.000004, C52: 0.000004, C54: 0.000004, C58: 0.000004, C59: 0.000004, C6: 0.030317, C8: 0.030162): 0.014982, (C21: 0.030970, C26: 0.013177): 0.015661);
Detailed output identifying parameters
kappa (ts/tv) = 0.87136
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98855 0.00000 0.01145
w: 0.08464 1.00000 22.00971
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..24 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..5 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..22 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..18 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..26 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..9 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..32 0.015 223.9 58.1 0.3358 0.0035 0.0106 0.8 0.6
32..10 0.015 223.9 58.1 0.3358 0.0035 0.0105 0.8 0.6
32..8 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..23 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..27 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..19 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..13 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..28 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..21 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..30 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..4 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..20 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..14 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..12 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..25 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..7 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..29 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..1 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..11 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..3 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..2 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..6 0.030 223.9 58.1 0.3358 0.0072 0.0214 1.6 1.2
32..17 0.030 223.9 58.1 0.3358 0.0071 0.0213 1.6 1.2
31..33 0.016 223.9 58.1 0.3358 0.0037 0.0110 0.8 0.6
33..15 0.031 223.9 58.1 0.3358 0.0073 0.0218 1.6 1.3
33..16 0.013 223.9 58.1 0.3358 0.0031 0.0093 0.7 0.5
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C52)
Pr(w>1) post mean +- SE for w
18 R 0.992** 21.842
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C52)
Pr(w>1) post mean +- SE for w
18 R 0.850 5.371 +- 3.204
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.696 0.232 0.057 0.012 0.002 0.000 0.000 0.000 0.000 0.000
w2: 0.121 0.105 0.102 0.100 0.099 0.097 0.096 0.095 0.093 0.092
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.015
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.010 0.060
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.002 0.008 0.040 0.201
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.009 0.028 0.131 0.482
sum of density on p0-p1 = 1.000000
Time used: 2:42
Model 7: beta (10 categories)
TREE # 1: (24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
check convergence..
lnL(ntime: 32 np: 35): -441.930697 +0.000000
31..24 31..5 31..22 31..18 31..26 31..9 31..32 32..10 32..8 32..23 32..27 32..19 32..13 32..28 32..21 32..30 32..4 32..20 32..14 32..12 32..25 32..7 32..29 32..1 32..11 32..3 32..2 32..6 32..17 31..33 33..15 33..16
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.010965 0.011007 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.021983 0.021944 0.010919 0.022034 0.010908 0.797224 0.007194 0.052982
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.109861
(24: 0.000004, 5: 0.000004, 22: 0.000004, 18: 0.000004, 26: 0.000004, 9: 0.000004, (10: 0.011007, 8: 0.000004, 23: 0.000004, 27: 0.000004, 19: 0.000004, 13: 0.000004, 28: 0.000004, 21: 0.000004, 30: 0.000004, 4: 0.000004, 20: 0.000004, 14: 0.000004, 12: 0.000004, 25: 0.000004, 7: 0.000004, 29: 0.000004, 1: 0.000004, 11: 0.000004, 3: 0.000004, 2: 0.000004, 6: 0.021983, 17: 0.021944): 0.010965, (15: 0.022034, 16: 0.010908): 0.010919);
(C10: 0.000004, C2: 0.000004, C29: 0.000004, C56: 0.000004, C57: 0.000004, C9: 0.000004, (C11: 0.011007, C13: 0.000004, C15: 0.000004, C18: 0.000004, C19: 0.000004, C20: 0.000004, C27: 0.000004, C30: 0.000004, C39: 0.000004, C4: 0.000004, C40: 0.000004, C42: 0.000004, C43: 0.000004, C45: 0.000004, C48: 0.000004, C49: 0.000004, C52: 0.000004, C54: 0.000004, C58: 0.000004, C59: 0.000004, C6: 0.021983, C8: 0.021944): 0.010965, (C21: 0.022034, C26: 0.010908): 0.010919);
Detailed output identifying parameters
kappa (ts/tv) = 0.79722
Parameters in M7 (beta):
p = 0.00719 q = 0.05298
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00685 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..24 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
31..5 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
31..22 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
31..18 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
31..26 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
31..9 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
31..32 0.011 224.8 57.2 0.1007 0.0013 0.0129 0.3 0.7
32..10 0.011 224.8 57.2 0.1007 0.0013 0.0130 0.3 0.7
32..8 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..23 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..27 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..19 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..13 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..28 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..21 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..30 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..4 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..20 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..14 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..12 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..25 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..7 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..29 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..1 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..11 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..3 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..2 0.000 224.8 57.2 0.1007 0.0000 0.0000 0.0 0.0
32..6 0.022 224.8 57.2 0.1007 0.0026 0.0259 0.6 1.5
32..17 0.022 224.8 57.2 0.1007 0.0026 0.0258 0.6 1.5
31..33 0.011 224.8 57.2 0.1007 0.0013 0.0128 0.3 0.7
33..15 0.022 224.8 57.2 0.1007 0.0026 0.0259 0.6 1.5
33..16 0.011 224.8 57.2 0.1007 0.0013 0.0128 0.3 0.7
Time used: 7:26
Model 8: beta&w>1 (11 categories)
TREE # 1: (24, 5, 22, 18, 26, 9, (10, 8, 23, 27, 19, 13, 28, 21, 30, 4, 20, 14, 12, 25, 7, 29, 1, 11, 3, 2, 6, 17), (15, 16)); MP score: 10
lnL(ntime: 32 np: 37): -440.522788 +0.000000
31..24 31..5 31..22 31..18 31..26 31..9 31..32 32..10 32..8 32..23 32..27 32..19 32..13 32..28 32..21 32..30 32..4 32..20 32..14 32..12 32..25 32..7 32..29 32..1 32..11 32..3 32..2 32..6 32..17 31..33 33..15 33..16
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.014972 0.014935 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.030295 0.030144 0.015649 0.030950 0.013169 0.872858 0.988550 9.229783 99.000000 21.993778
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.150215
(24: 0.000004, 5: 0.000004, 22: 0.000004, 18: 0.000004, 26: 0.000004, 9: 0.000004, (10: 0.014935, 8: 0.000004, 23: 0.000004, 27: 0.000004, 19: 0.000004, 13: 0.000004, 28: 0.000004, 21: 0.000004, 30: 0.000004, 4: 0.000004, 20: 0.000004, 14: 0.000004, 12: 0.000004, 25: 0.000004, 7: 0.000004, 29: 0.000004, 1: 0.000004, 11: 0.000004, 3: 0.000004, 2: 0.000004, 6: 0.030295, 17: 0.030144): 0.014972, (15: 0.030950, 16: 0.013169): 0.015649);
(C10: 0.000004, C2: 0.000004, C29: 0.000004, C56: 0.000004, C57: 0.000004, C9: 0.000004, (C11: 0.014935, C13: 0.000004, C15: 0.000004, C18: 0.000004, C19: 0.000004, C20: 0.000004, C27: 0.000004, C30: 0.000004, C39: 0.000004, C4: 0.000004, C40: 0.000004, C42: 0.000004, C43: 0.000004, C45: 0.000004, C48: 0.000004, C49: 0.000004, C52: 0.000004, C54: 0.000004, C58: 0.000004, C59: 0.000004, C6: 0.030295, C8: 0.030144): 0.014972, (C21: 0.030950, C26: 0.013169): 0.015649);
Detailed output identifying parameters
kappa (ts/tv) = 0.87286
Parameters in M8 (beta&w>1):
p0 = 0.98855 p = 9.22978 q = 99.00000
(p1 = 0.01145) w = 21.99378
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09885 0.09885 0.09885 0.09885 0.09885 0.09885 0.09885 0.09885 0.09885 0.09885 0.01145
w: 0.04608 0.05804 0.06604 0.07291 0.07944 0.08610 0.09331 0.10176 0.11293 0.13320 21.99378
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
31..24 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..5 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..22 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..18 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..26 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..9 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
31..32 0.015 223.9 58.1 0.3358 0.0035 0.0106 0.8 0.6
32..10 0.015 223.9 58.1 0.3358 0.0035 0.0105 0.8 0.6
32..8 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..23 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..27 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..19 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..13 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..28 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..21 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..30 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..4 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..20 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..14 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..12 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..25 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..7 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..29 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..1 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..11 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..3 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..2 0.000 223.9 58.1 0.3358 0.0000 0.0000 0.0 0.0
32..6 0.030 223.9 58.1 0.3358 0.0072 0.0214 1.6 1.2
32..17 0.030 223.9 58.1 0.3358 0.0071 0.0213 1.6 1.2
31..33 0.016 223.9 58.1 0.3358 0.0037 0.0110 0.8 0.6
33..15 0.031 223.9 58.1 0.3358 0.0073 0.0218 1.6 1.3
33..16 0.013 223.9 58.1 0.3358 0.0031 0.0093 0.7 0.5
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C52)
Pr(w>1) post mean +- SE for w
18 R 0.992** 21.810
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: C52)
Pr(w>1) post mean +- SE for w
18 R 0.901 5.213 +- 3.068
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.007 0.056 0.936
p : 0.664 0.210 0.074 0.029 0.012 0.006 0.003 0.002 0.001 0.001
q : 0.000 0.013 0.038 0.064 0.088 0.112 0.136 0.159 0.183 0.206
ws: 0.134 0.120 0.115 0.109 0.102 0.095 0.089 0.084 0.079 0.075
Time used: 15:14
Model 1: NearlyNeutral -441.843727 Model 2: PositiveSelection -440.521385 Model 7: beta -441.930697 Model 8: beta&w>1 -440.522788 Model 2 vs 1 2.644684 Model 8 vs 7 2.815818
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken. # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
