--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Dec 09 11:30:22 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/444/ZnT49B-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4362.19         -4373.01
2      -4362.40         -4375.57
--------------------------------------
TOTAL    -4362.29         -4374.95
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.286611    0.000765    0.235601    0.341319    0.285458   1147.69   1278.94    1.000
r(A<->C){all}   0.081064    0.000349    0.045553    0.116885    0.079697   1065.30   1141.72    1.001
r(A<->G){all}   0.278694    0.001328    0.210849    0.352033    0.277160    925.28    965.40    1.001
r(A<->T){all}   0.089283    0.000445    0.051329    0.132520    0.087853   1061.86   1086.01    1.000
r(C<->G){all}   0.047937    0.000205    0.022945    0.076772    0.046798    989.37   1006.86    1.000
r(C<->T){all}   0.427071    0.001735    0.344708    0.507146    0.426576    874.24    920.59    1.000
r(G<->T){all}   0.075951    0.000311    0.045063    0.112046    0.074829    723.35    914.46    1.000
pi(A){all}      0.249956    0.000087    0.232861    0.268965    0.249924   1236.60   1241.04    1.000
pi(C){all}      0.238799    0.000087    0.220217    0.257084    0.238972   1266.21   1335.09    1.001
pi(G){all}      0.273614    0.000092    0.253872    0.290716    0.273585   1232.97   1294.49    1.000
pi(T){all}      0.237632    0.000088    0.219234    0.256388    0.237360   1118.22   1202.15    1.000
alpha{1,2}      0.048431    0.001059    0.000160    0.107905    0.044469   1086.80   1129.26    1.000
alpha{3}        2.865465    0.836222    1.366352    4.780826    2.721522   1469.60   1485.30    1.000
pinvar{all}     0.470439    0.002553    0.373245    0.569207    0.472644    996.25   1237.73    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-4152.361755
Model 2: PositiveSelection	-4152.361755
Model 0: one-ratio	-4173.762567
Model 3: discrete	-4151.954868
Model 7: beta	-4152.150637
Model 8: beta&w>1	-4152.06586


Model 0 vs 1	42.80162399999972

Model 2 vs 1	0.0

Model 8 vs 7	0.16955400000006193
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAVGL
GESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAPVI
PLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQEP
PMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRRLR
DYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYSGS
HSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSLIS
GVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLVVA
INELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACMGL
SSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEKIN
SALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDLAK
LLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIRHV
DLEILoo
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKYDLPPVTKVAASAINLRSTSTGVATGAVGLGESSG
SVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAPVIPLKRP
RFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQEPPMTVY
WRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQNLFTVKRRLRDYRRE
MGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYSGSHSMFA
EVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSLISGVGIF
CVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLVVAINELK
RSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACMGLSSYTG
SPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEKINSALEA
DVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDLAKLLTTV
RSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIRHVDLEIL
ooooooo
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAVGL
GESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAPVI
PIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQEP
PMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRRLR
DYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYSGS
HSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSLIS
GVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLVVA
INELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACMGL
SSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEKIN
SALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDLAK
LLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIRHV
DLEILoo
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDSKKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILSIS
TTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAVGL
GSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAPVI
PPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQEP
PMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQNLFTVKRRLR
DYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYSGS
HSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSLIS
GVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLVVA
INELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACMGL
SSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEKIN
SALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDLAK
LLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIRHV
DLEILoo
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=664 

C1              MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
C2              MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
C3              MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
C4              MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
C5              MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
                *************:*:*******:**:*.  .*:*:** :** ******.

C1              TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKE--TKNFEVKTTKGILS
C2              MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKE--TKNFEVKTTKGILS
C3              MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRE--TKNFEVKTTKGILS
C4              TFLQFRCSANDS--KKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
C5              MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
                 *********.*  *:::*:*:*:*:*.****:*  **************

C1              ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
C2              ISTTIEDSKINEIVFEKYDLPPVTKV-----AASAINLRSTSTGVATGAV
C3              ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
C4              ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
C5              ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
                ***************** ****::**     .*.******:* .:. ***

C1              GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
C2              GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
C3              GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
C4              GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
C5              GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
                *** .***::******.*..*** :.*.*:*:*.*  ** ******* **

C1              VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
C2              VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
C3              VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
C4              VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
C5              VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
                **. ********************************* ************

C1              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
C2              EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQNLFTVKRR
C3              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
C4              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQNLFTVKRR
C5              EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
                *****************:***************:****************

C1              LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
C2              LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
C3              LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
C4              LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
C5              LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
                **************************************************

C1              GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
C2              GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
C3              GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
C4              GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
C5              GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
                **************************************************

C1              ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
C2              ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
C3              ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
C4              ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
C5              ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
                **************************************************

C1              VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
C2              VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
C3              VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
C4              VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
C5              VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
                ***************:******************************.***

C1              GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
C2              GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
C3              GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
C4              GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
C5              GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
                **************************************************

C1              INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
C2              INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
C3              INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
C4              INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
C5              INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
                **************************************************

C1              AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
C2              AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
C3              AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
C4              AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
C5              AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
                ********.*****************************************

C1              HVDLEILoo-----
C2              HVDLEILooooooo
C3              HVDLEILoo-----
C4              HVDLEILoo-----
C5              HVDLEIL-------
                *******       




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  657 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  657 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13408]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [13408]--->[13306]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/444/ZnT49B-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.370 Mb, Max= 30.921 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILoo-----
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKYDLPPVTKV-----AASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILooooooo
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILoo-----
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDS--KKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILoo-----
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL-------

FORMAT of file /tmp/tmp8951868038358119526aln Not Supported[FATAL:T-COFFEE]
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILoo-----
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKYDLPPVTKV-----AASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILooooooo
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPRE--TKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILoo-----
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDS--KKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEILoo-----
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL-------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:664 S:99 BS:664
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.55 C1	 C2	 97.55
TOP	    1    0	 97.55 C2	 C1	 97.55
BOT	    0    2	 97.87 C1	 C3	 97.87
TOP	    2    0	 97.87 C3	 C1	 97.87
BOT	    0    3	 94.05 C1	 C4	 94.05
TOP	    3    0	 94.05 C4	 C1	 94.05
BOT	    0    4	 93.13 C1	 C5	 93.13
TOP	    4    0	 93.13 C5	 C1	 93.13
BOT	    1    2	 98.47 C2	 C3	 98.47
TOP	    2    1	 98.47 C3	 C2	 98.47
BOT	    1    3	 93.38 C2	 C4	 93.38
TOP	    3    1	 93.38 C4	 C2	 93.38
BOT	    1    4	 93.54 C2	 C5	 93.54
TOP	    4    1	 93.54 C5	 C2	 93.54
BOT	    2    3	 93.74 C3	 C4	 93.74
TOP	    3    2	 93.74 C4	 C3	 93.74
BOT	    2    4	 93.59 C3	 C5	 93.59
TOP	    4    2	 93.59 C5	 C3	 93.59
BOT	    3    4	 94.50 C4	 C5	 94.50
TOP	    4    3	 94.50 C5	 C4	 94.50
AVG	 0	 C1	  *	 95.65
AVG	 1	 C2	  *	 95.73
AVG	 2	 C3	  *	 95.92
AVG	 3	 C4	  *	 93.92
AVG	 4	 C5	  *	 93.69
TOT	 TOT	  *	 94.98
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTGGG
C2              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
C3              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
C4              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCATCACTTCGG
C5              ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
                ***************************************** ***** **

C1              AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGACGGCAGGAACCCTTGGA
C2              AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
C3              AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
C4              AAAGGCTTTTAGCCAGTGCACCTTGCGCCACGATGCCAGAATCTCCTGGA
C5              AAAGGCTTTTAGCCAGTGCTCCTTGCGCCAAGATGCCAGTTATCCCTGGA
                *******************:****.** **.** * *** ::  * ****

C1              GGCGGCATGACGGCGAGGCATTCAAACTACAGCCGTGGAAGCGACCAAGC
C2              GGCGGCATGACGGCGAGGCATTCAAAATACAGCCGTGGAAGCGACCAAGC
C3              GGCGGCATGACGGCGAGGCGTTTAAACTACAGCCGTGGAAGCGACCAGAC
C4              GGAGGAATGACGGCGAGTCATTCAAACTACAACCGTGGAAGCGACCAAGC
C5              AGCGGAATGACGGCGTGTCATTCAAGCAACAACCGTGGAAGCGCCCAAGC
                .*.**.*********:* *.** **..:***.***********.***..*

C1              ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGGCAGTGATTCCAAGAAGGA
C2              ATGTTCCTTCAGTTTCGCTGCAGCGCCAATGACAGTGATTCCAAGAAGGA
C3              ATGTTCCTTCAGTTTCGCTGCAGTGCCAATGGCAGTGATTCCAAGAAGGA
C4              ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGATTCG------AAAAAGGA
C5              ATGTTCCTGCAGTTTCGCTGTAGCGCCAATGACAGTGATTCCAAGAGGGA
                * ****** *********** ** *******. :        **.*.***

C1              AAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAAGG
C2              GAAACCTGTGCAGAAGGAGACCACCGCTGGTCCAGTTGCCAAGCCAAAGG
C3              TAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAGGG
C4              CCAACCTTTGCAGGAGGAGTCCACCACTGGTTCAGTTGCCAAACCAAAGG
C5              CAAACCTCTGCAGGAGGAGTCCACCGCTGGTGCAGTCGCCAAACCAAAGG
                 .***** *****.***** *****.***** **** *****.****.**

C1              AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGCATCCTGTCT
C2              AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
C3              AA------ACGAAAAATTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
C4              AGAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTCTCT
C5              AAAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTGTCT
                *.      ******** **************.******** ***** ***

C1              ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
C2              ATCAGCACCACCATCGAGGACTCCAAAATTAACGAAATTGTGTTTGAAAA
C3              ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
C4              ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
C5              ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
                **************************.********.**************

C1              ATCCGATCTGCCACCGGTAACGAAGGTGAAAGAGCCGGTTTTGGCCGCAA
C2              ATACGATCTACCACCGGTAACCAAGGTG---------------GCCGCAA
C3              ATCCGATCTACCACCGGTAACCAAGGTGAAAGAGCCGGTTTTGGCCGCAA
C4              ATCCGATCTGCCACCGCTAGCCAAGGTGAAAGAGCCGGTATTGGCCGCAG
C5              ATCCGATCTACCGCCGCTAACCAAGGTGAAAGAGCCAGCATTGGTCGCAG
                **.******.**.*** **.* ******               * ****.

C1              GTGCCATTAATCTACGTTCTACGTCTACTGGAGTAGCAACTGGTGCTGTA
C2              GTGCCATTAATCTACGATCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
C3              GTGCCATTAATCTACGTTCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
C4              GGGCTATCAATCTGCGTTCCAGCTCCATTGCAGTAGCAGCTGGTGCTGTG
C5              GGGCCATCAATCTACGTTCCAGCTCCACTGCATTGGGAATTGGTGCTGTG
                * ** ** *****.**:** *  ** * ** * *.* *. ********* 

C1              GGATTGGGAGAGAGCTCTGGTTCTGTTATGAATCCTCCTGAAACAGTGAA
C2              GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
C3              GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
C4              GGATTGGGAAGTGGCTCTGGTTCAATTATGAATCCACCTGAAACAGTGAC
C5              GGATTGGGAGGGGCTTCTGGCTCCATTTTGAATCCTCCTGAAACAGTGAC
                *********.. .  ***** ** .**:*.*****:*************.

C1              AAGCGCACCTAAAAATTCTCCGTCTGGTGCTGTGCTAGCTGAAAAGGCGG
C2              AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
C3              AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
C4              AAGCCCAACTAAAAATTCTTTAGCTGGTGCTGTGCTAGCTGAAAAGGCAG
C5              AAGCGCAACTAAAAATTCTCCGGCTGATGCTGTGCTATCTGAAAGGGCCG
                **** ** ***********  . ***.***** **** ******.*** *

C1              GAGAAGGTATTCGAACATCCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
C2              GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
C3              GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
C4              GAGAGGCTAGTCGAACAGGCCCACCTGCAGAGGTGACGCCTCCAGCGCCT
C5              CAGAAGTTAGTCGAACATGCCCACCTGCAGAGGTGACGCCTCTAGCGCCT
                 .**.* ** *******  ***************.******* *******

C1              GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
C2              GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
C3              GTGATTCCTATAAAGCGACCCCGATTCGATTATCGAGCTTCCCTAGAGCG
C4              GTGATTCCTCCAAAGCGACCACGTTTCGATTATCGTGCTTCCCTAGAGCG
C5              GTGATTTCTCCAAAGCGACCCCGTTTCGATTATCGTGCTTCCCTAGAGCG
                ****** **. *********.**:***********:**************

C1              CAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGTTGACCGCTG
C2              AAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGCTGACCGCCG
C3              CAACTTTGTGACCCCCAACCGCGCCATCAGCGATTTCTTGCTAACCGCCG
C4              CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGCTGACCGCTG
C5              CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGTTGACCGCTG
                .******************.* ****************** *.***** *

C1              CTCAACTCGAAAGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
C2              CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
C3              CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
C4              CTCAACTCGAGAATCTGCCCAAGATTAAGCGAAGATCGCCGTACGAGCAG
C5              CTCAACTGGAGTGTCTGCCCAAAATTAAGCGGAGATCGCCGTACGAGCAG
                ******* **.:.*********.** *****.******************

C1              GAGCCACCCATGACTGTCTACTGGCGACGGGATGTGGAGGCTAAGGCCGT
C2              GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAGGCTAAGGCCGT
C3              GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAAGCTAAGGCAGT
C4              GAGCCACCCATGACTGTTTACTGGCGTCGCGATGTGGAAGCTAAGGCTGT
C5              GAGCCGCCCATGACGGTCTACTGGCGACGCGATGTTGAAGCTAAGGCTGT
                **.**.******** ** ********:** ** ** **.******** **

C1              CGAAGTGTGGGGGTCCAAGGAAAATCTGTTGCGGGAGCGACTCAAGCGGG
C2              AGACGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
C3              AGAAGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
C4              AGAAGTGTGGGGATCCAAGGAAAACCTGTTGCGGGAACGACTTAAGCGGG
C5              GGAGGTGTGGGGATCCAAGGAAAACCTGTTACGGGAACGACTCAAGCGGG
                 ** ** *****.** *****.** *****.*****.***** *******

C1              AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTTAAACGGCGG
C2              AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
C3              AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
C4              ATGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
C5              AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
                * ************************************** *********

C1              TTGCGTGACTACCGCAGGGAAATGGGATCTCGAACCAAAGTAATGCTCGA
C2              TTGCGTGACTACCGCAGGGAGATGGGATCTCGAACCAAAGTAATGCTCGA
C3              TTGCGCGACTACCGCAGGGAGATGGGATCTCGAACCAAAGTAATGCTCGA
C4              TTGCGCGACTACCGCAGAGAGATGGGTTCTCGAACCAAAGTAATGCTCGA
C5              TTGCGCGACTACCGCAGGGAGATGGGATCTCGGACCAAAGTAATGCTCGA
                ***** ***********.**.*****:*****.*****************

C1              CAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATCG
C2              CAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATCG
C3              CAACAGAAAGGAGTCTGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATTG
C4              CAACAGAAAGGAGTCGGAGAAGTCCGGACAAGTGGTTGCCACCGCCATCG
C5              CAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATCG
                *************** ***********.******** *********** *

C1              CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
C2              CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
C3              CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
C4              CTATCAATGCAGCTAATTTGCTTTTCAAAGCAGGAGGCTGGCTGTACAGC
C5              CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
                ************* **************.******** ************

C1              GGTTCTCACAGCATGTTTGCAGAAGTTATCCATTCTTTGGCCGACTTAAT
C2              GGTTCTCACAGCATGTTTGCAGAGGTTATCCATTCTTTGGCCGACTTAAT
C3              GGTTCCCACAGCATGTTTGCGGAGGTTATCCATTCTTTGGCCGACTTAAT
C4              GGTTCTCACAGCATGTTTGCGGAGGTTATCCATTCATTGGCCGACCTAAT
C5              GGTTCCCACAGCATGTTTGCGGAGGTTATCCATTCTTTGGCCGACCTAAT
                ***** **************.**.***********:********* ****

C1              CAACCAGCTCATCCTCGCGTTTGGCATCTACAAGTCCTCTCAGAGTCCCG
C2              CAACCAGCTCATCCTCGCCTTTGGCATCTACAAGTCCTCTCAGAGTCCCG
C3              CAACCAGCTCATCCTCGCATTTGGCATCTACAAGTCCTCTCAGAGTCCCG
C4              CAACCAGCTAATTCTCGCCTTTGGCATCTACAAGTCCTCTCAGAGTCCGG
C5              CAACCAGCTCATTCTCGCCTTTGGCATTTACAAGTCATCTCAGAGTCCGG
                *********.** ***** ******** ********.*********** *

C1              ATATAGATCATCCATATGGATACATGAACATGCGATATGTTTCCTCGCTG
C2              ATATAGATCATCCTTATGGATATATGAACATGAGATATGTTTCCTCGCTG
C3              ATATAGATCATCCTTATGGATATATGAACATGAGATATGTTTCCTCGCTG
C4              ACATAGATCATCCTTATGGATACATGAACATGCGTTATGTATCCTCGCTG
C5              ACATAGATCATCCTTATGGATACATGAACATGCGATATGTGTCCTCGCTG
                * ***********:******** *********.*:***** *********

C1              ATTTCGGGCGTTGGCATCTTTTGCGTTGGCTGTGGCCTGTCCATATACCA
C2              ATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGGCCTGTCCATCTACCA
C3              ATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGGCCTGTCCATCTACCA
C4              ATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGGCCTGTCCATCTACCA
C5              ATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGGGCTGTCCATCTACCA
                ************** **.***** **:******** ********.*****

C1              CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTATTTTGGG
C2              CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTGTTTTGGG
C3              CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTGTTTTGGG
C4              CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTGTTTTGGG
C5              CGGTATTGATGGCATTCTCCATCCGGAACCCATAACCGATCTGTTTTGGG
                ************************************.*****.*******

C1              TGTACTGTATCTTGATGGGATCATTAGTTTCTGAGGGAGCCACATTGGTG
C2              TGTATTGTATCTTGATGGGATCATTGGTTTCTGAGGGAGCCACTTTGGTG
C3              TGTACTGCATCTTGATGGGATCATTAGTTTCTGAGGGAGCCACTTTGGTG
C4              TATACTGCATCTTAATGGGATCGCTGGTTTCTGAGGGAGCTACTTTGGTG
C5              TGTATTGCATCTTAATGGGATCGTTAGTTTCTGAGGGAGCCACTCTGGTG
                *.** ** *****.********. *.************** **: *****

C1              GTGGCCATTAATGAGCTTAAGCGATCGGCTAAGGAAAACAATATGTCCTT
C2              GTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGAAAACAATATGTCCTT
C3              GTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGAAAACAATATGTCCTT
C4              GTAGCCATCAATGAGCTTAAACGATCGGCCAAGGAAAACAATATGACCTT
C5              GTGGCCATCAATGAGCTTAAACGATCGGCCAAGGAAAACAATATGACCTT
                **.***** ***********.******** ***************:****

C1              TAAGGATTATGTGATTTCTGGCAAGGATCCGTGCGTGAATGTGGTGCTGT
C2              TAAGGATTATGTGATTTCTGGCAAGGATCCGTGCGTGAATGTGGTGCTAT
C3              TAAGGATTATGTCATTTCTGGCAAGGATCCGTGCGTGAATGTGGTGCTGT
C4              TAAAGATTATGTGATTTCTGGCAAGGATCCGTGCGTAAATGTGGTGCTGT
C5              TAAAGATTATGTAATTTCTGGCAAGGATCCATGCGTGAATGTGGTGCTGT
                ***.******** *****************.*****.***********.*

C1              GTGAAGACGCTGCAGCGGTAACTGGCGTTATGGTGGCTGCAGCTTGCATG
C2              GTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTGGCTGCAGCTTGCATG
C3              GTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTGGCGGCAGCTTGCATG
C4              GCGAAGATGCTGCAGCTGTAACTGGCGTTATGGTGGCTGGAGCCTGTATG
C5              GCGAAGACGCTGCAGCTGTAACTGGCGTTATGGTGGCTGGAGCTTGTATG
                * ***** ******** *********** ******** * *** ** ***

C1              GGATTAAGTAGTTACACAGGATCGCCCATCTTCGACGCCGCTGGTTCACT
C2              GGATTAAGTAGTTACACAGGATCGCCCATCTTTGACGCCGCTGGATCACT
C3              GGATTAAGTAGTTACACAGGATCGCCCATCTTTGACGCCGCTGGATCACT
C4              GGATTAAGTAGTTACACAGGATCCCCCATTTTCGACGCCGCTGGATCACT
C5              GGATTGAGTAGTTACACAGGATCGCCCATCTTCGACGCCGCTGGATCACT
                *****.***************** ***** ** ***********:*****

C1              GGTTATAGGTGCTCTTCTGGGCGCTGTGGCCTCTTTTATTATTTATACAA
C2              GGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCTTTATCATTTATACAA
C3              GGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCTTTATCATTTATACAA
C4              GGTTATAGGTGCTCTTCTGGGCGCTGTGGCTTCTTTTATCATTTATACAA
C5              GGTTATAGGTGCTCTCCTGGGTGCTGTGGCCTCTTTTATCATTTATACAA
                *************** ***** ** ***** ** ***** **********

C1              ATGCCAATGCGTTGGTGGGGATATCCATTGCTTCCGAGCGCCTAGAAAAG
C2              ATGCTAATGCGCTGGTGGGGATATCCATTGCTTCCGAGCGCCTAGAAAAG
C3              ATGCTAATGCGCTGGTGGGGATATCCATCGCTTCCGAGCGCCTAGAAAAG
C4              ATGCTAATGCGCTGGTAGGGATATCCATTGCTTCCGAGCGCCTAGAAAAA
C5              ATGCCAATGCGCTGGTAGGAATATCCATTGCATCCGAGCGCCTAGAAAAG
                **** ****** ****.**.******** **:*****************.

C1              ATTAACTCTGCTTTGGAGGCTGATGTAATGATCAGAGCGATTTACGATGT
C2              ATTAATTCTGCCTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
C3              ATTAATTCTGCTTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
C4              ATTAATTCTGCTTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
C5              ATAAATTCTGCTTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
                **:** ***** **************.***********************

C1              CAAGGGAATCGATATTGGCAATGCTCGGGTTCGGTATAAGGCTGAGCTCG
C2              CAAGGGAATCGACATTGGCAATGCTCGGGTTCGGTATAAGGCTGAGCTCG
C3              CAAGGGAATCGACATTGGCAACGCTCGGGTTCGGTATAAGGCTGAGCTCG
C4              CAAGGGAATCGATATTGGCAACGCTCGGGTTCGGTATAAGGCTGAACTCG
C5              CAAGGGAATCGATATTGGCAACGCTCGAGTTCGTTATAAGGCTGAGCTTG
                ************ ******** *****.***** ***********.** *

C1              ACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTGGACAAACAGGATCTC
C2              ACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTGGACAAACAGGATCTC
C3              ACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTGGACAAACAGGATCTC
C4              ATTTTGACGGCCGTGAGTTGACGCGTTCGTATCTGGACAAACAGGATCTC
C5              ACTTCGATGGCCGTGAGCTGACGCGTTCGTATCTGGATAAACAGGATCTC
                * ** ** ********* **** ************** ************

C1              GCAAAACTGCTCACGACGGTTCGAGGCTTTCAAAAGGTTGAGGATCTGGA
C2              GCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAAGGTTGAGGATCTGGA
C3              GCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAAGGTTGAGGATCTGGA
C4              GCAAAACTGCTCACTACTGTTCGAGGCTTTCAAAAGGTTGAGGATCTGGA
C5              GCAAAACTGCTCACAACTGTTCGAGGCTTTCAAAAGGTTGAGGATCTGGA
                ************** ** ******.**** ********************

C1              GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGCG
C2              GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGTG
C3              GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGTG
C4              GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGCG
C5              GAGCTTTTTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGTG
                ******* **************************************** *

C1              AAATTGATCGCATTGAGATGAACTTGCGGACACAATTCCCGGAAATACGC
C2              AAATTGATCGCATTGAGATGAATCTGCGGACACAATTTCCGGAAATACGC
C3              AAATTGATCGCATTGAGATGAATCTGCGGACACAATTTCCGGAAATACGC
C4              AAATTGATCGCATTGAGATGAACTTGCGGACACAATTCCCGGAAATACGT
C5              AGATTGATCGCATTGAGATGAACCTGCGGACACAATTTCCGGAAATACGT
                *.********************  ************* *********** 

C1              CATGTGGACCTGGAAATACTC---------------------
C2              CATGTGGACCTGGAAATACTC---------------------
C3              CATGTGGACCTGGAAATACTC---------------------
C4              CATGTGGACCTGGAAATACTC---------------------
C5              CATGTGGACCTGGAAATACTC---------------------
                *********************                     



>C1
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTGGG
AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGACGGCAGGAACCCTTGGA
GGCGGCATGACGGCGAGGCATTCAAACTACAGCCGTGGAAGCGACCAAGC
ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGGCAGTGATTCCAAGAAGGA
AAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAAGG
AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGCATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
ATCCGATCTGCCACCGGTAACGAAGGTGAAAGAGCCGGTTTTGGCCGCAA
GTGCCATTAATCTACGTTCTACGTCTACTGGAGTAGCAACTGGTGCTGTA
GGATTGGGAGAGAGCTCTGGTTCTGTTATGAATCCTCCTGAAACAGTGAA
AAGCGCACCTAAAAATTCTCCGTCTGGTGCTGTGCTAGCTGAAAAGGCGG
GAGAAGGTATTCGAACATCCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGTTGACCGCTG
CTCAACTCGAAAGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
GAGCCACCCATGACTGTCTACTGGCGACGGGATGTGGAGGCTAAGGCCGT
CGAAGTGTGGGGGTCCAAGGAAAATCTGTTGCGGGAGCGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTTAAACGGCGG
TTGCGTGACTACCGCAGGGAAATGGGATCTCGAACCAAAGTAATGCTCGA
CAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATCG
CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
GGTTCTCACAGCATGTTTGCAGAAGTTATCCATTCTTTGGCCGACTTAAT
CAACCAGCTCATCCTCGCGTTTGGCATCTACAAGTCCTCTCAGAGTCCCG
ATATAGATCATCCATATGGATACATGAACATGCGATATGTTTCCTCGCTG
ATTTCGGGCGTTGGCATCTTTTGCGTTGGCTGTGGCCTGTCCATATACCA
CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTATTTTGGG
TGTACTGTATCTTGATGGGATCATTAGTTTCTGAGGGAGCCACATTGGTG
GTGGCCATTAATGAGCTTAAGCGATCGGCTAAGGAAAACAATATGTCCTT
TAAGGATTATGTGATTTCTGGCAAGGATCCGTGCGTGAATGTGGTGCTGT
GTGAAGACGCTGCAGCGGTAACTGGCGTTATGGTGGCTGCAGCTTGCATG
GGATTAAGTAGTTACACAGGATCGCCCATCTTCGACGCCGCTGGTTCACT
GGTTATAGGTGCTCTTCTGGGCGCTGTGGCCTCTTTTATTATTTATACAA
ATGCCAATGCGTTGGTGGGGATATCCATTGCTTCCGAGCGCCTAGAAAAG
ATTAACTCTGCTTTGGAGGCTGATGTAATGATCAGAGCGATTTACGATGT
CAAGGGAATCGATATTGGCAATGCTCGGGTTCGGTATAAGGCTGAGCTCG
ACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTGGACAAACAGGATCTC
GCAAAACTGCTCACGACGGTTCGAGGCTTTCAAAAGGTTGAGGATCTGGA
GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGCG
AAATTGATCGCATTGAGATGAACTTGCGGACACAATTCCCGGAAATACGC
CATGTGGACCTGGAAATACTC---------------------
>C2
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
GGCGGCATGACGGCGAGGCATTCAAAATACAGCCGTGGAAGCGACCAAGC
ATGTTCCTTCAGTTTCGCTGCAGCGCCAATGACAGTGATTCCAAGAAGGA
GAAACCTGTGCAGAAGGAGACCACCGCTGGTCCAGTTGCCAAGCCAAAGG
AA------ACGAAAAACTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAAATTAACGAAATTGTGTTTGAAAA
ATACGATCTACCACCGGTAACCAAGGTG---------------GCCGCAA
GTGCCATTAATCTACGATCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
GTGATTCCTCTAAAGCGACCCCGATTCGATTATCGTGCTTCCCTAGAGCG
AAACTTTGTGACCCCCAACCGGGCCATCAGCGATTTCTTGCTGACCGCCG
CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAGGCTAAGGCCGT
AGACGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
TTGCGTGACTACCGCAGGGAGATGGGATCTCGAACCAAAGTAATGCTCGA
CAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATCG
CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
GGTTCTCACAGCATGTTTGCAGAGGTTATCCATTCTTTGGCCGACTTAAT
CAACCAGCTCATCCTCGCCTTTGGCATCTACAAGTCCTCTCAGAGTCCCG
ATATAGATCATCCTTATGGATATATGAACATGAGATATGTTTCCTCGCTG
ATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGGCCTGTCCATCTACCA
CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTGTTTTGGG
TGTATTGTATCTTGATGGGATCATTGGTTTCTGAGGGAGCCACTTTGGTG
GTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGAAAACAATATGTCCTT
TAAGGATTATGTGATTTCTGGCAAGGATCCGTGCGTGAATGTGGTGCTAT
GTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTGGCTGCAGCTTGCATG
GGATTAAGTAGTTACACAGGATCGCCCATCTTTGACGCCGCTGGATCACT
GGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCTTTATCATTTATACAA
ATGCTAATGCGCTGGTGGGGATATCCATTGCTTCCGAGCGCCTAGAAAAG
ATTAATTCTGCCTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
CAAGGGAATCGACATTGGCAATGCTCGGGTTCGGTATAAGGCTGAGCTCG
ACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTGGACAAACAGGATCTC
GCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAAGGTTGAGGATCTGGA
GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGTG
AAATTGATCGCATTGAGATGAATCTGCGGACACAATTTCCGGAAATACGC
CATGTGGACCTGGAAATACTC---------------------
>C3
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
AAAGGCTTTTAGCCAGTGCTCCTTACGTCAAGATGCCAGGAACCCTTGGA
GGCGGCATGACGGCGAGGCGTTTAAACTACAGCCGTGGAAGCGACCAGAC
ATGTTCCTTCAGTTTCGCTGCAGTGCCAATGGCAGTGATTCCAAGAAGGA
TAAACCTGTGCAGGAGGAGGCCACCGCTGGTCCAGTTGCCAAGCCAAGGG
AA------ACGAAAAATTTTGAGGTGAAGACCACAAAGGGTATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAAATTAACGAGATTGTGTTTGAAAA
ATCCGATCTACCACCGGTAACCAAGGTGAAAGAGCCGGTTTTGGCCGCAA
GTGCCATTAATCTACGTTCTACCTCCACTGGAGTAGCAACTGGTGCTGTT
GGATTGGGAGAGAGTTCTGGTTCCGTTATAAATCCTCCTGAAACAGTGAA
AAGCGCAGCTAAAAATTCTCCGGCTGGTGCTGCGCTAGCTGAAAAGGCAG
GCGAAGGTATTCGAACATGCCCACCTGCAGAGGTAACGCCTCCAGCGCCT
GTGATTCCTATAAAGCGACCCCGATTCGATTATCGAGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACCGCGCCATCAGCGATTTCTTGCTAACCGCCG
CTCAACTCGAATGTCTGCCCAAGATCAAGCGGAGATCGCCGTACGAGCAG
GAACCACCCATGACTGTATACTGGCGACGCGACGTTGAAGCTAAGGCAGT
AGAAGTTTGGGGGTCTAAGGAGAACCTGTTGCGGGAGCGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
TTGCGCGACTACCGCAGGGAGATGGGATCTCGAACCAAAGTAATGCTCGA
CAACAGAAAGGAGTCTGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATTG
CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
GGTTCCCACAGCATGTTTGCGGAGGTTATCCATTCTTTGGCCGACTTAAT
CAACCAGCTCATCCTCGCATTTGGCATCTACAAGTCCTCTCAGAGTCCCG
ATATAGATCATCCTTATGGATATATGAACATGAGATATGTTTCCTCGCTG
ATTTCGGGCGTTGGTATCTTTTGTGTAGGCTGTGGCCTGTCCATCTACCA
CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTGTTTTGGG
TGTACTGCATCTTGATGGGATCATTAGTTTCTGAGGGAGCCACTTTGGTG
GTGGCCATTAATGAGCTTAAGCGATCGGCCAAGGAAAACAATATGTCCTT
TAAGGATTATGTCATTTCTGGCAAGGATCCGTGCGTGAATGTGGTGCTGT
GTGAAGACGCTGCAGCGGTAACTGGCGTCATGGTGGCGGCAGCTTGCATG
GGATTAAGTAGTTACACAGGATCGCCCATCTTTGACGCCGCTGGATCACT
GGTTATAGGTGCTCTCCTGGGCGCCGTGGCCTCCTTTATCATTTATACAA
ATGCTAATGCGCTGGTGGGGATATCCATCGCTTCCGAGCGCCTAGAAAAG
ATTAATTCTGCTTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
CAAGGGAATCGACATTGGCAACGCTCGGGTTCGGTATAAGGCTGAGCTCG
ACTTTGACGGCCGTGAGCTGACCCGTTCGTATCTGGACAAACAGGATCTC
GCAAAACTGCTCACGACGGTTCGAAGCTTCCAAAAGGTTGAGGATCTGGA
GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGTG
AAATTGATCGCATTGAGATGAATCTGCGGACACAATTTCCGGAAATACGC
CATGTGGACCTGGAAATACTC---------------------
>C4
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCATCACTTCGG
AAAGGCTTTTAGCCAGTGCACCTTGCGCCACGATGCCAGAATCTCCTGGA
GGAGGAATGACGGCGAGTCATTCAAACTACAACCGTGGAAGCGACCAAGC
ACGTTCCTTCAGTTTCGCTGCAGCGCCAATGATTCG------AAAAAGGA
CCAACCTTTGCAGGAGGAGTCCACCACTGGTTCAGTTGCCAAACCAAAGG
AGAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTCTCT
ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
ATCCGATCTGCCACCGCTAGCCAAGGTGAAAGAGCCGGTATTGGCCGCAG
GGGCTATCAATCTGCGTTCCAGCTCCATTGCAGTAGCAGCTGGTGCTGTG
GGATTGGGAAGTGGCTCTGGTTCAATTATGAATCCACCTGAAACAGTGAC
AAGCCCAACTAAAAATTCTTTAGCTGGTGCTGTGCTAGCTGAAAAGGCAG
GAGAGGCTAGTCGAACAGGCCCACCTGCAGAGGTGACGCCTCCAGCGCCT
GTGATTCCTCCAAAGCGACCACGTTTCGATTATCGTGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGCTGACCGCTG
CTCAACTCGAGAATCTGCCCAAGATTAAGCGAAGATCGCCGTACGAGCAG
GAGCCACCCATGACTGTTTACTGGCGTCGCGATGTGGAAGCTAAGGCTGT
AGAAGTGTGGGGATCCAAGGAAAACCTGTTGCGGGAACGACTTAAGCGGG
ATGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
TTGCGCGACTACCGCAGAGAGATGGGTTCTCGAACCAAAGTAATGCTCGA
CAACAGAAAGGAGTCGGAGAAGTCCGGACAAGTGGTTGCCACCGCCATCG
CTATCAATGCAGCTAATTTGCTTTTCAAAGCAGGAGGCTGGCTGTACAGC
GGTTCTCACAGCATGTTTGCGGAGGTTATCCATTCATTGGCCGACCTAAT
CAACCAGCTAATTCTCGCCTTTGGCATCTACAAGTCCTCTCAGAGTCCGG
ACATAGATCATCCTTATGGATACATGAACATGCGTTATGTATCCTCGCTG
ATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGGCCTGTCCATCTACCA
CGGTATTGATGGCATTCTCCATCCGGAACCCATAACAGATCTGTTTTGGG
TATACTGCATCTTAATGGGATCGCTGGTTTCTGAGGGAGCTACTTTGGTG
GTAGCCATCAATGAGCTTAAACGATCGGCCAAGGAAAACAATATGACCTT
TAAAGATTATGTGATTTCTGGCAAGGATCCGTGCGTAAATGTGGTGCTGT
GCGAAGATGCTGCAGCTGTAACTGGCGTTATGGTGGCTGGAGCCTGTATG
GGATTAAGTAGTTACACAGGATCCCCCATTTTCGACGCCGCTGGATCACT
GGTTATAGGTGCTCTTCTGGGCGCTGTGGCTTCTTTTATCATTTATACAA
ATGCTAATGCGCTGGTAGGGATATCCATTGCTTCCGAGCGCCTAGAAAAA
ATTAATTCTGCTTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
CAAGGGAATCGATATTGGCAACGCTCGGGTTCGGTATAAGGCTGAACTCG
ATTTTGACGGCCGTGAGTTGACGCGTTCGTATCTGGACAAACAGGATCTC
GCAAAACTGCTCACTACTGTTCGAGGCTTTCAAAAGGTTGAGGATCTGGA
GAGCTTTCTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGCG
AAATTGATCGCATTGAGATGAACTTGCGGACACAATTCCCGGAAATACGT
CATGTGGACCTGGAAATACTC---------------------
>C5
ATGCTGTTGCGCGGCGTGCAGATCCTGCAGCGAAGACACCAGCACTTTGG
AAAGGCTTTTAGCCAGTGCTCCTTGCGCCAAGATGCCAGTTATCCCTGGA
AGCGGAATGACGGCGTGTCATTCAAGCAACAACCGTGGAAGCGCCCAAGC
ATGTTCCTGCAGTTTCGCTGTAGCGCCAATGACAGTGATTCCAAGAGGGA
CAAACCTCTGCAGGAGGAGTCCACCGCTGGTGCAGTCGCCAAACCAAAGG
AAAAGGAAACGAAAAACTTTGAGGTGAAGACAACAAAGGGCATCCTGTCT
ATCAGCACCACCATCGAGGACTCCAAGATTAACGAGATTGTGTTTGAAAA
ATCCGATCTACCGCCGCTAACCAAGGTGAAAGAGCCAGCATTGGTCGCAG
GGGCCATCAATCTACGTTCCAGCTCCACTGCATTGGGAATTGGTGCTGTG
GGATTGGGAGGGGCTTCTGGCTCCATTTTGAATCCTCCTGAAACAGTGAC
AAGCGCAACTAAAAATTCTCCGGCTGATGCTGTGCTATCTGAAAGGGCCG
CAGAAGTTAGTCGAACATGCCCACCTGCAGAGGTGACGCCTCTAGCGCCT
GTGATTTCTCCAAAGCGACCCCGTTTCGATTATCGTGCTTCCCTAGAGCG
CAACTTTGTGACCCCCAACAGGGCCATCAGCGATTTCTTGTTGACCGCTG
CTCAACTGGAGTGTCTGCCCAAAATTAAGCGGAGATCGCCGTACGAGCAG
GAGCCGCCCATGACGGTCTACTGGCGACGCGATGTTGAAGCTAAGGCTGT
GGAGGTGTGGGGATCCAAGGAAAACCTGTTACGGGAACGACTCAAGCGGG
AGGTGGAGCGCAAGCAATACCAGCAGAATCTATTCACTGTCAAACGGCGG
TTGCGCGACTACCGCAGGGAGATGGGATCTCGGACCAAAGTAATGCTCGA
CAACAGAAAGGAGTCGGAGAAGTCCGGGCAAGTGGTGGCCACCGCCATCG
CTATCAATGCAGCCAATTTGCTTTTCAAGGCAGGAGGTTGGCTGTACAGC
GGTTCCCACAGCATGTTTGCGGAGGTTATCCATTCTTTGGCCGACCTAAT
CAACCAGCTCATTCTCGCCTTTGGCATTTACAAGTCATCTCAGAGTCCGG
ACATAGATCATCCTTATGGATACATGAACATGCGATATGTGTCCTCGCTG
ATTTCGGGCGTTGGCATATTTTGCGTAGGCTGTGGGCTGTCCATCTACCA
CGGTATTGATGGCATTCTCCATCCGGAACCCATAACCGATCTGTTTTGGG
TGTATTGCATCTTAATGGGATCGTTAGTTTCTGAGGGAGCCACTCTGGTG
GTGGCCATCAATGAGCTTAAACGATCGGCCAAGGAAAACAATATGACCTT
TAAAGATTATGTAATTTCTGGCAAGGATCCATGCGTGAATGTGGTGCTGT
GCGAAGACGCTGCAGCTGTAACTGGCGTTATGGTGGCTGGAGCTTGTATG
GGATTGAGTAGTTACACAGGATCGCCCATCTTCGACGCCGCTGGATCACT
GGTTATAGGTGCTCTCCTGGGTGCTGTGGCCTCTTTTATCATTTATACAA
ATGCCAATGCGCTGGTAGGAATATCCATTGCATCCGAGCGCCTAGAAAAG
ATAAATTCTGCTTTGGAGGCTGATGTGATGATCAGAGCGATTTACGATGT
CAAGGGAATCGATATTGGCAACGCTCGAGTTCGTTATAAGGCTGAGCTTG
ACTTCGATGGCCGTGAGCTGACGCGTTCGTATCTGGATAAACAGGATCTC
GCAAAACTGCTCACAACTGTTCGAGGCTTTCAAAAGGTTGAGGATCTGGA
GAGCTTTTTGCTGGATCAAGGCGAAAACATTGTGGACCTGATGGGCGGTG
AGATTGATCGCATTGAGATGAACCTGCGGACACAATTTCCGGAAATACGT
CATGTGGACCTGGAAATACTC---------------------
>C1
MLLRGVQILQRRHQHLGKAFSQCSLRQDGRNPWRRHDGEAFKLQPWKRPS
TFLQFRCSANGSDSKKEKPVQEEATAGPVAKPKEooTKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVMNPPETVKSAPKNSPSGAVLAEKAGEGIRTSPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLESLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL
>C2
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKIQPWKRPS
MFLQFRCSANDSDSKKEKPVQKETTAGPVAKPKEooTKNFEVKTTKGILS
ISTTIEDSKINEIVFEKYDLPPVTKVoooooAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPLKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVDVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL
>C3
MLLRGVQILQRRHQHFGKAFSQCSLRQDARNPWRRHDGEAFKLQPWKRPD
MFLQFRCSANGSDSKKDKPVQEEATAGPVAKPREooTKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPVTKVKEPVLAASAINLRSTSTGVATGAV
GLGESSGSVINPPETVKSAAKNSPAGAALAEKAGEGIRTCPPAEVTPPAP
VIPIKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMSFKDYVISGKDPCVNVVLCEDAAAVTGVMVAAACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRSFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL
>C4
MLLRGVQILQRRHHHFGKAFSQCTLRHDARISWRRNDGESFKLQPWKRPS
TFLQFRCSANDSooKKDQPLQEESTTGSVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLAKVKEPVLAAGAINLRSSSIAVAAGAV
GLGSGSGSIMNPPETVTSPTKNSLAGAVLAEKAGEASRTGPPAEVTPPAP
VIPPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLENLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKRDVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL
>C5
MLLRGVQILQRRHQHFGKAFSQCSLRQDASYPWKRNDGVSFKQQPWKRPS
MFLQFRCSANDSDSKRDKPLQEESTAGAVAKPKEKETKNFEVKTTKGILS
ISTTIEDSKINEIVFEKSDLPPLTKVKEPALVAGAINLRSSSTALGIGAV
GLGGASGSILNPPETVTSATKNSPADAVLSERAAEVSRTCPPAEVTPLAP
VISPKRPRFDYRASLERNFVTPNRAISDFLLTAAQLECLPKIKRRSPYEQ
EPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQNLFTVKRR
LRDYRREMGSRTKVMLDNRKESEKSGQVVATAIAINAANLLFKAGGWLYS
GSHSMFAEVIHSLADLINQLILAFGIYKSSQSPDIDHPYGYMNMRYVSSL
ISGVGIFCVGCGLSIYHGIDGILHPEPITDLFWVYCILMGSLVSEGATLV
VAINELKRSAKENNMTFKDYVISGKDPCVNVVLCEDAAAVTGVMVAGACM
GLSSYTGSPIFDAAGSLVIGALLGAVASFIIYTNANALVGISIASERLEK
INSALEADVMIRAIYDVKGIDIGNARVRYKAELDFDGRELTRSYLDKQDL
AKLLTTVRGFQKVEDLESFLLDQGENIVDLMGGEIDRIEMNLRTQFPEIR
HVDLEIL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1992 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481282609
      Setting output file names to "/opt/ADOPS/444/ZnT49B-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 797390779
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0000478935
      Seed = 948311907
      Swapseed = 1481282609
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 49 unique site patterns
      Division 2 has 38 unique site patterns
      Division 3 has 93 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5119.735080 -- -25.624409
         Chain 2 -- -5260.033616 -- -25.624409
         Chain 3 -- -5292.973183 -- -25.624409
         Chain 4 -- -5267.598884 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5305.364349 -- -25.624409
         Chain 2 -- -5268.965409 -- -25.624409
         Chain 3 -- -5194.303788 -- -25.624409
         Chain 4 -- -5056.729009 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5119.735] (-5260.034) (-5292.973) (-5267.599) * [-5305.364] (-5268.965) (-5194.304) (-5056.729) 
        500 -- (-4470.300) [-4448.262] (-4449.425) (-4467.664) * [-4444.359] (-4459.228) (-4463.664) (-4472.393) -- 0:00:00
       1000 -- (-4449.373) [-4416.814] (-4437.822) (-4453.222) * [-4432.157] (-4449.864) (-4448.266) (-4443.934) -- 0:16:39
       1500 -- (-4427.537) [-4393.064] (-4425.694) (-4411.055) * [-4427.276] (-4445.158) (-4442.062) (-4421.339) -- 0:11:05
       2000 -- (-4406.225) (-4384.890) (-4405.149) [-4374.874] * [-4386.407] (-4415.785) (-4407.753) (-4404.123) -- 0:08:19
       2500 -- (-4404.644) [-4375.927] (-4403.680) (-4363.696) * (-4372.424) (-4400.864) (-4388.539) [-4375.207] -- 0:06:39
       3000 -- (-4371.318) (-4378.807) (-4394.269) [-4360.894] * [-4371.255] (-4379.400) (-4382.581) (-4375.588) -- 0:05:32
       3500 -- [-4369.065] (-4366.342) (-4388.496) (-4363.307) * (-4365.288) [-4363.882] (-4368.892) (-4371.548) -- 0:04:44
       4000 -- (-4370.045) (-4369.241) (-4370.213) [-4369.090] * [-4368.290] (-4362.574) (-4363.242) (-4365.542) -- 0:04:09
       4500 -- (-4373.941) (-4361.760) [-4372.080] (-4365.799) * (-4361.376) (-4364.142) [-4364.963] (-4367.420) -- 0:07:22
       5000 -- (-4368.311) [-4366.696] (-4367.591) (-4365.386) * (-4365.479) [-4364.353] (-4362.968) (-4366.669) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-4378.375) (-4366.582) (-4363.813) [-4363.494] * (-4371.634) [-4367.230] (-4364.076) (-4363.556) -- 0:06:01
       6000 -- (-4365.054) (-4361.551) [-4363.659] (-4372.884) * [-4359.059] (-4362.956) (-4365.320) (-4367.882) -- 0:05:31
       6500 -- [-4362.583] (-4362.931) (-4366.005) (-4365.569) * [-4365.032] (-4362.336) (-4363.614) (-4360.961) -- 0:05:05
       7000 -- (-4366.687) (-4366.518) [-4364.387] (-4363.599) * (-4361.963) [-4362.461] (-4369.169) (-4363.463) -- 0:04:43
       7500 -- (-4373.359) [-4359.767] (-4361.854) (-4376.166) * [-4363.538] (-4365.348) (-4374.977) (-4362.609) -- 0:06:37
       8000 -- (-4366.480) (-4366.143) [-4367.070] (-4369.832) * (-4363.352) (-4366.906) (-4371.850) [-4366.527] -- 0:06:12
       8500 -- [-4364.347] (-4361.611) (-4369.700) (-4361.858) * [-4365.513] (-4364.356) (-4372.276) (-4363.877) -- 0:05:49
       9000 -- (-4367.323) (-4371.643) [-4363.191] (-4367.746) * (-4366.367) (-4370.222) (-4373.828) [-4365.245] -- 0:05:30
       9500 -- (-4363.034) [-4362.388] (-4363.840) (-4370.855) * (-4374.892) (-4360.504) [-4367.763] (-4366.135) -- 0:05:12
      10000 -- (-4364.507) (-4377.666) (-4367.137) [-4366.375] * (-4358.709) [-4364.358] (-4364.148) (-4362.815) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-4363.223) (-4369.623) (-4364.310) [-4365.040] * (-4363.462) (-4366.864) [-4359.794] (-4364.531) -- 0:04:42
      11000 -- [-4367.215] (-4371.667) (-4365.759) (-4366.778) * (-4363.829) (-4369.315) [-4365.397] (-4362.982) -- 0:05:59
      11500 -- (-4370.468) [-4364.713] (-4370.740) (-4371.119) * [-4367.170] (-4367.581) (-4361.212) (-4367.796) -- 0:05:43
      12000 -- (-4369.239) (-4376.232) (-4370.013) [-4368.562] * (-4366.037) [-4370.567] (-4359.698) (-4367.531) -- 0:05:29
      12500 -- [-4367.622] (-4376.522) (-4366.601) (-4366.450) * (-4365.747) [-4372.497] (-4370.866) (-4365.537) -- 0:05:16
      13000 -- (-4368.339) (-4367.529) (-4366.834) [-4362.931] * (-4368.680) (-4366.647) (-4361.774) [-4368.858] -- 0:05:03
      13500 -- [-4362.085] (-4368.832) (-4368.648) (-4370.690) * (-4374.048) (-4368.480) (-4363.617) [-4364.602] -- 0:04:52
      14000 -- [-4367.840] (-4366.821) (-4372.247) (-4366.177) * (-4366.425) [-4364.356] (-4366.823) (-4363.601) -- 0:05:52
      14500 -- (-4365.397) (-4366.017) (-4366.514) [-4363.452] * (-4365.972) [-4367.614] (-4366.654) (-4366.950) -- 0:05:39
      15000 -- (-4372.117) (-4366.911) (-4370.970) [-4366.056] * [-4362.570] (-4373.591) (-4365.167) (-4371.622) -- 0:05:28

      Average standard deviation of split frequencies: 0.000000

      15500 -- [-4374.125] (-4372.860) (-4363.848) (-4364.630) * [-4367.375] (-4366.271) (-4362.816) (-4360.243) -- 0:05:17
      16000 -- (-4370.109) (-4369.693) (-4363.074) [-4368.013] * (-4369.503) (-4371.801) (-4367.882) [-4365.147] -- 0:05:07
      16500 -- (-4363.708) (-4370.948) (-4373.144) [-4368.732] * (-4371.272) (-4363.307) (-4365.656) [-4362.683] -- 0:04:58
      17000 -- (-4367.355) (-4366.862) [-4369.496] (-4370.061) * (-4365.192) [-4361.700] (-4369.051) (-4369.762) -- 0:04:49
      17500 -- [-4364.943] (-4370.424) (-4361.012) (-4365.458) * [-4366.448] (-4372.625) (-4369.272) (-4363.833) -- 0:05:36
      18000 -- (-4374.229) [-4367.026] (-4363.698) (-4361.226) * (-4363.364) (-4364.399) (-4368.002) [-4369.707] -- 0:05:27
      18500 -- (-4373.688) [-4366.542] (-4359.520) (-4359.053) * [-4364.618] (-4363.792) (-4370.723) (-4374.672) -- 0:05:18
      19000 -- (-4373.755) (-4366.238) [-4367.085] (-4362.241) * [-4362.339] (-4362.154) (-4371.436) (-4367.994) -- 0:05:09
      19500 -- (-4367.798) [-4369.661] (-4367.812) (-4367.988) * (-4370.841) (-4364.952) [-4364.059] (-4366.191) -- 0:05:01
      20000 -- (-4367.528) (-4363.371) [-4368.529] (-4368.565) * [-4369.119] (-4363.949) (-4366.861) (-4369.953) -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-4367.718) (-4368.492) [-4371.693] (-4363.866) * [-4367.403] (-4362.936) (-4361.342) (-4367.117) -- 0:04:46
      21000 -- (-4365.119) (-4367.288) (-4361.705) [-4363.044] * (-4362.009) (-4367.587) (-4360.926) [-4362.133] -- 0:05:26
      21500 -- [-4366.993] (-4378.464) (-4374.481) (-4366.610) * (-4360.832) [-4369.745] (-4368.932) (-4369.099) -- 0:05:18
      22000 -- (-4369.122) [-4361.294] (-4366.201) (-4368.943) * [-4362.816] (-4365.013) (-4374.262) (-4366.913) -- 0:05:11
      22500 -- (-4369.245) [-4366.066] (-4365.002) (-4374.468) * (-4368.038) (-4364.739) (-4374.410) [-4360.697] -- 0:05:04
      23000 -- (-4365.130) (-4366.657) [-4360.172] (-4370.520) * (-4367.118) [-4369.793] (-4366.802) (-4370.607) -- 0:04:57
      23500 -- (-4364.970) (-4368.951) (-4362.127) [-4369.231] * (-4368.298) (-4366.850) (-4370.607) [-4363.332] -- 0:04:50
      24000 -- (-4368.583) [-4364.551] (-4365.629) (-4372.755) * (-4365.201) (-4370.597) [-4364.686] (-4379.841) -- 0:05:25
      24500 -- (-4370.735) (-4373.526) [-4366.099] (-4370.449) * (-4369.050) (-4364.371) [-4363.494] (-4366.703) -- 0:05:18
      25000 -- (-4363.744) (-4363.032) [-4363.940] (-4364.815) * (-4363.929) [-4369.219] (-4362.585) (-4370.766) -- 0:05:12

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-4366.180] (-4363.907) (-4359.264) (-4365.590) * (-4364.603) (-4359.828) [-4362.609] (-4363.534) -- 0:05:05
      26000 -- (-4363.493) (-4365.760) (-4361.144) [-4362.485] * [-4365.243] (-4363.666) (-4361.950) (-4363.444) -- 0:04:59
      26500 -- (-4371.505) (-4368.030) [-4364.709] (-4366.541) * (-4369.583) (-4369.577) [-4359.533] (-4364.499) -- 0:04:53
      27000 -- [-4364.224] (-4361.914) (-4365.450) (-4362.944) * (-4371.199) (-4365.277) [-4361.882] (-4373.942) -- 0:04:48
      27500 -- (-4372.920) [-4366.524] (-4374.860) (-4370.212) * [-4363.998] (-4367.627) (-4363.567) (-4367.474) -- 0:05:18
      28000 -- (-4364.466) (-4366.368) [-4366.064] (-4364.128) * (-4371.735) (-4362.810) (-4362.438) [-4365.883] -- 0:05:12
      28500 -- (-4369.832) (-4365.710) (-4366.166) [-4365.069] * (-4366.293) [-4371.926] (-4366.132) (-4366.111) -- 0:05:06
      29000 -- (-4368.946) [-4362.405] (-4360.015) (-4371.362) * (-4366.322) (-4374.303) (-4373.008) [-4362.715] -- 0:05:01
      29500 -- [-4366.458] (-4368.896) (-4366.386) (-4365.057) * [-4362.759] (-4374.927) (-4371.661) (-4363.477) -- 0:04:56
      30000 -- [-4368.695] (-4367.121) (-4376.785) (-4368.797) * (-4365.164) (-4375.759) [-4369.373] (-4370.225) -- 0:04:51

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-4363.826) [-4367.634] (-4364.297) (-4366.378) * (-4372.640) (-4363.220) (-4370.212) [-4365.351] -- 0:05:17
      31000 -- [-4367.267] (-4368.707) (-4369.544) (-4370.210) * (-4367.070) [-4368.020] (-4364.931) (-4359.612) -- 0:05:12
      31500 -- (-4363.847) [-4367.955] (-4372.001) (-4366.529) * (-4363.286) (-4369.917) (-4363.298) [-4358.991] -- 0:05:07
      32000 -- (-4369.712) (-4368.904) (-4362.564) [-4363.586] * (-4362.091) (-4372.031) [-4367.906] (-4368.456) -- 0:05:02
      32500 -- [-4366.966] (-4364.109) (-4368.423) (-4371.055) * [-4363.364] (-4370.660) (-4366.308) (-4364.550) -- 0:04:57
      33000 -- [-4364.002] (-4360.978) (-4365.361) (-4362.894) * (-4368.904) (-4377.524) (-4370.421) [-4364.849] -- 0:04:53
      33500 -- (-4370.988) [-4362.042] (-4365.519) (-4368.016) * (-4365.897) (-4373.537) (-4373.832) [-4366.063] -- 0:04:48
      34000 -- [-4365.403] (-4366.612) (-4365.482) (-4367.285) * [-4368.647] (-4376.192) (-4364.401) (-4379.741) -- 0:05:12
      34500 -- (-4364.226) (-4361.899) (-4364.720) [-4361.577] * (-4373.269) (-4367.340) [-4364.162] (-4378.729) -- 0:05:07
      35000 -- (-4368.898) (-4366.542) [-4364.826] (-4362.090) * (-4370.161) (-4369.199) [-4358.959] (-4379.322) -- 0:05:03

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-4363.561) (-4364.889) (-4370.816) [-4365.712] * [-4362.438] (-4369.238) (-4369.032) (-4372.121) -- 0:04:58
      36000 -- (-4368.649) [-4359.756] (-4369.835) (-4360.312) * [-4363.298] (-4370.708) (-4368.992) (-4364.202) -- 0:04:54
      36500 -- (-4363.891) (-4362.289) (-4368.523) [-4365.987] * (-4368.452) (-4365.738) (-4368.268) [-4366.075] -- 0:04:50
      37000 -- [-4364.220] (-4362.360) (-4376.110) (-4365.437) * [-4372.205] (-4365.214) (-4368.456) (-4368.628) -- 0:04:46
      37500 -- [-4367.281] (-4363.962) (-4378.515) (-4371.306) * [-4364.878] (-4364.803) (-4367.779) (-4379.521) -- 0:05:08
      38000 -- (-4373.983) [-4371.374] (-4363.008) (-4369.643) * [-4363.533] (-4360.046) (-4370.600) (-4371.580) -- 0:05:03
      38500 -- (-4368.708) (-4365.075) [-4365.580] (-4361.349) * (-4363.831) [-4362.757] (-4374.011) (-4360.701) -- 0:04:59
      39000 -- (-4361.837) (-4371.077) (-4365.333) [-4361.481] * (-4361.573) (-4370.772) [-4373.865] (-4370.517) -- 0:04:55
      39500 -- [-4360.229] (-4369.035) (-4369.669) (-4378.262) * (-4365.005) (-4370.064) (-4372.410) [-4365.829] -- 0:04:51
      40000 -- [-4362.741] (-4368.357) (-4369.966) (-4366.651) * (-4367.401) [-4366.869] (-4378.000) (-4367.194) -- 0:04:48

      Average standard deviation of split frequencies: 0.000000

      40500 -- [-4366.118] (-4373.937) (-4365.926) (-4365.144) * (-4365.324) (-4370.009) [-4367.435] (-4365.900) -- 0:05:07
      41000 -- (-4371.375) (-4368.553) (-4372.238) [-4365.430] * (-4362.303) (-4365.268) (-4368.965) [-4365.016] -- 0:05:04
      41500 -- (-4363.139) [-4364.492] (-4366.277) (-4363.032) * (-4362.691) (-4376.577) [-4365.180] (-4363.257) -- 0:05:00
      42000 -- [-4366.685] (-4363.409) (-4374.006) (-4375.447) * (-4370.917) (-4367.793) (-4365.646) [-4370.729] -- 0:04:56
      42500 -- (-4365.771) [-4363.442] (-4366.244) (-4364.785) * (-4372.298) (-4367.212) (-4375.788) [-4363.935] -- 0:04:52
      43000 -- [-4359.563] (-4364.249) (-4371.838) (-4371.609) * [-4365.539] (-4363.153) (-4370.695) (-4368.346) -- 0:04:49
      43500 -- (-4366.760) (-4361.638) (-4363.764) [-4370.992] * (-4367.401) [-4370.556] (-4367.523) (-4369.073) -- 0:04:45
      44000 -- (-4364.007) (-4365.641) (-4363.881) [-4363.247] * (-4382.718) [-4365.928] (-4362.876) (-4365.586) -- 0:05:04
      44500 -- (-4363.171) (-4370.426) [-4365.213] (-4367.533) * (-4369.248) [-4365.020] (-4368.732) (-4365.751) -- 0:05:00
      45000 -- (-4371.097) (-4365.737) [-4366.451] (-4360.871) * [-4368.711] (-4363.371) (-4367.443) (-4365.589) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      45500 -- [-4365.689] (-4371.869) (-4369.404) (-4365.401) * (-4363.778) (-4364.469) (-4364.010) [-4370.438] -- 0:04:53
      46000 -- (-4367.238) (-4370.003) (-4369.076) [-4366.921] * (-4366.534) (-4367.684) [-4364.064] (-4375.575) -- 0:04:50
      46500 -- [-4366.351] (-4367.906) (-4369.298) (-4364.846) * [-4365.673] (-4372.173) (-4365.961) (-4367.586) -- 0:04:47
      47000 -- (-4369.056) (-4378.780) (-4371.979) [-4370.555] * (-4369.302) (-4365.757) (-4363.114) [-4368.787] -- 0:05:04
      47500 -- (-4368.536) (-4370.868) (-4366.824) [-4365.223] * (-4367.590) (-4368.779) [-4365.006] (-4368.284) -- 0:05:00
      48000 -- (-4376.568) [-4363.112] (-4371.776) (-4364.866) * (-4372.681) (-4367.856) (-4364.821) [-4368.122] -- 0:04:57
      48500 -- [-4368.635] (-4369.154) (-4367.145) (-4366.744) * (-4372.020) (-4366.661) [-4366.684] (-4364.873) -- 0:04:54
      49000 -- (-4370.130) (-4367.812) [-4361.808] (-4369.714) * [-4363.746] (-4364.573) (-4370.949) (-4371.889) -- 0:04:51
      49500 -- (-4372.709) (-4364.386) (-4367.516) [-4368.733] * (-4363.619) (-4366.336) (-4376.438) [-4361.851] -- 0:04:48
      50000 -- (-4375.394) [-4363.249] (-4365.375) (-4374.046) * (-4366.831) (-4363.407) (-4368.776) [-4364.532] -- 0:05:04

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-4368.444) (-4374.234) [-4361.557] (-4370.525) * (-4365.587) (-4361.108) (-4371.509) [-4362.663] -- 0:05:00
      51000 -- [-4363.336] (-4364.719) (-4367.849) (-4372.029) * (-4362.013) [-4364.880] (-4364.309) (-4364.791) -- 0:04:57
      51500 -- [-4367.691] (-4364.908) (-4368.388) (-4368.540) * (-4365.453) [-4366.598] (-4366.684) (-4362.708) -- 0:04:54
      52000 -- [-4364.835] (-4367.247) (-4361.510) (-4368.233) * (-4366.295) (-4364.972) (-4368.120) [-4364.981] -- 0:04:51
      52500 -- (-4376.390) (-4372.303) [-4365.410] (-4369.467) * [-4364.251] (-4365.781) (-4365.419) (-4366.542) -- 0:04:48
      53000 -- [-4360.384] (-4375.639) (-4368.838) (-4361.934) * [-4366.579] (-4363.394) (-4364.775) (-4367.847) -- 0:04:45
      53500 -- (-4367.519) (-4361.330) (-4363.453) [-4366.232] * [-4364.331] (-4365.920) (-4368.458) (-4363.916) -- 0:05:00
      54000 -- (-4363.825) (-4365.765) [-4362.878] (-4370.822) * (-4364.705) [-4362.722] (-4370.940) (-4368.223) -- 0:04:57
      54500 -- (-4366.376) (-4369.593) (-4365.663) [-4365.981] * (-4381.417) (-4366.331) (-4365.663) [-4364.126] -- 0:04:54
      55000 -- (-4363.218) (-4364.404) (-4369.695) [-4371.894] * (-4365.110) (-4375.299) (-4366.476) [-4364.637] -- 0:04:52

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-4361.608) [-4369.824] (-4363.921) (-4367.009) * [-4368.091] (-4370.074) (-4369.166) (-4367.167) -- 0:04:49
      56000 -- (-4367.965) (-4373.328) [-4364.258] (-4367.554) * (-4366.114) [-4363.542] (-4369.126) (-4365.597) -- 0:04:46
      56500 -- (-4361.994) (-4372.248) (-4366.075) [-4366.538] * [-4365.305] (-4361.131) (-4362.992) (-4373.127) -- 0:05:00
      57000 -- (-4361.496) (-4367.441) (-4362.650) [-4364.348] * (-4370.554) (-4362.609) (-4369.332) [-4365.211] -- 0:04:57
      57500 -- (-4369.226) [-4363.915] (-4372.434) (-4362.478) * (-4370.625) [-4376.325] (-4369.057) (-4370.184) -- 0:04:55
      58000 -- (-4368.628) (-4367.557) [-4365.402] (-4370.429) * (-4371.633) (-4365.307) [-4363.293] (-4358.248) -- 0:04:52
      58500 -- [-4360.087] (-4364.373) (-4364.868) (-4371.405) * (-4364.734) [-4360.389] (-4368.015) (-4377.968) -- 0:04:49
      59000 -- (-4364.796) [-4363.216] (-4368.918) (-4363.427) * (-4367.302) [-4360.880] (-4370.257) (-4372.358) -- 0:04:47
      59500 -- (-4361.238) [-4363.396] (-4368.991) (-4367.174) * [-4363.499] (-4369.626) (-4366.366) (-4373.388) -- 0:04:44
      60000 -- (-4363.517) (-4366.543) (-4370.515) [-4360.405] * (-4362.657) (-4369.698) [-4365.629] (-4367.317) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-4366.024) (-4371.530) [-4367.422] (-4367.084) * (-4374.642) (-4364.355) [-4364.164] (-4365.359) -- 0:04:55
      61000 -- (-4362.617) [-4369.133] (-4366.220) (-4362.292) * [-4367.100] (-4366.720) (-4367.034) (-4369.105) -- 0:04:52
      61500 -- (-4360.998) [-4361.189] (-4366.870) (-4369.214) * (-4370.422) [-4361.659] (-4369.723) (-4367.989) -- 0:04:49
      62000 -- [-4364.043] (-4364.609) (-4365.796) (-4364.834) * [-4369.343] (-4358.517) (-4366.197) (-4366.775) -- 0:04:47
      62500 -- [-4361.282] (-4363.732) (-4366.450) (-4363.493) * [-4366.231] (-4365.093) (-4364.048) (-4367.655) -- 0:04:45
      63000 -- [-4366.909] (-4366.229) (-4363.571) (-4366.278) * (-4370.478) (-4362.672) (-4364.963) [-4368.570] -- 0:04:57
      63500 -- (-4364.520) (-4363.759) [-4364.747] (-4363.390) * (-4364.191) [-4368.403] (-4370.126) (-4376.001) -- 0:04:54
      64000 -- (-4371.775) (-4367.809) (-4369.671) [-4366.635] * [-4362.045] (-4366.811) (-4366.022) (-4376.174) -- 0:04:52
      64500 -- [-4368.620] (-4367.791) (-4365.926) (-4365.214) * (-4365.133) (-4366.620) [-4365.059] (-4374.879) -- 0:04:50
      65000 -- (-4374.377) (-4368.060) (-4361.999) [-4367.261] * (-4363.779) [-4375.160] (-4365.951) (-4360.934) -- 0:04:47

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-4365.069) (-4370.572) [-4363.831] (-4364.377) * [-4362.065] (-4366.751) (-4362.324) (-4366.369) -- 0:04:45
      66000 -- (-4363.927) [-4365.790] (-4367.533) (-4362.195) * (-4366.788) [-4368.884] (-4364.257) (-4372.106) -- 0:04:43
      66500 -- (-4367.612) (-4367.571) [-4365.781] (-4365.808) * (-4368.258) (-4366.768) (-4364.643) [-4364.482] -- 0:04:54
      67000 -- (-4366.736) [-4374.395] (-4368.382) (-4364.450) * [-4369.336] (-4365.401) (-4367.645) (-4365.891) -- 0:04:52
      67500 -- [-4365.425] (-4370.536) (-4366.033) (-4365.606) * (-4371.511) (-4361.583) (-4361.106) [-4364.154] -- 0:04:50
      68000 -- [-4369.209] (-4367.210) (-4370.169) (-4363.596) * (-4375.872) [-4363.087] (-4366.908) (-4360.897) -- 0:04:47
      68500 -- (-4358.239) (-4368.271) [-4362.575] (-4370.056) * (-4367.742) (-4367.568) [-4369.393] (-4363.215) -- 0:04:45
      69000 -- (-4362.068) (-4362.911) [-4365.192] (-4366.697) * (-4372.420) (-4370.236) [-4372.698] (-4368.195) -- 0:04:43
      69500 -- (-4360.911) (-4363.982) [-4364.576] (-4366.179) * (-4360.830) (-4366.242) (-4371.706) [-4360.598] -- 0:04:54
      70000 -- (-4362.524) (-4361.850) (-4372.773) [-4368.603] * (-4365.201) (-4363.123) [-4368.259] (-4360.549) -- 0:04:52

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-4365.027) [-4360.962] (-4366.636) (-4366.550) * (-4370.853) [-4368.825] (-4364.071) (-4368.409) -- 0:04:50
      71000 -- (-4372.416) (-4366.526) (-4361.968) [-4360.641] * (-4364.334) [-4368.067] (-4371.106) (-4366.620) -- 0:04:47
      71500 -- (-4377.875) [-4366.683] (-4368.435) (-4366.203) * (-4369.047) (-4368.419) [-4366.368] (-4366.368) -- 0:04:45
      72000 -- [-4366.695] (-4370.364) (-4364.331) (-4359.492) * (-4367.326) [-4363.740] (-4373.914) (-4364.923) -- 0:04:43
      72500 -- (-4367.871) [-4368.637] (-4362.778) (-4368.571) * (-4365.546) (-4368.339) (-4364.640) [-4365.925] -- 0:04:41
      73000 -- (-4376.459) [-4361.266] (-4362.924) (-4362.006) * (-4369.870) [-4362.680] (-4362.070) (-4371.937) -- 0:04:52
      73500 -- (-4364.887) [-4367.056] (-4362.003) (-4366.211) * (-4369.247) (-4366.093) (-4362.968) [-4367.891] -- 0:04:49
      74000 -- [-4363.701] (-4368.282) (-4369.489) (-4367.941) * [-4369.721] (-4366.206) (-4363.613) (-4369.395) -- 0:04:47
      74500 -- (-4363.220) (-4367.175) [-4362.657] (-4361.741) * (-4367.147) (-4363.989) [-4368.747] (-4370.835) -- 0:04:45
      75000 -- (-4361.862) [-4366.689] (-4361.944) (-4364.453) * [-4369.947] (-4364.889) (-4363.704) (-4374.488) -- 0:04:43

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-4365.501) [-4368.655] (-4365.327) (-4366.006) * [-4364.767] (-4366.053) (-4364.440) (-4378.335) -- 0:04:41
      76000 -- (-4370.878) (-4373.774) (-4373.499) [-4364.083] * (-4368.890) [-4364.319] (-4360.649) (-4371.732) -- 0:04:51
      76500 -- (-4371.449) (-4379.321) [-4361.887] (-4364.530) * (-4363.925) (-4366.660) [-4361.739] (-4367.604) -- 0:04:49
      77000 -- (-4367.052) (-4371.141) (-4368.227) [-4367.626] * (-4370.079) [-4368.924] (-4367.792) (-4368.762) -- 0:04:47
      77500 -- [-4363.009] (-4370.263) (-4367.827) (-4373.453) * (-4364.353) (-4368.505) [-4362.119] (-4370.503) -- 0:04:45
      78000 -- (-4362.084) [-4368.016] (-4369.284) (-4367.755) * (-4365.553) [-4363.143] (-4362.976) (-4361.928) -- 0:04:43
      78500 -- [-4369.512] (-4369.588) (-4371.253) (-4365.745) * (-4361.726) (-4366.011) (-4367.063) [-4364.596] -- 0:04:41
      79000 -- (-4373.387) (-4366.873) (-4365.105) [-4365.515] * [-4359.657] (-4364.527) (-4363.152) (-4363.055) -- 0:04:39
      79500 -- (-4369.558) [-4361.525] (-4369.930) (-4368.927) * (-4365.684) [-4363.210] (-4366.749) (-4367.554) -- 0:04:49
      80000 -- (-4369.468) (-4364.153) [-4367.015] (-4361.130) * (-4370.337) [-4364.382] (-4364.050) (-4370.460) -- 0:04:47

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-4366.052) (-4366.352) (-4368.756) [-4363.918] * (-4364.258) (-4366.092) (-4368.288) [-4368.876] -- 0:04:45
      81000 -- [-4368.601] (-4364.744) (-4365.649) (-4369.901) * (-4365.091) [-4365.525] (-4373.556) (-4374.288) -- 0:04:43
      81500 -- [-4360.394] (-4365.082) (-4370.991) (-4374.402) * [-4368.382] (-4360.929) (-4372.412) (-4368.563) -- 0:04:41
      82000 -- [-4370.277] (-4362.680) (-4371.861) (-4365.179) * (-4366.311) (-4363.008) (-4374.389) [-4363.275] -- 0:04:39
      82500 -- (-4359.229) (-4368.888) (-4371.383) [-4360.166] * [-4369.264] (-4361.288) (-4376.337) (-4374.762) -- 0:04:38
      83000 -- (-4364.427) (-4368.899) [-4369.110] (-4364.318) * [-4366.864] (-4366.737) (-4376.490) (-4377.770) -- 0:04:47
      83500 -- (-4365.716) (-4364.459) [-4374.704] (-4366.351) * (-4366.746) (-4367.119) [-4373.121] (-4372.238) -- 0:04:45
      84000 -- (-4366.358) [-4363.497] (-4364.584) (-4360.914) * (-4370.583) [-4362.325] (-4365.766) (-4369.880) -- 0:04:43
      84500 -- (-4360.869) (-4368.237) (-4365.052) [-4359.903] * (-4372.457) [-4363.889] (-4372.018) (-4372.691) -- 0:04:41
      85000 -- (-4372.175) [-4364.154] (-4373.737) (-4366.513) * (-4372.452) (-4362.983) (-4368.910) [-4366.755] -- 0:04:39

      Average standard deviation of split frequencies: 0.000000

      85500 -- [-4363.272] (-4373.372) (-4372.694) (-4383.254) * (-4364.217) [-4361.117] (-4367.324) (-4372.362) -- 0:04:38
      86000 -- (-4368.327) [-4365.050] (-4362.677) (-4374.192) * (-4370.038) (-4367.858) [-4368.249] (-4367.602) -- 0:04:46
      86500 -- [-4363.315] (-4367.242) (-4366.680) (-4372.525) * [-4368.042] (-4367.394) (-4361.759) (-4364.279) -- 0:04:45
      87000 -- (-4367.756) [-4366.055] (-4370.210) (-4368.799) * (-4367.854) (-4376.554) (-4368.299) [-4364.721] -- 0:04:43
      87500 -- (-4359.792) [-4362.059] (-4371.731) (-4365.255) * (-4373.426) (-4367.137) [-4370.675] (-4368.677) -- 0:04:41
      88000 -- (-4371.709) (-4364.652) [-4367.271] (-4370.410) * (-4366.503) [-4366.574] (-4368.889) (-4364.777) -- 0:04:39
      88500 -- (-4365.900) [-4371.791] (-4360.933) (-4362.923) * (-4361.985) (-4365.775) [-4365.515] (-4361.722) -- 0:04:38
      89000 -- (-4366.230) [-4364.860] (-4367.252) (-4365.190) * (-4365.618) (-4367.380) (-4363.018) [-4362.402] -- 0:04:36
      89500 -- (-4361.834) (-4368.949) (-4362.674) [-4365.511] * [-4363.616] (-4371.903) (-4360.819) (-4363.023) -- 0:04:44
      90000 -- (-4361.466) [-4365.923] (-4366.645) (-4364.179) * [-4363.334] (-4368.210) (-4362.836) (-4367.120) -- 0:04:43

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-4369.415) (-4369.917) (-4369.417) [-4365.427] * (-4367.906) (-4366.194) [-4366.662] (-4366.631) -- 0:04:41
      91000 -- (-4364.970) (-4376.453) (-4369.659) [-4369.504] * [-4373.328] (-4364.982) (-4362.139) (-4377.977) -- 0:04:39
      91500 -- [-4367.582] (-4374.056) (-4361.924) (-4363.999) * (-4365.867) (-4368.702) [-4368.517] (-4368.522) -- 0:04:38
      92000 -- (-4369.301) (-4378.418) (-4364.602) [-4369.820] * (-4366.360) (-4364.821) (-4365.747) [-4360.377] -- 0:04:36
      92500 -- (-4365.423) (-4373.344) (-4371.644) [-4367.616] * (-4371.865) (-4362.491) (-4368.862) [-4363.299] -- 0:04:44
      93000 -- (-4368.117) (-4368.549) [-4365.724] (-4372.857) * [-4370.321] (-4364.520) (-4371.511) (-4366.209) -- 0:04:42
      93500 -- [-4363.559] (-4370.636) (-4364.458) (-4367.977) * (-4367.769) (-4362.347) (-4368.299) [-4365.330] -- 0:04:41
      94000 -- (-4368.176) (-4369.275) [-4370.659] (-4372.679) * (-4366.192) [-4362.982] (-4366.874) (-4364.050) -- 0:04:39
      94500 -- (-4369.996) (-4376.855) (-4371.385) [-4364.054] * (-4366.068) (-4363.440) [-4362.104] (-4363.082) -- 0:04:37
      95000 -- (-4370.716) (-4364.568) [-4364.756] (-4364.997) * (-4372.860) (-4371.778) [-4362.674] (-4363.486) -- 0:04:36

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-4365.501) (-4375.571) [-4364.732] (-4365.348) * (-4371.736) (-4367.388) [-4366.087] (-4363.221) -- 0:04:34
      96000 -- [-4360.335] (-4362.618) (-4364.965) (-4365.205) * (-4370.296) (-4371.491) [-4369.681] (-4370.620) -- 0:04:42
      96500 -- (-4371.634) (-4360.775) (-4366.825) [-4365.676] * (-4375.483) [-4365.181] (-4365.624) (-4375.582) -- 0:04:40
      97000 -- (-4367.603) (-4369.796) [-4368.380] (-4364.933) * (-4371.651) (-4364.461) (-4367.410) [-4366.126] -- 0:04:39
      97500 -- (-4365.441) [-4365.484] (-4367.628) (-4363.448) * [-4368.797] (-4362.791) (-4361.565) (-4368.114) -- 0:04:37
      98000 -- [-4365.665] (-4370.913) (-4365.623) (-4367.729) * (-4368.137) [-4364.115] (-4369.219) (-4366.333) -- 0:04:36
      98500 -- (-4371.233) (-4369.550) [-4370.895] (-4365.942) * [-4366.260] (-4365.125) (-4364.713) (-4366.937) -- 0:04:34
      99000 -- (-4366.617) [-4369.167] (-4372.998) (-4362.720) * [-4364.293] (-4362.646) (-4371.697) (-4362.093) -- 0:04:42
      99500 -- [-4360.420] (-4366.272) (-4373.532) (-4369.319) * (-4361.846) [-4363.245] (-4368.634) (-4367.261) -- 0:04:40
      100000 -- (-4362.323) [-4364.639] (-4367.017) (-4367.058) * (-4369.836) (-4366.037) [-4362.951] (-4365.442) -- 0:04:39

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-4367.348) [-4366.844] (-4363.787) (-4366.532) * (-4370.123) [-4365.309] (-4361.776) (-4367.342) -- 0:04:37
      101000 -- [-4358.799] (-4366.175) (-4365.021) (-4363.536) * [-4363.414] (-4360.348) (-4377.735) (-4364.489) -- 0:04:35
      101500 -- [-4366.896] (-4360.867) (-4362.761) (-4361.117) * (-4367.557) [-4364.052] (-4369.470) (-4360.932) -- 0:04:34
      102000 -- (-4368.089) (-4372.351) [-4359.214] (-4372.025) * (-4368.161) (-4365.705) [-4370.587] (-4374.380) -- 0:04:32
      102500 -- (-4362.665) (-4367.011) (-4364.346) [-4365.361] * (-4369.375) (-4376.418) [-4368.066] (-4365.211) -- 0:04:40
      103000 -- (-4361.699) [-4372.833] (-4374.661) (-4362.348) * [-4366.482] (-4365.660) (-4365.549) (-4374.025) -- 0:04:38
      103500 -- (-4365.390) [-4367.379] (-4372.434) (-4371.567) * (-4367.537) (-4366.054) [-4367.365] (-4366.078) -- 0:04:37
      104000 -- (-4364.243) [-4362.468] (-4365.987) (-4364.421) * [-4363.798] (-4366.830) (-4362.540) (-4369.915) -- 0:04:35
      104500 -- (-4373.639) (-4369.117) [-4365.799] (-4366.196) * [-4366.899] (-4371.261) (-4367.650) (-4367.329) -- 0:04:34
      105000 -- (-4366.409) (-4367.267) (-4370.171) [-4363.702] * (-4366.542) (-4373.701) (-4368.987) [-4368.369] -- 0:04:41

      Average standard deviation of split frequencies: 0.000000

      105500 -- [-4361.928] (-4376.737) (-4366.551) (-4362.100) * (-4362.176) (-4370.181) (-4364.802) [-4366.029] -- 0:04:39
      106000 -- (-4364.788) (-4362.530) (-4362.519) [-4371.131] * [-4365.312] (-4367.659) (-4365.806) (-4362.782) -- 0:04:38
      106500 -- [-4363.243] (-4370.659) (-4364.158) (-4372.516) * (-4367.078) [-4365.099] (-4368.549) (-4369.622) -- 0:04:36
      107000 -- (-4367.129) (-4363.309) [-4366.622] (-4372.555) * (-4368.270) (-4368.205) (-4366.949) [-4367.343] -- 0:04:35
      107500 -- (-4364.305) (-4359.291) (-4360.739) [-4372.652] * (-4365.299) (-4365.470) (-4369.119) [-4367.113] -- 0:04:33
      108000 -- (-4362.865) (-4368.166) [-4363.698] (-4371.841) * (-4366.219) (-4365.117) [-4369.945] (-4369.117) -- 0:04:40
      108500 -- [-4369.989] (-4364.585) (-4362.735) (-4363.654) * (-4363.203) (-4367.039) (-4370.800) [-4361.349] -- 0:04:39
      109000 -- [-4367.385] (-4367.450) (-4363.729) (-4362.824) * [-4370.293] (-4362.987) (-4368.427) (-4365.088) -- 0:04:37
      109500 -- [-4372.732] (-4378.105) (-4361.737) (-4366.412) * [-4363.540] (-4365.678) (-4370.118) (-4365.356) -- 0:04:36
      110000 -- (-4367.853) (-4370.343) (-4360.405) [-4366.826] * [-4368.434] (-4363.330) (-4370.372) (-4367.976) -- 0:04:35

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-4369.511) (-4366.946) [-4363.992] (-4366.865) * [-4367.458] (-4368.203) (-4368.976) (-4367.882) -- 0:04:33
      111000 -- [-4370.408] (-4364.262) (-4364.371) (-4366.252) * (-4370.635) [-4366.186] (-4361.094) (-4368.488) -- 0:04:32
      111500 -- (-4370.064) (-4369.178) (-4369.477) [-4368.683] * [-4361.376] (-4365.147) (-4363.560) (-4369.885) -- 0:04:38
      112000 -- (-4368.169) (-4367.004) [-4363.943] (-4371.423) * (-4365.576) (-4367.944) (-4364.122) [-4365.740] -- 0:04:37
      112500 -- [-4361.480] (-4362.451) (-4364.147) (-4368.631) * (-4366.953) (-4372.070) (-4365.576) [-4362.630] -- 0:04:36
      113000 -- (-4371.542) (-4362.520) [-4363.689] (-4364.125) * (-4371.777) (-4365.813) (-4367.835) [-4362.531] -- 0:04:34
      113500 -- (-4363.040) (-4364.873) [-4362.324] (-4368.249) * (-4367.133) (-4374.957) (-4367.513) [-4360.563] -- 0:04:33
      114000 -- (-4360.268) [-4363.562] (-4362.861) (-4369.404) * [-4363.182] (-4370.477) (-4365.501) (-4364.182) -- 0:04:32
      114500 -- (-4362.958) [-4366.158] (-4359.813) (-4369.426) * [-4364.915] (-4382.956) (-4370.667) (-4362.316) -- 0:04:38
      115000 -- (-4363.843) (-4364.778) [-4361.269] (-4367.643) * [-4367.658] (-4365.427) (-4372.194) (-4364.364) -- 0:04:37

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-4366.671) (-4365.488) [-4360.226] (-4364.003) * [-4363.487] (-4374.987) (-4373.164) (-4362.063) -- 0:04:35
      116000 -- [-4363.511] (-4361.962) (-4368.506) (-4361.568) * (-4368.606) [-4372.063] (-4365.516) (-4363.251) -- 0:04:34
      116500 -- (-4368.028) (-4364.889) [-4364.305] (-4363.990) * (-4362.776) [-4366.796] (-4362.970) (-4362.521) -- 0:04:33
      117000 -- (-4367.801) (-4366.969) (-4367.186) [-4369.720] * (-4365.310) (-4363.613) (-4372.273) [-4362.465] -- 0:04:31
      117500 -- (-4366.785) [-4363.789] (-4362.430) (-4371.349) * [-4370.386] (-4362.650) (-4365.978) (-4359.021) -- 0:04:30
      118000 -- (-4363.704) (-4376.987) [-4365.309] (-4366.328) * [-4364.993] (-4365.288) (-4367.027) (-4374.630) -- 0:04:36
      118500 -- (-4365.376) (-4372.848) [-4364.760] (-4367.266) * (-4363.739) (-4365.110) (-4372.379) [-4362.718] -- 0:04:35
      119000 -- [-4364.248] (-4374.394) (-4366.660) (-4373.418) * (-4367.180) (-4369.342) (-4367.211) [-4365.310] -- 0:04:33
      119500 -- (-4367.031) (-4375.176) [-4367.597] (-4369.464) * (-4362.400) (-4370.798) [-4366.001] (-4366.222) -- 0:04:32
      120000 -- [-4367.808] (-4378.141) (-4368.247) (-4365.318) * (-4364.070) [-4364.636] (-4365.622) (-4364.066) -- 0:04:31

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-4366.344) [-4364.370] (-4364.259) (-4362.495) * [-4366.655] (-4363.356) (-4368.243) (-4365.288) -- 0:04:30
      121000 -- (-4366.119) (-4371.801) (-4376.718) [-4362.682] * (-4365.550) (-4371.136) [-4365.622] (-4364.609) -- 0:04:28
      121500 -- [-4360.447] (-4367.297) (-4371.548) (-4368.765) * (-4363.199) (-4369.760) (-4367.656) [-4363.196] -- 0:04:34
      122000 -- (-4367.327) (-4365.484) [-4362.180] (-4366.793) * (-4361.609) (-4362.489) (-4366.920) [-4365.011] -- 0:04:33
      122500 -- (-4361.351) (-4371.195) [-4362.341] (-4368.788) * (-4370.635) (-4366.329) (-4363.923) [-4365.007] -- 0:04:32
      123000 -- [-4363.486] (-4366.054) (-4372.263) (-4367.765) * (-4365.168) (-4366.100) (-4370.107) [-4364.863] -- 0:04:30
      123500 -- [-4374.905] (-4368.229) (-4371.407) (-4370.114) * (-4366.192) (-4376.082) (-4368.071) [-4363.741] -- 0:04:29
      124000 -- (-4368.650) [-4365.918] (-4369.203) (-4366.934) * (-4371.661) (-4371.169) [-4371.422] (-4369.012) -- 0:04:28
      124500 -- (-4364.539) (-4370.653) (-4367.248) [-4367.856] * [-4366.753] (-4369.464) (-4370.411) (-4363.832) -- 0:04:34
      125000 -- [-4370.372] (-4368.502) (-4368.255) (-4364.467) * (-4363.678) (-4373.031) [-4371.891] (-4368.315) -- 0:04:33

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-4368.016) [-4364.351] (-4369.976) (-4365.596) * [-4361.568] (-4366.559) (-4365.603) (-4372.404) -- 0:04:31
      126000 -- (-4367.406) (-4361.984) [-4365.254] (-4376.148) * (-4370.901) (-4365.368) (-4364.145) [-4362.361] -- 0:04:30
      126500 -- [-4366.262] (-4369.593) (-4362.536) (-4368.223) * (-4367.472) [-4364.241] (-4371.573) (-4367.554) -- 0:04:29
      127000 -- (-4370.350) [-4363.062] (-4366.180) (-4376.085) * (-4362.700) [-4366.078] (-4370.328) (-4361.180) -- 0:04:28
      127500 -- (-4366.973) (-4370.694) [-4370.267] (-4371.521) * (-4365.062) (-4364.210) [-4375.053] (-4367.928) -- 0:04:26
      128000 -- (-4365.189) (-4366.163) [-4364.496] (-4374.431) * [-4367.436] (-4368.704) (-4371.399) (-4369.109) -- 0:04:32
      128500 -- (-4375.112) [-4362.494] (-4368.782) (-4370.631) * [-4361.416] (-4369.828) (-4367.191) (-4369.574) -- 0:04:31
      129000 -- [-4365.377] (-4365.586) (-4361.813) (-4367.195) * (-4364.800) [-4362.236] (-4370.869) (-4368.780) -- 0:04:30
      129500 -- (-4369.206) (-4369.341) (-4364.201) [-4368.690] * (-4363.645) (-4368.550) (-4373.653) [-4362.513] -- 0:04:28
      130000 -- (-4365.235) [-4365.876] (-4364.785) (-4372.245) * (-4368.564) (-4369.024) [-4366.739] (-4363.239) -- 0:04:27

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-4370.419) (-4367.075) [-4366.143] (-4371.836) * (-4370.588) [-4366.620] (-4363.766) (-4367.020) -- 0:04:26
      131000 -- (-4369.763) (-4371.621) (-4374.880) [-4367.654] * (-4368.643) [-4362.471] (-4373.763) (-4375.935) -- 0:04:31
      131500 -- (-4377.762) (-4371.695) [-4362.748] (-4372.609) * (-4368.277) (-4372.728) [-4361.410] (-4372.534) -- 0:04:30
      132000 -- (-4372.323) (-4365.986) (-4371.356) [-4367.714] * (-4358.831) (-4368.117) (-4365.448) [-4364.870] -- 0:04:29
      132500 -- (-4367.755) [-4367.144] (-4373.185) (-4371.979) * [-4367.073] (-4377.461) (-4367.171) (-4367.341) -- 0:04:28
      133000 -- (-4365.032) (-4364.537) [-4367.100] (-4364.641) * (-4373.522) [-4362.892] (-4360.729) (-4367.702) -- 0:04:27
      133500 -- [-4366.803] (-4362.107) (-4363.935) (-4364.491) * (-4364.093) (-4364.998) (-4363.062) [-4365.320] -- 0:04:26
      134000 -- [-4367.182] (-4365.780) (-4363.525) (-4366.626) * (-4363.140) (-4362.179) [-4364.981] (-4366.513) -- 0:04:24
      134500 -- (-4364.242) (-4370.712) (-4369.170) [-4365.927] * (-4362.065) [-4369.101] (-4361.746) (-4366.264) -- 0:04:30
      135000 -- (-4365.159) (-4375.215) (-4369.085) [-4365.448] * (-4363.702) (-4364.917) [-4362.707] (-4367.590) -- 0:04:29

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-4360.798) [-4366.385] (-4365.897) (-4366.559) * [-4364.681] (-4370.270) (-4365.689) (-4371.948) -- 0:04:27
      136000 -- (-4362.826) (-4367.040) (-4368.447) [-4369.409] * [-4362.190] (-4366.991) (-4364.991) (-4365.117) -- 0:04:26
      136500 -- (-4366.838) [-4368.657] (-4367.917) (-4367.111) * (-4369.384) (-4367.615) [-4365.542] (-4362.651) -- 0:04:25
      137000 -- [-4365.788] (-4369.470) (-4372.372) (-4361.599) * (-4372.645) (-4375.330) (-4369.568) [-4363.854] -- 0:04:24
      137500 -- (-4370.080) (-4364.274) (-4374.377) [-4367.761] * (-4368.659) (-4371.597) (-4365.550) [-4367.747] -- 0:04:29
      138000 -- (-4367.994) (-4369.313) (-4365.502) [-4367.377] * [-4363.360] (-4370.653) (-4368.879) (-4366.858) -- 0:04:28
      138500 -- (-4364.518) [-4368.425] (-4369.163) (-4360.958) * (-4361.506) (-4362.625) [-4364.757] (-4372.968) -- 0:04:27
      139000 -- [-4367.394] (-4366.478) (-4365.164) (-4368.388) * (-4367.723) [-4364.710] (-4364.752) (-4365.135) -- 0:04:26
      139500 -- (-4366.730) (-4366.217) [-4374.033] (-4367.978) * (-4361.260) [-4366.128] (-4366.177) (-4363.946) -- 0:04:25
      140000 -- (-4363.158) [-4365.783] (-4371.586) (-4371.896) * (-4362.961) (-4370.823) [-4370.091] (-4365.732) -- 0:04:24

      Average standard deviation of split frequencies: 0.000000

      140500 -- [-4358.771] (-4367.291) (-4375.026) (-4367.170) * (-4372.013) (-4366.572) (-4363.046) [-4361.679] -- 0:04:23
      141000 -- [-4367.985] (-4366.838) (-4362.459) (-4372.997) * (-4367.596) (-4365.106) [-4366.787] (-4368.924) -- 0:04:28
      141500 -- [-4363.433] (-4367.857) (-4363.352) (-4362.448) * (-4366.053) (-4361.945) [-4368.376] (-4366.207) -- 0:04:26
      142000 -- (-4369.089) (-4368.887) (-4365.026) [-4364.805] * (-4361.748) (-4361.513) [-4363.993] (-4365.931) -- 0:04:25
      142500 -- (-4372.829) (-4372.995) [-4363.897] (-4369.802) * [-4362.657] (-4370.701) (-4365.213) (-4369.283) -- 0:04:24
      143000 -- (-4361.705) (-4365.069) [-4365.250] (-4365.565) * (-4364.876) (-4366.032) [-4366.409] (-4365.562) -- 0:04:23
      143500 -- (-4363.809) [-4360.162] (-4371.720) (-4361.848) * (-4366.709) [-4368.221] (-4364.099) (-4368.812) -- 0:04:22
      144000 -- (-4360.697) (-4362.611) (-4376.618) [-4366.151] * (-4360.459) (-4367.613) [-4363.539] (-4372.393) -- 0:04:27
      144500 -- (-4366.119) [-4365.725] (-4368.284) (-4369.880) * (-4369.209) (-4372.996) [-4365.132] (-4371.837) -- 0:04:26
      145000 -- [-4361.852] (-4374.948) (-4367.740) (-4370.214) * (-4365.374) (-4370.393) (-4371.043) [-4372.052] -- 0:04:25

      Average standard deviation of split frequencies: 0.000000

      145500 -- [-4362.155] (-4367.546) (-4367.865) (-4365.703) * [-4371.146] (-4364.975) (-4367.611) (-4373.706) -- 0:04:24
      146000 -- (-4365.101) [-4363.667] (-4364.490) (-4364.452) * (-4366.697) (-4360.498) (-4367.638) [-4371.763] -- 0:04:23
      146500 -- (-4367.102) (-4367.634) [-4367.396] (-4370.045) * (-4366.292) [-4360.462] (-4364.919) (-4364.082) -- 0:04:22
      147000 -- (-4362.157) (-4365.231) [-4366.363] (-4372.081) * (-4362.077) (-4370.085) (-4366.586) [-4365.538] -- 0:04:21
      147500 -- (-4365.645) (-4378.661) [-4366.325] (-4365.263) * (-4363.374) (-4365.554) [-4364.332] (-4369.546) -- 0:04:25
      148000 -- (-4369.889) (-4367.785) [-4367.997] (-4366.372) * (-4372.121) (-4368.173) [-4362.070] (-4362.788) -- 0:04:24
      148500 -- (-4378.263) (-4367.536) [-4367.525] (-4364.028) * (-4367.272) [-4366.018] (-4373.843) (-4365.739) -- 0:04:23
      149000 -- (-4365.195) [-4366.102] (-4368.234) (-4373.099) * (-4362.711) (-4362.736) [-4371.032] (-4365.988) -- 0:04:22
      149500 -- [-4365.182] (-4390.973) (-4370.692) (-4367.405) * [-4363.615] (-4367.552) (-4366.627) (-4371.376) -- 0:04:21
      150000 -- (-4372.284) (-4373.151) (-4363.172) [-4366.384] * [-4364.541] (-4365.121) (-4363.121) (-4368.774) -- 0:04:20

      Average standard deviation of split frequencies: 0.000000

      150500 -- [-4363.391] (-4364.860) (-4364.788) (-4364.467) * [-4361.639] (-4370.257) (-4369.150) (-4366.105) -- 0:04:19
      151000 -- (-4366.021) [-4367.922] (-4367.492) (-4365.209) * (-4362.508) (-4364.138) (-4362.384) [-4371.871] -- 0:04:24
      151500 -- (-4368.061) (-4373.822) [-4365.073] (-4360.500) * [-4368.233] (-4366.135) (-4366.834) (-4367.718) -- 0:04:23
      152000 -- [-4371.471] (-4373.830) (-4372.290) (-4365.260) * (-4374.654) (-4361.821) (-4365.944) [-4365.549] -- 0:04:22
      152500 -- [-4364.303] (-4372.882) (-4365.495) (-4366.976) * (-4366.229) (-4369.923) [-4363.489] (-4369.698) -- 0:04:21
      153000 -- (-4361.490) (-4364.545) [-4360.840] (-4360.624) * [-4362.539] (-4367.501) (-4362.834) (-4367.638) -- 0:04:20
      153500 -- (-4362.047) [-4367.896] (-4367.199) (-4371.020) * [-4359.610] (-4366.941) (-4365.315) (-4365.482) -- 0:04:19
      154000 -- (-4363.894) [-4368.885] (-4371.871) (-4366.887) * (-4363.226) [-4363.462] (-4374.516) (-4366.720) -- 0:04:23
      154500 -- (-4367.339) (-4371.056) [-4362.732] (-4372.529) * (-4367.219) (-4368.192) [-4364.130] (-4364.519) -- 0:04:22
      155000 -- (-4373.532) (-4365.701) [-4363.500] (-4370.564) * (-4367.615) (-4368.571) (-4366.716) [-4364.941] -- 0:04:21

      Average standard deviation of split frequencies: 0.000000

      155500 -- [-4364.421] (-4363.294) (-4364.761) (-4366.604) * [-4363.029] (-4365.729) (-4369.619) (-4365.711) -- 0:04:20
      156000 -- (-4365.038) (-4369.836) [-4363.622] (-4370.161) * (-4364.056) [-4367.454] (-4363.265) (-4363.543) -- 0:04:19
      156500 -- (-4366.268) (-4369.514) [-4373.732] (-4375.221) * (-4364.566) (-4373.071) [-4365.073] (-4369.587) -- 0:04:18
      157000 -- [-4367.177] (-4360.779) (-4367.691) (-4369.960) * (-4365.246) (-4368.517) (-4367.762) [-4367.284] -- 0:04:17
      157500 -- (-4363.833) (-4366.366) (-4367.927) [-4372.269] * (-4364.770) (-4368.636) (-4368.724) [-4366.164] -- 0:04:22
      158000 -- (-4362.816) (-4367.594) [-4360.311] (-4365.628) * (-4372.284) (-4368.208) (-4372.208) [-4362.660] -- 0:04:21
      158500 -- [-4367.575] (-4365.721) (-4365.505) (-4370.081) * (-4363.984) (-4377.086) (-4366.830) [-4367.220] -- 0:04:20
      159000 -- [-4366.507] (-4380.778) (-4368.838) (-4368.529) * (-4372.078) [-4364.549] (-4365.797) (-4367.060) -- 0:04:19
      159500 -- [-4363.840] (-4360.032) (-4368.461) (-4366.704) * [-4366.804] (-4366.116) (-4361.104) (-4370.358) -- 0:04:18
      160000 -- (-4365.539) (-4369.022) (-4361.972) [-4367.825] * [-4366.773] (-4361.505) (-4370.396) (-4368.539) -- 0:04:17

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-4362.910) (-4365.231) [-4367.896] (-4366.440) * (-4370.286) [-4363.825] (-4369.995) (-4364.368) -- 0:04:21
      161000 -- (-4368.109) [-4365.100] (-4365.389) (-4367.404) * (-4365.536) (-4365.981) (-4377.592) [-4371.509] -- 0:04:20
      161500 -- (-4365.311) (-4374.218) [-4365.919] (-4369.936) * [-4360.055] (-4366.328) (-4365.097) (-4367.820) -- 0:04:19
      162000 -- (-4364.194) (-4365.484) [-4370.129] (-4369.451) * (-4365.850) [-4367.879] (-4366.758) (-4371.340) -- 0:04:18
      162500 -- [-4366.081] (-4368.003) (-4373.841) (-4364.656) * (-4362.545) (-4376.182) [-4370.395] (-4376.265) -- 0:04:17
      163000 -- [-4361.878] (-4363.245) (-4375.876) (-4362.940) * [-4362.278] (-4373.208) (-4369.264) (-4375.536) -- 0:04:16
      163500 -- [-4362.343] (-4364.960) (-4370.084) (-4365.965) * [-4363.676] (-4368.155) (-4363.284) (-4378.084) -- 0:04:15
      164000 -- (-4361.672) (-4360.192) [-4366.867] (-4370.595) * (-4375.821) (-4366.370) [-4362.537] (-4365.954) -- 0:04:19
      164500 -- [-4364.433] (-4373.707) (-4369.720) (-4370.945) * (-4370.601) (-4375.002) (-4364.200) [-4364.814] -- 0:04:19
      165000 -- (-4366.097) (-4371.428) (-4366.645) [-4362.877] * [-4367.551] (-4368.196) (-4367.442) (-4362.123) -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-4363.543] (-4370.706) (-4366.982) (-4361.143) * (-4367.666) (-4369.543) [-4363.320] (-4363.828) -- 0:04:17
      166000 -- (-4371.974) (-4369.552) [-4362.450] (-4365.155) * (-4363.135) (-4370.652) (-4365.703) [-4363.263] -- 0:04:16
      166500 -- (-4363.259) (-4362.201) [-4367.525] (-4366.818) * (-4367.581) (-4365.844) (-4368.597) [-4360.141] -- 0:04:15
      167000 -- [-4364.138] (-4375.169) (-4362.225) (-4367.863) * (-4367.057) [-4362.574] (-4367.564) (-4365.433) -- 0:04:19
      167500 -- (-4370.185) (-4369.648) [-4358.802] (-4365.670) * [-4368.275] (-4366.505) (-4363.835) (-4361.455) -- 0:04:18
      168000 -- (-4373.179) (-4369.230) [-4364.105] (-4367.671) * (-4369.321) (-4365.758) [-4360.719] (-4373.737) -- 0:04:17
      168500 -- (-4373.455) (-4372.644) (-4363.453) [-4362.111] * (-4367.330) (-4366.601) (-4366.834) [-4364.531] -- 0:04:16
      169000 -- (-4370.356) [-4364.817] (-4363.920) (-4365.519) * (-4369.016) (-4369.491) [-4370.363] (-4369.580) -- 0:04:15
      169500 -- (-4365.936) (-4375.176) [-4366.773] (-4365.338) * (-4368.450) (-4374.018) (-4362.195) [-4366.241] -- 0:04:14
      170000 -- (-4365.071) (-4370.827) [-4358.826] (-4363.228) * (-4370.548) (-4367.253) [-4373.145] (-4369.170) -- 0:04:13

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-4365.122) (-4365.611) [-4360.754] (-4362.274) * [-4369.273] (-4370.623) (-4365.591) (-4367.514) -- 0:04:17
      171000 -- (-4363.150) (-4372.973) (-4371.556) [-4375.169] * [-4364.348] (-4370.016) (-4363.358) (-4368.325) -- 0:04:16
      171500 -- (-4369.182) [-4364.922] (-4374.681) (-4368.863) * (-4369.553) (-4360.913) [-4362.701] (-4369.266) -- 0:04:16
      172000 -- (-4363.620) (-4369.073) (-4361.507) [-4365.483] * (-4365.735) (-4364.231) (-4363.594) [-4367.884] -- 0:04:15
      172500 -- (-4361.496) (-4362.982) [-4365.421] (-4370.993) * (-4363.831) [-4365.947] (-4366.003) (-4366.654) -- 0:04:14
      173000 -- [-4359.804] (-4372.897) (-4371.697) (-4368.275) * (-4361.835) (-4362.988) (-4366.553) [-4364.002] -- 0:04:13
      173500 -- (-4365.162) [-4365.153] (-4362.332) (-4367.835) * (-4361.783) [-4366.349] (-4368.105) (-4368.519) -- 0:04:12
      174000 -- [-4366.894] (-4365.003) (-4362.805) (-4364.782) * (-4374.006) [-4364.964] (-4362.244) (-4362.707) -- 0:04:16
      174500 -- [-4364.617] (-4362.905) (-4361.473) (-4365.527) * (-4367.770) [-4367.277] (-4361.355) (-4370.522) -- 0:04:15
      175000 -- (-4364.332) (-4368.282) (-4364.780) [-4361.708] * [-4367.483] (-4367.317) (-4367.058) (-4363.416) -- 0:04:14

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-4370.600) (-4362.761) [-4370.094] (-4365.051) * [-4366.670] (-4369.298) (-4364.984) (-4365.397) -- 0:04:13
      176000 -- (-4365.768) [-4363.572] (-4368.112) (-4366.067) * (-4366.170) (-4362.780) [-4362.911] (-4367.251) -- 0:04:12
      176500 -- (-4367.104) (-4364.114) (-4364.391) [-4365.712] * (-4370.439) (-4360.120) (-4367.936) [-4360.562] -- 0:04:11
      177000 -- (-4365.812) (-4362.240) (-4367.014) [-4365.001] * [-4372.925] (-4370.608) (-4364.501) (-4366.737) -- 0:04:15
      177500 -- (-4366.319) (-4364.900) (-4362.416) [-4363.678] * [-4365.390] (-4378.912) (-4364.705) (-4366.773) -- 0:04:14
      178000 -- (-4365.135) (-4365.109) (-4368.099) [-4358.744] * (-4364.911) [-4367.202] (-4368.785) (-4362.949) -- 0:04:13
      178500 -- (-4365.705) (-4366.073) [-4365.887] (-4360.812) * (-4359.991) (-4363.370) (-4366.951) [-4361.684] -- 0:04:13
      179000 -- [-4367.925] (-4368.736) (-4366.717) (-4368.274) * (-4367.653) [-4365.750] (-4365.373) (-4362.779) -- 0:04:12
      179500 -- (-4360.446) (-4366.252) (-4370.610) [-4363.303] * (-4364.806) (-4368.624) (-4362.518) [-4362.493] -- 0:04:11
      180000 -- (-4364.691) (-4365.974) (-4363.226) [-4363.594] * (-4362.294) [-4361.037] (-4363.683) (-4368.627) -- 0:04:15

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-4362.887) (-4366.016) [-4364.632] (-4370.294) * (-4367.591) [-4362.095] (-4369.894) (-4365.449) -- 0:04:14
      181000 -- [-4363.699] (-4372.363) (-4365.927) (-4364.722) * (-4365.381) (-4368.599) (-4372.653) [-4360.588] -- 0:04:13
      181500 -- [-4367.986] (-4372.694) (-4372.577) (-4363.285) * (-4363.907) [-4361.305] (-4370.545) (-4370.204) -- 0:04:12
      182000 -- (-4361.894) [-4366.148] (-4370.996) (-4365.974) * (-4365.549) [-4369.518] (-4369.745) (-4368.944) -- 0:04:11
      182500 -- (-4373.065) [-4370.090] (-4366.868) (-4376.422) * [-4365.829] (-4373.893) (-4367.684) (-4368.549) -- 0:04:10
      183000 -- [-4359.949] (-4365.062) (-4369.151) (-4371.077) * [-4363.951] (-4376.065) (-4374.639) (-4364.706) -- 0:04:10
      183500 -- (-4361.243) [-4360.475] (-4365.285) (-4372.437) * (-4371.829) (-4363.984) [-4368.485] (-4370.873) -- 0:04:13
      184000 -- [-4361.987] (-4368.205) (-4363.078) (-4363.907) * (-4371.525) (-4374.584) [-4370.638] (-4366.664) -- 0:04:12
      184500 -- (-4361.264) (-4367.949) [-4365.099] (-4373.952) * (-4368.757) (-4372.374) [-4366.249] (-4366.009) -- 0:04:11
      185000 -- (-4370.370) [-4366.503] (-4371.579) (-4376.350) * [-4365.942] (-4369.532) (-4369.397) (-4374.135) -- 0:04:11

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-4366.204) [-4367.041] (-4369.887) (-4370.176) * (-4365.057) (-4369.928) [-4365.591] (-4370.005) -- 0:04:10
      186000 -- (-4363.189) [-4363.564] (-4366.437) (-4364.647) * (-4372.700) (-4377.129) [-4367.130] (-4368.020) -- 0:04:09
      186500 -- [-4363.855] (-4365.061) (-4373.265) (-4363.117) * (-4371.738) (-4369.025) [-4362.873] (-4366.176) -- 0:04:08
      187000 -- (-4371.192) (-4365.464) (-4369.288) [-4365.076] * (-4361.462) (-4363.677) (-4368.237) [-4361.006] -- 0:04:12
      187500 -- (-4373.252) (-4368.239) (-4369.614) [-4364.630] * [-4362.446] (-4371.152) (-4363.192) (-4360.290) -- 0:04:11
      188000 -- (-4363.149) (-4368.262) [-4365.706] (-4364.281) * (-4367.026) (-4369.560) [-4364.498] (-4363.765) -- 0:04:10
      188500 -- [-4362.298] (-4367.330) (-4364.727) (-4367.721) * (-4368.948) (-4368.126) (-4364.614) [-4367.700] -- 0:04:09
      189000 -- [-4366.010] (-4369.584) (-4363.489) (-4365.351) * (-4363.264) [-4361.614] (-4361.057) (-4364.152) -- 0:04:08
      189500 -- (-4368.517) [-4368.315] (-4369.930) (-4361.729) * (-4371.898) (-4360.098) (-4366.494) [-4369.476] -- 0:04:12
      190000 -- (-4373.455) (-4375.207) (-4363.763) [-4359.605] * (-4368.782) (-4367.117) [-4367.752] (-4365.937) -- 0:04:11

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-4366.764) (-4366.257) [-4363.271] (-4369.144) * [-4366.225] (-4366.655) (-4360.662) (-4365.033) -- 0:04:10
      191000 -- (-4370.131) (-4368.685) (-4369.319) [-4367.736] * [-4366.704] (-4370.583) (-4371.097) (-4365.908) -- 0:04:09
      191500 -- (-4372.352) [-4367.203] (-4363.136) (-4366.501) * (-4368.207) [-4367.854] (-4365.169) (-4367.133) -- 0:04:09
      192000 -- (-4364.335) (-4367.080) [-4365.222] (-4360.927) * (-4372.530) [-4367.506] (-4372.199) (-4365.557) -- 0:04:08
      192500 -- (-4370.811) (-4368.305) [-4360.410] (-4364.869) * [-4371.314] (-4367.114) (-4368.924) (-4361.194) -- 0:04:07
      193000 -- (-4362.944) [-4371.739] (-4370.141) (-4364.758) * (-4366.556) (-4360.926) (-4362.002) [-4361.747] -- 0:04:10
      193500 -- (-4368.374) [-4363.857] (-4366.630) (-4362.028) * [-4365.842] (-4369.898) (-4370.342) (-4370.338) -- 0:04:10
      194000 -- (-4367.787) (-4366.588) (-4367.517) [-4365.042] * (-4364.095) (-4364.054) [-4363.554] (-4369.338) -- 0:04:09
      194500 -- (-4364.337) (-4369.655) [-4365.008] (-4368.664) * (-4365.773) [-4366.838] (-4368.162) (-4372.695) -- 0:04:08
      195000 -- (-4365.081) (-4366.719) [-4368.471] (-4369.171) * (-4372.561) (-4366.312) [-4363.770] (-4362.209) -- 0:04:07

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-4368.779) [-4368.509] (-4368.877) (-4371.808) * (-4364.657) (-4368.956) [-4363.488] (-4366.357) -- 0:04:06
      196000 -- (-4367.077) (-4367.660) (-4367.291) [-4360.977] * (-4365.112) (-4367.285) [-4362.769] (-4363.576) -- 0:04:10
      196500 -- [-4367.070] (-4371.231) (-4368.430) (-4361.996) * [-4360.191] (-4360.878) (-4364.560) (-4371.118) -- 0:04:09
      197000 -- [-4360.951] (-4361.853) (-4368.270) (-4371.889) * (-4366.922) [-4361.645] (-4362.211) (-4368.557) -- 0:04:08
      197500 -- (-4365.850) (-4368.529) (-4372.704) [-4366.019] * [-4361.895] (-4363.103) (-4368.078) (-4362.848) -- 0:04:07
      198000 -- [-4364.954] (-4363.318) (-4370.601) (-4369.662) * (-4370.715) (-4361.119) (-4372.229) [-4369.430] -- 0:04:07
      198500 -- [-4368.776] (-4371.814) (-4367.686) (-4372.123) * (-4368.934) [-4365.692] (-4364.858) (-4364.749) -- 0:04:06
      199000 -- (-4362.612) [-4363.253] (-4362.034) (-4368.785) * (-4373.270) [-4362.657] (-4364.258) (-4362.109) -- 0:04:05
      199500 -- (-4365.628) [-4371.086] (-4366.576) (-4368.720) * (-4369.318) (-4366.061) (-4365.518) [-4361.983] -- 0:04:08
      200000 -- (-4364.390) (-4366.056) [-4365.974] (-4373.752) * [-4367.063] (-4379.257) (-4363.262) (-4368.121) -- 0:04:08

      Average standard deviation of split frequencies: 0.000000

      200500 -- [-4364.413] (-4366.243) (-4360.881) (-4366.661) * (-4372.296) [-4364.782] (-4370.614) (-4368.483) -- 0:04:07
      201000 -- (-4367.867) (-4365.066) [-4369.677] (-4369.474) * (-4366.030) (-4369.022) (-4364.790) [-4360.886] -- 0:04:06
      201500 -- [-4371.713] (-4362.233) (-4364.556) (-4368.935) * [-4362.938] (-4366.302) (-4371.802) (-4362.511) -- 0:04:05
      202000 -- [-4365.097] (-4363.398) (-4368.372) (-4374.497) * (-4370.138) (-4367.005) [-4376.838] (-4361.236) -- 0:04:04
      202500 -- (-4365.471) (-4364.162) (-4369.023) [-4369.545] * (-4364.810) (-4368.702) (-4368.086) [-4361.114] -- 0:04:08
      203000 -- (-4362.603) (-4366.975) [-4365.916] (-4362.661) * [-4366.664] (-4371.389) (-4370.264) (-4363.916) -- 0:04:07
      203500 -- (-4364.144) (-4364.174) [-4368.215] (-4369.836) * (-4369.554) [-4365.353] (-4366.286) (-4368.126) -- 0:04:06
      204000 -- [-4362.224] (-4368.395) (-4366.698) (-4368.215) * (-4366.175) (-4361.118) (-4368.260) [-4364.528] -- 0:04:05
      204500 -- (-4375.520) (-4369.175) [-4362.911] (-4361.504) * [-4369.779] (-4372.154) (-4361.685) (-4362.404) -- 0:04:05
      205000 -- (-4366.964) [-4370.319] (-4374.400) (-4369.704) * [-4364.037] (-4365.271) (-4360.401) (-4361.571) -- 0:04:04

      Average standard deviation of split frequencies: 0.000000

      205500 -- [-4370.053] (-4371.712) (-4369.835) (-4362.180) * (-4368.808) (-4369.572) [-4367.745] (-4362.819) -- 0:04:03
      206000 -- (-4366.698) (-4376.851) (-4366.260) [-4365.161] * (-4368.027) [-4367.271] (-4378.706) (-4361.967) -- 0:04:06
      206500 -- (-4361.899) (-4372.691) [-4364.737] (-4369.313) * (-4363.177) [-4365.652] (-4375.858) (-4368.880) -- 0:04:05
      207000 -- (-4366.077) [-4363.251] (-4367.794) (-4363.545) * (-4368.551) (-4363.805) [-4371.251] (-4367.501) -- 0:04:05
      207500 -- (-4364.366) [-4366.882] (-4368.207) (-4373.100) * (-4364.133) (-4366.297) [-4366.322] (-4366.861) -- 0:04:04
      208000 -- (-4364.268) (-4362.924) (-4371.688) [-4370.255] * (-4366.813) (-4371.359) [-4361.834] (-4363.324) -- 0:04:03
      208500 -- [-4368.589] (-4366.670) (-4362.114) (-4365.135) * [-4362.517] (-4369.012) (-4368.848) (-4361.870) -- 0:04:02
      209000 -- [-4364.669] (-4366.713) (-4365.177) (-4366.597) * (-4360.260) (-4372.544) [-4364.309] (-4366.695) -- 0:04:06
      209500 -- (-4368.933) (-4369.671) [-4361.339] (-4364.684) * (-4361.504) [-4364.998] (-4373.561) (-4365.735) -- 0:04:05
      210000 -- [-4367.043] (-4368.370) (-4358.884) (-4364.361) * (-4367.945) (-4370.674) (-4369.179) [-4366.855] -- 0:04:04

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-4367.609) (-4367.949) (-4362.739) [-4370.434] * (-4368.031) [-4363.857] (-4366.326) (-4374.971) -- 0:04:03
      211000 -- (-4366.895) (-4374.977) [-4365.328] (-4365.210) * (-4361.225) (-4362.594) (-4366.324) [-4367.828] -- 0:04:03
      211500 -- (-4371.875) [-4365.650] (-4364.763) (-4379.486) * (-4370.343) [-4367.875] (-4368.720) (-4363.714) -- 0:04:02
      212000 -- (-4364.872) (-4362.214) (-4368.593) [-4363.603] * [-4365.409] (-4364.941) (-4374.134) (-4373.882) -- 0:04:01
      212500 -- (-4367.200) [-4366.965] (-4365.893) (-4366.211) * (-4364.693) [-4360.511] (-4361.472) (-4372.631) -- 0:04:04
      213000 -- (-4372.733) (-4364.811) [-4368.025] (-4368.020) * (-4364.521) (-4363.919) (-4367.059) [-4366.768] -- 0:04:03
      213500 -- (-4369.315) (-4371.220) [-4369.942] (-4374.108) * [-4363.501] (-4360.381) (-4366.048) (-4363.993) -- 0:04:03
      214000 -- (-4368.406) [-4362.746] (-4368.210) (-4362.479) * (-4364.539) [-4368.300] (-4366.714) (-4365.142) -- 0:04:02
      214500 -- (-4365.010) [-4369.589] (-4367.393) (-4358.867) * (-4371.289) [-4371.920] (-4370.033) (-4365.765) -- 0:04:01
      215000 -- (-4364.843) [-4363.523] (-4364.804) (-4369.974) * [-4365.968] (-4365.941) (-4371.603) (-4364.415) -- 0:04:00

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-4367.070) (-4363.772) (-4369.920) [-4368.820] * (-4363.399) [-4368.025] (-4382.483) (-4363.599) -- 0:04:03
      216000 -- (-4365.515) (-4367.166) [-4366.771] (-4375.846) * [-4361.300] (-4364.113) (-4373.051) (-4368.923) -- 0:04:03
      216500 -- [-4369.750] (-4368.982) (-4365.474) (-4371.182) * (-4366.737) (-4362.396) (-4371.666) [-4370.628] -- 0:04:02
      217000 -- (-4367.408) [-4359.862] (-4361.934) (-4368.081) * (-4371.178) (-4364.507) [-4370.875] (-4363.896) -- 0:04:01
      217500 -- (-4359.488) (-4361.984) (-4363.901) [-4364.622] * [-4370.992] (-4366.100) (-4368.574) (-4372.518) -- 0:04:01
      218000 -- (-4369.895) (-4359.285) (-4368.400) [-4370.153] * (-4380.977) (-4366.973) [-4362.889] (-4366.028) -- 0:04:00
      218500 -- (-4363.311) (-4364.402) [-4367.097] (-4374.743) * [-4365.398] (-4365.493) (-4361.210) (-4365.489) -- 0:03:59
      219000 -- (-4365.597) (-4367.617) (-4363.687) [-4371.779] * (-4369.539) (-4377.569) (-4367.179) [-4362.212] -- 0:04:02
      219500 -- (-4362.966) (-4365.611) [-4362.859] (-4368.414) * (-4366.195) (-4368.092) [-4363.156] (-4369.757) -- 0:04:01
      220000 -- (-4362.039) [-4363.809] (-4370.420) (-4375.994) * (-4365.648) [-4367.427] (-4364.647) (-4363.336) -- 0:04:01

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-4365.094) (-4367.759) [-4367.916] (-4372.153) * (-4368.050) (-4372.980) (-4367.735) [-4368.971] -- 0:04:00
      221000 -- [-4363.206] (-4377.058) (-4368.092) (-4366.824) * (-4366.151) [-4366.195] (-4369.245) (-4364.848) -- 0:03:59
      221500 -- (-4366.634) [-4366.503] (-4367.919) (-4362.500) * (-4367.613) [-4366.965] (-4366.635) (-4373.790) -- 0:03:58
      222000 -- (-4364.263) (-4370.485) (-4372.380) [-4362.757] * (-4368.196) [-4368.120] (-4363.036) (-4369.508) -- 0:04:01
      222500 -- (-4369.778) (-4370.304) [-4362.845] (-4362.008) * (-4371.974) (-4366.103) [-4364.818] (-4363.586) -- 0:04:01
      223000 -- (-4375.022) (-4362.768) (-4366.161) [-4363.182] * (-4360.137) [-4364.356] (-4365.096) (-4368.406) -- 0:04:00
      223500 -- [-4359.937] (-4370.436) (-4369.188) (-4362.437) * [-4361.423] (-4367.402) (-4368.811) (-4371.249) -- 0:03:59
      224000 -- [-4369.140] (-4366.204) (-4362.852) (-4373.089) * [-4368.996] (-4366.091) (-4366.329) (-4363.391) -- 0:03:59
      224500 -- (-4372.116) (-4366.104) [-4361.756] (-4367.617) * [-4367.981] (-4368.578) (-4366.978) (-4360.667) -- 0:03:58
      225000 -- (-4369.968) (-4365.509) (-4368.915) [-4362.175] * [-4364.998] (-4365.127) (-4366.858) (-4366.468) -- 0:03:57

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-4366.307) (-4361.256) (-4367.431) [-4367.377] * (-4365.678) (-4368.303) [-4370.795] (-4366.731) -- 0:04:00
      226000 -- (-4363.758) [-4363.529] (-4359.431) (-4368.776) * [-4367.935] (-4369.596) (-4372.778) (-4372.533) -- 0:03:59
      226500 -- (-4365.375) [-4361.662] (-4363.073) (-4372.971) * [-4365.356] (-4368.612) (-4365.661) (-4369.820) -- 0:03:59
      227000 -- (-4363.143) (-4365.994) (-4362.331) [-4368.730] * (-4364.231) (-4372.965) [-4365.406] (-4367.115) -- 0:03:58
      227500 -- [-4366.740] (-4363.158) (-4362.098) (-4371.723) * (-4365.088) (-4364.855) [-4362.481] (-4363.062) -- 0:03:57
      228000 -- (-4366.517) (-4368.446) (-4363.099) [-4365.328] * (-4362.929) [-4365.921] (-4368.111) (-4363.674) -- 0:03:57
      228500 -- (-4369.840) (-4359.679) (-4364.060) [-4369.586] * (-4367.962) (-4367.681) (-4365.355) [-4365.864] -- 0:03:59
      229000 -- (-4367.465) (-4364.820) [-4362.412] (-4365.512) * (-4362.774) (-4368.393) [-4367.632] (-4369.058) -- 0:03:59
      229500 -- (-4374.637) (-4370.839) (-4376.345) [-4365.098] * (-4364.979) (-4361.307) [-4360.334] (-4364.593) -- 0:03:58
      230000 -- (-4369.759) (-4365.419) [-4372.145] (-4366.326) * (-4370.942) (-4372.225) (-4372.231) [-4366.589] -- 0:03:57

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-4371.316) (-4364.115) [-4369.662] (-4366.480) * [-4367.269] (-4360.140) (-4364.824) (-4366.256) -- 0:03:57
      231000 -- [-4363.145] (-4370.171) (-4369.401) (-4366.736) * [-4363.619] (-4371.260) (-4366.057) (-4370.621) -- 0:03:56
      231500 -- (-4372.986) (-4371.819) [-4369.326] (-4368.401) * [-4364.540] (-4366.123) (-4369.432) (-4368.368) -- 0:03:55
      232000 -- [-4365.029] (-4365.013) (-4363.924) (-4365.033) * (-4368.506) [-4367.214] (-4370.037) (-4369.383) -- 0:03:58
      232500 -- (-4367.721) (-4365.223) (-4364.001) [-4362.030] * (-4369.920) (-4362.023) [-4365.981] (-4364.463) -- 0:03:57
      233000 -- (-4360.517) [-4371.001] (-4362.841) (-4368.383) * (-4371.597) [-4363.009] (-4373.841) (-4362.505) -- 0:03:57
      233500 -- (-4368.024) [-4364.069] (-4364.777) (-4363.587) * (-4364.692) [-4363.457] (-4362.071) (-4359.798) -- 0:03:56
      234000 -- (-4363.740) (-4362.735) (-4362.554) [-4365.057] * (-4359.992) (-4366.336) [-4361.146] (-4363.564) -- 0:03:55
      234500 -- [-4366.126] (-4363.401) (-4363.648) (-4375.285) * (-4363.141) [-4363.165] (-4364.805) (-4366.244) -- 0:03:55
      235000 -- [-4370.506] (-4361.647) (-4364.463) (-4368.387) * (-4362.957) [-4369.315] (-4370.374) (-4364.337) -- 0:03:57

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-4366.110) (-4360.008) [-4365.930] (-4365.331) * (-4359.875) (-4367.896) (-4365.495) [-4364.150] -- 0:03:56
      236000 -- (-4367.100) (-4361.777) (-4370.873) [-4368.614] * [-4363.161] (-4370.624) (-4367.367) (-4365.603) -- 0:03:56
      236500 -- (-4367.940) [-4363.204] (-4362.049) (-4368.384) * (-4367.325) (-4364.371) (-4367.130) [-4367.473] -- 0:03:55
      237000 -- (-4370.420) (-4361.500) [-4365.099] (-4369.422) * [-4367.942] (-4370.795) (-4361.453) (-4368.497) -- 0:03:55
      237500 -- (-4369.640) (-4365.188) [-4366.160] (-4367.293) * (-4367.538) [-4364.199] (-4375.646) (-4368.994) -- 0:03:54
      238000 -- [-4368.450] (-4364.947) (-4362.500) (-4364.498) * [-4363.994] (-4369.533) (-4366.664) (-4362.606) -- 0:03:53
      238500 -- (-4373.426) (-4365.675) (-4366.173) [-4362.015] * (-4366.123) (-4363.801) (-4366.948) [-4361.919] -- 0:03:56
      239000 -- (-4373.038) (-4372.098) [-4362.640] (-4362.439) * [-4363.914] (-4368.181) (-4367.275) (-4370.418) -- 0:03:55
      239500 -- (-4372.723) [-4362.590] (-4364.690) (-4367.772) * (-4363.066) [-4362.796] (-4362.234) (-4362.676) -- 0:03:54
      240000 -- (-4376.201) [-4361.292] (-4364.557) (-4364.410) * (-4364.675) [-4364.127] (-4370.743) (-4363.704) -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-4363.845) [-4361.325] (-4368.943) (-4366.852) * (-4362.588) (-4370.149) (-4364.932) [-4364.668] -- 0:03:53
      241000 -- (-4360.389) (-4362.646) (-4375.953) [-4362.906] * (-4371.789) [-4361.270] (-4367.097) (-4371.787) -- 0:03:53
      241500 -- (-4361.066) (-4361.377) [-4373.428] (-4366.766) * (-4378.833) (-4369.330) [-4373.743] (-4370.924) -- 0:03:55
      242000 -- (-4364.373) (-4363.320) [-4366.423] (-4364.443) * [-4369.987] (-4361.221) (-4366.235) (-4370.136) -- 0:03:54
      242500 -- (-4367.513) (-4361.720) [-4363.865] (-4373.535) * [-4366.520] (-4369.407) (-4359.988) (-4368.401) -- 0:03:54
      243000 -- (-4365.541) (-4368.545) [-4363.383] (-4368.539) * [-4370.014] (-4368.298) (-4367.013) (-4365.866) -- 0:03:53
      243500 -- (-4363.514) (-4367.162) [-4368.664] (-4368.918) * (-4368.021) (-4362.870) (-4365.532) [-4372.366] -- 0:03:53
      244000 -- [-4362.203] (-4362.892) (-4362.491) (-4366.083) * (-4366.109) (-4361.932) (-4371.772) [-4363.040] -- 0:03:52
      244500 -- [-4361.972] (-4364.900) (-4368.535) (-4361.864) * [-4366.982] (-4361.867) (-4363.414) (-4359.526) -- 0:03:51
      245000 -- (-4368.702) (-4369.449) (-4362.735) [-4372.717] * (-4362.146) (-4369.632) [-4365.529] (-4372.763) -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-4371.723) (-4361.759) (-4373.859) [-4367.524] * [-4359.665] (-4362.899) (-4365.033) (-4369.143) -- 0:03:53
      246000 -- (-4373.922) [-4365.362] (-4369.064) (-4363.035) * (-4365.005) (-4367.817) [-4363.788] (-4362.969) -- 0:03:52
      246500 -- [-4368.969] (-4369.734) (-4363.098) (-4364.722) * (-4367.006) (-4364.152) (-4361.298) [-4366.800] -- 0:03:52
      247000 -- [-4366.410] (-4370.625) (-4369.795) (-4370.987) * (-4374.014) [-4370.736] (-4364.286) (-4365.688) -- 0:03:51
      247500 -- (-4371.747) (-4364.419) [-4364.852] (-4364.592) * (-4366.527) (-4368.973) (-4366.716) [-4364.804] -- 0:03:51
      248000 -- [-4363.168] (-4361.163) (-4365.550) (-4364.868) * (-4365.143) [-4371.851] (-4363.165) (-4362.298) -- 0:03:53
      248500 -- (-4371.832) [-4364.981] (-4376.775) (-4367.951) * (-4365.325) (-4374.290) [-4365.641] (-4365.381) -- 0:03:52
      249000 -- [-4368.513] (-4366.307) (-4362.089) (-4367.253) * [-4364.342] (-4366.294) (-4364.015) (-4365.209) -- 0:03:52
      249500 -- (-4360.563) (-4368.320) (-4364.673) [-4366.984] * (-4362.969) (-4366.027) (-4363.865) [-4373.200] -- 0:03:51
      250000 -- [-4361.146] (-4368.596) (-4365.861) (-4364.181) * (-4368.418) (-4363.405) [-4363.192] (-4374.285) -- 0:03:51

      Average standard deviation of split frequencies: 0.000000

      250500 -- [-4370.302] (-4369.071) (-4367.137) (-4364.033) * (-4371.624) (-4367.719) [-4364.414] (-4370.527) -- 0:03:50
      251000 -- (-4371.339) (-4363.162) (-4369.635) [-4362.254] * (-4373.628) (-4363.579) (-4367.854) [-4363.663] -- 0:03:52
      251500 -- [-4362.181] (-4378.980) (-4374.371) (-4362.406) * (-4363.313) (-4370.879) [-4368.237] (-4367.967) -- 0:03:52
      252000 -- [-4366.229] (-4369.941) (-4370.394) (-4373.158) * (-4369.142) [-4364.836] (-4359.902) (-4371.905) -- 0:03:51
      252500 -- (-4373.782) (-4371.499) (-4362.684) [-4363.963] * (-4371.331) (-4371.444) [-4364.333] (-4367.972) -- 0:03:50
      253000 -- (-4367.459) [-4368.816] (-4368.617) (-4371.427) * (-4369.906) (-4370.121) (-4374.184) [-4372.212] -- 0:03:50
      253500 -- (-4371.173) (-4369.339) [-4362.855] (-4369.670) * (-4363.066) (-4367.954) (-4362.919) [-4368.523] -- 0:03:49
      254000 -- [-4366.010] (-4366.028) (-4370.025) (-4366.050) * (-4364.534) (-4363.541) (-4369.170) [-4366.842] -- 0:03:49
      254500 -- (-4368.716) [-4363.594] (-4369.577) (-4366.519) * (-4362.201) [-4365.481] (-4360.329) (-4373.815) -- 0:03:51
      255000 -- (-4373.825) (-4366.238) [-4367.500] (-4369.673) * [-4361.628] (-4365.578) (-4361.013) (-4365.326) -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-4368.379) [-4369.235] (-4371.441) (-4373.020) * (-4368.698) (-4367.214) (-4365.838) [-4368.224] -- 0:03:50
      256000 -- (-4363.688) (-4377.219) [-4368.847] (-4375.561) * [-4362.365] (-4365.260) (-4364.776) (-4373.134) -- 0:03:49
      256500 -- (-4370.354) (-4367.428) [-4369.774] (-4372.465) * (-4373.782) (-4366.092) [-4367.436] (-4372.924) -- 0:03:48
      257000 -- (-4363.832) (-4370.231) (-4368.694) [-4369.060] * (-4370.920) (-4360.474) (-4369.209) [-4367.143] -- 0:03:48
      257500 -- (-4373.276) [-4366.504] (-4367.779) (-4362.173) * (-4361.566) (-4362.684) [-4366.384] (-4367.426) -- 0:03:50
      258000 -- (-4374.399) (-4366.066) (-4365.001) [-4363.574] * [-4363.166] (-4365.702) (-4374.321) (-4364.091) -- 0:03:50
      258500 -- (-4367.211) (-4369.804) [-4368.600] (-4371.512) * [-4370.754] (-4369.492) (-4366.311) (-4363.849) -- 0:03:49
      259000 -- [-4363.589] (-4370.983) (-4373.479) (-4367.640) * (-4363.969) (-4366.127) [-4369.512] (-4364.215) -- 0:03:48
      259500 -- (-4367.564) (-4365.081) [-4379.828] (-4363.201) * (-4372.256) (-4368.085) (-4372.025) [-4375.437] -- 0:03:48
      260000 -- [-4362.900] (-4368.671) (-4363.500) (-4366.102) * (-4366.920) (-4362.964) [-4364.145] (-4365.744) -- 0:03:47

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-4367.104) (-4364.707) [-4364.737] (-4372.122) * [-4364.281] (-4364.413) (-4365.111) (-4371.486) -- 0:03:47
      261000 -- [-4359.923] (-4369.462) (-4364.885) (-4368.493) * (-4359.475) (-4363.391) (-4361.433) [-4364.772] -- 0:03:49
      261500 -- [-4363.062] (-4361.793) (-4374.679) (-4362.730) * [-4363.665] (-4365.853) (-4367.963) (-4365.901) -- 0:03:48
      262000 -- (-4366.595) [-4364.791] (-4370.299) (-4371.024) * (-4361.356) (-4366.057) (-4368.227) [-4361.511] -- 0:03:48
      262500 -- (-4364.755) (-4362.652) (-4373.674) [-4368.144] * (-4358.768) (-4369.338) (-4372.086) [-4363.775] -- 0:03:47
      263000 -- (-4361.666) [-4363.490] (-4368.590) (-4369.781) * (-4365.470) (-4366.315) [-4367.386] (-4365.389) -- 0:03:46
      263500 -- (-4361.681) [-4364.084] (-4365.165) (-4362.383) * [-4363.275] (-4365.513) (-4368.520) (-4363.233) -- 0:03:46
      264000 -- (-4362.693) [-4365.383] (-4367.027) (-4365.969) * (-4369.660) (-4370.740) [-4364.511] (-4369.757) -- 0:03:48
      264500 -- (-4366.724) [-4362.500] (-4363.476) (-4368.734) * (-4365.562) (-4376.543) (-4376.565) [-4370.348] -- 0:03:48
      265000 -- (-4365.181) (-4366.253) (-4368.263) [-4369.316] * [-4367.649] (-4366.953) (-4378.364) (-4367.647) -- 0:03:47

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-4365.686) [-4361.107] (-4369.090) (-4367.734) * (-4362.840) (-4370.420) [-4369.339] (-4371.790) -- 0:03:46
      266000 -- (-4363.533) (-4367.099) (-4369.109) [-4369.099] * (-4365.521) [-4363.352] (-4371.897) (-4367.738) -- 0:03:46
      266500 -- (-4370.878) [-4365.940] (-4387.074) (-4369.090) * [-4363.284] (-4365.628) (-4371.609) (-4366.061) -- 0:03:45
      267000 -- [-4367.545] (-4365.701) (-4371.393) (-4364.838) * [-4371.601] (-4360.342) (-4363.958) (-4370.256) -- 0:03:45
      267500 -- (-4359.711) (-4363.404) (-4363.109) [-4366.038] * (-4366.337) [-4362.503] (-4368.022) (-4359.876) -- 0:03:47
      268000 -- (-4361.411) (-4366.064) [-4365.815] (-4364.146) * (-4365.057) (-4364.675) (-4375.171) [-4366.398] -- 0:03:46
      268500 -- (-4362.593) (-4371.870) [-4368.587] (-4364.181) * (-4363.860) [-4367.924] (-4362.449) (-4362.057) -- 0:03:46
      269000 -- (-4367.993) (-4371.587) (-4364.713) [-4365.533] * (-4362.275) (-4364.331) (-4363.718) [-4364.940] -- 0:03:45
      269500 -- [-4363.238] (-4367.562) (-4376.074) (-4371.855) * (-4364.986) [-4364.734] (-4367.192) (-4364.844) -- 0:03:44
      270000 -- (-4367.205) (-4367.095) [-4364.626] (-4365.882) * (-4370.873) (-4367.839) [-4362.004] (-4368.584) -- 0:03:44

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-4368.482) (-4362.681) [-4363.384] (-4366.673) * (-4367.359) [-4368.816] (-4368.799) (-4371.419) -- 0:03:46
      271000 -- (-4371.248) (-4367.573) (-4364.666) [-4366.541] * (-4365.225) [-4360.807] (-4369.659) (-4363.109) -- 0:03:45
      271500 -- (-4366.771) [-4369.519] (-4362.962) (-4366.272) * [-4367.145] (-4371.224) (-4370.223) (-4366.680) -- 0:03:45
      272000 -- (-4366.227) (-4369.454) [-4363.518] (-4371.892) * (-4369.190) (-4365.728) (-4370.985) [-4368.999] -- 0:03:44
      272500 -- [-4360.797] (-4366.749) (-4362.618) (-4370.619) * (-4371.968) [-4362.541] (-4371.611) (-4366.870) -- 0:03:44
      273000 -- (-4367.973) (-4364.867) (-4378.980) [-4372.501] * [-4361.932] (-4365.266) (-4370.500) (-4361.825) -- 0:03:43
      273500 -- (-4366.328) [-4362.979] (-4365.723) (-4368.944) * (-4360.604) (-4368.731) (-4369.257) [-4365.555] -- 0:03:43
      274000 -- (-4361.792) (-4371.523) (-4369.687) [-4359.391] * (-4363.411) [-4373.979] (-4367.324) (-4368.730) -- 0:03:45
      274500 -- [-4365.768] (-4364.792) (-4364.461) (-4369.196) * (-4366.180) [-4365.721] (-4369.077) (-4362.247) -- 0:03:44
      275000 -- [-4367.799] (-4373.243) (-4370.921) (-4361.524) * (-4368.092) (-4364.449) (-4366.826) [-4368.237] -- 0:03:44

      Average standard deviation of split frequencies: 0.000000

      275500 -- (-4364.524) [-4364.536] (-4369.043) (-4365.591) * (-4371.800) (-4365.007) [-4365.652] (-4364.230) -- 0:03:43
      276000 -- (-4362.937) [-4370.699] (-4369.120) (-4368.349) * (-4374.956) (-4364.626) [-4364.834] (-4366.507) -- 0:03:42
      276500 -- (-4368.927) (-4378.292) (-4366.751) [-4361.340] * (-4363.814) (-4366.025) (-4365.109) [-4366.881] -- 0:03:42
      277000 -- [-4366.230] (-4373.672) (-4373.712) (-4364.156) * (-4370.663) (-4362.929) [-4365.650] (-4379.532) -- 0:03:44
      277500 -- [-4362.449] (-4372.354) (-4374.013) (-4363.271) * (-4365.345) (-4366.430) [-4369.710] (-4368.369) -- 0:03:43
      278000 -- (-4362.679) (-4380.739) [-4365.214] (-4367.841) * (-4359.265) (-4371.194) [-4364.278] (-4368.793) -- 0:03:43
      278500 -- (-4360.306) [-4371.372] (-4374.338) (-4373.533) * (-4362.905) (-4365.799) (-4362.746) [-4364.467] -- 0:03:42
      279000 -- (-4367.587) (-4365.215) [-4361.045] (-4370.908) * (-4370.760) [-4366.780] (-4365.758) (-4368.345) -- 0:03:42
      279500 -- [-4363.644] (-4366.800) (-4364.442) (-4367.337) * (-4360.578) (-4366.796) [-4361.114] (-4374.489) -- 0:03:41
      280000 -- (-4371.498) (-4370.535) [-4366.684] (-4367.907) * (-4366.632) [-4368.029] (-4366.156) (-4370.750) -- 0:03:41

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-4362.258) (-4365.856) (-4369.667) [-4365.055] * [-4365.240] (-4362.956) (-4366.549) (-4365.807) -- 0:03:43
      281000 -- (-4360.903) (-4364.521) [-4364.030] (-4367.661) * [-4364.312] (-4367.752) (-4368.245) (-4365.596) -- 0:03:42
      281500 -- [-4363.199] (-4370.390) (-4363.767) (-4367.676) * (-4364.183) [-4366.507] (-4370.309) (-4370.439) -- 0:03:42
      282000 -- (-4371.408) (-4366.536) [-4367.015] (-4364.349) * (-4370.081) (-4364.247) (-4361.328) [-4373.919] -- 0:03:41
      282500 -- (-4368.391) (-4367.348) [-4367.084] (-4371.342) * [-4364.628] (-4364.619) (-4372.313) (-4362.391) -- 0:03:40
      283000 -- (-4363.353) [-4360.178] (-4365.375) (-4367.919) * [-4360.323] (-4367.905) (-4362.651) (-4369.312) -- 0:03:40
      283500 -- [-4363.492] (-4361.242) (-4369.612) (-4366.511) * (-4369.997) (-4363.656) (-4360.576) [-4364.059] -- 0:03:42
      284000 -- (-4364.377) (-4368.360) (-4376.584) [-4365.137] * [-4365.851] (-4361.722) (-4374.155) (-4374.095) -- 0:03:41
      284500 -- (-4364.582) [-4367.982] (-4367.159) (-4367.878) * (-4363.478) (-4367.591) [-4364.295] (-4373.627) -- 0:03:41
      285000 -- (-4378.106) (-4362.034) [-4364.947] (-4364.492) * (-4364.489) [-4372.543] (-4360.515) (-4362.245) -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-4371.980) [-4366.860] (-4366.836) (-4366.122) * (-4366.247) (-4372.326) (-4368.046) [-4363.419] -- 0:03:40
      286000 -- (-4366.348) (-4369.637) [-4362.934] (-4364.404) * (-4371.257) (-4372.941) [-4363.336] (-4360.818) -- 0:03:39
      286500 -- [-4365.825] (-4372.255) (-4368.785) (-4365.818) * (-4368.644) (-4373.315) (-4368.054) [-4361.109] -- 0:03:39
      287000 -- (-4367.425) (-4363.697) (-4370.942) [-4368.592] * (-4370.297) (-4370.740) [-4362.167] (-4363.301) -- 0:03:41
      287500 -- (-4362.393) (-4373.738) (-4363.486) [-4370.832] * (-4365.149) (-4372.585) (-4363.850) [-4364.685] -- 0:03:40
      288000 -- (-4369.464) [-4365.203] (-4365.514) (-4364.623) * (-4364.437) [-4373.321] (-4371.737) (-4364.300) -- 0:03:40
      288500 -- [-4365.052] (-4370.060) (-4365.620) (-4365.192) * (-4375.392) (-4364.762) (-4362.895) [-4362.573] -- 0:03:39
      289000 -- (-4365.538) (-4367.954) [-4362.553] (-4363.716) * (-4370.277) [-4365.303] (-4363.065) (-4366.895) -- 0:03:38
      289500 -- (-4365.652) (-4366.675) (-4368.713) [-4364.369] * (-4366.383) (-4373.789) [-4366.802] (-4368.966) -- 0:03:38
      290000 -- (-4367.685) (-4365.872) [-4363.348] (-4360.082) * [-4364.517] (-4364.010) (-4362.294) (-4369.634) -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      290500 -- [-4363.460] (-4372.781) (-4364.399) (-4363.777) * (-4366.390) (-4370.742) [-4361.609] (-4364.851) -- 0:03:39
      291000 -- (-4364.679) (-4367.582) [-4363.743] (-4364.150) * (-4365.417) (-4373.418) [-4362.348] (-4372.860) -- 0:03:39
      291500 -- (-4363.680) (-4367.575) (-4367.114) [-4365.337] * (-4371.402) (-4362.347) [-4367.502] (-4369.811) -- 0:03:38
      292000 -- [-4360.154] (-4371.714) (-4363.608) (-4368.735) * (-4371.897) (-4368.175) [-4364.972] (-4370.009) -- 0:03:38
      292500 -- (-4362.157) (-4369.298) [-4364.170] (-4364.041) * [-4368.018] (-4366.297) (-4368.133) (-4372.880) -- 0:03:37
      293000 -- (-4364.138) [-4370.763] (-4365.643) (-4363.570) * (-4369.015) [-4363.930] (-4369.963) (-4368.660) -- 0:03:39
      293500 -- (-4367.934) (-4370.664) (-4370.615) [-4365.282] * (-4377.363) (-4369.139) (-4368.671) [-4375.156] -- 0:03:39
      294000 -- [-4367.416] (-4365.838) (-4367.767) (-4364.681) * (-4368.496) [-4365.997] (-4371.166) (-4363.040) -- 0:03:38
      294500 -- [-4362.226] (-4367.973) (-4365.650) (-4362.005) * (-4371.179) (-4364.177) [-4369.473] (-4364.965) -- 0:03:37
      295000 -- (-4365.763) [-4368.917] (-4367.948) (-4369.264) * (-4364.661) (-4369.438) [-4360.289] (-4373.385) -- 0:03:37

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-4366.998) [-4363.441] (-4363.753) (-4367.689) * (-4372.643) (-4372.885) [-4365.886] (-4375.656) -- 0:03:36
      296000 -- [-4368.873] (-4367.066) (-4365.129) (-4360.512) * (-4368.621) (-4371.172) [-4363.630] (-4371.535) -- 0:03:36
      296500 -- (-4363.951) (-4363.708) (-4365.635) [-4363.256] * (-4368.824) (-4364.197) (-4372.136) [-4366.207] -- 0:03:38
      297000 -- (-4370.048) [-4362.468] (-4366.139) (-4365.126) * (-4368.105) (-4365.523) (-4366.178) [-4362.918] -- 0:03:37
      297500 -- (-4366.426) [-4363.387] (-4365.565) (-4366.529) * (-4368.034) (-4364.023) [-4362.059] (-4367.747) -- 0:03:37
      298000 -- [-4362.778] (-4367.570) (-4366.439) (-4362.033) * (-4378.424) (-4365.871) [-4364.542] (-4371.674) -- 0:03:36
      298500 -- (-4366.974) [-4361.635] (-4371.802) (-4370.793) * (-4376.738) [-4365.607] (-4367.633) (-4368.270) -- 0:03:36
      299000 -- (-4366.115) [-4364.905] (-4372.029) (-4370.208) * (-4363.090) [-4363.904] (-4365.472) (-4363.938) -- 0:03:35
      299500 -- (-4369.932) (-4374.067) [-4366.454] (-4364.703) * (-4372.232) (-4364.917) (-4361.581) [-4366.133] -- 0:03:37
      300000 -- (-4368.827) [-4366.048] (-4370.488) (-4370.123) * (-4375.394) (-4368.045) (-4366.991) [-4367.177] -- 0:03:37

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-4371.904) [-4368.392] (-4367.863) (-4371.178) * [-4367.462] (-4363.344) (-4362.408) (-4363.367) -- 0:03:36
      301000 -- (-4364.587) [-4362.655] (-4371.370) (-4365.539) * (-4363.468) (-4368.137) (-4359.971) [-4364.955] -- 0:03:35
      301500 -- (-4366.298) (-4361.491) (-4367.602) [-4367.965] * (-4366.044) [-4366.714] (-4373.198) (-4365.563) -- 0:03:35
      302000 -- (-4369.696) (-4364.063) (-4366.204) [-4366.487] * (-4374.420) [-4371.478] (-4365.567) (-4363.495) -- 0:03:34
      302500 -- (-4364.552) [-4368.696] (-4359.356) (-4369.534) * (-4371.379) (-4366.215) [-4363.903] (-4362.092) -- 0:03:34
      303000 -- (-4369.466) (-4368.355) [-4363.714] (-4369.560) * (-4368.267) (-4362.285) [-4365.276] (-4367.843) -- 0:03:36
      303500 -- (-4364.228) [-4365.584] (-4372.936) (-4373.735) * (-4366.328) (-4368.667) [-4363.995] (-4365.069) -- 0:03:35
      304000 -- [-4369.446] (-4368.462) (-4368.328) (-4370.101) * [-4372.343] (-4366.214) (-4365.445) (-4360.131) -- 0:03:35
      304500 -- (-4363.229) (-4376.297) (-4368.854) [-4370.708] * (-4365.746) [-4361.278] (-4366.553) (-4369.942) -- 0:03:34
      305000 -- (-4368.182) (-4370.545) [-4364.613] (-4362.491) * (-4372.013) [-4371.281] (-4368.496) (-4368.920) -- 0:03:34

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-4369.557) (-4363.164) (-4365.156) [-4364.815] * (-4362.086) (-4363.275) [-4372.505] (-4378.549) -- 0:03:33
      306000 -- (-4362.187) (-4359.607) (-4372.020) [-4364.866] * (-4362.632) (-4362.023) [-4372.253] (-4364.628) -- 0:03:35
      306500 -- (-4358.990) (-4366.206) [-4363.506] (-4364.045) * (-4360.953) [-4367.060] (-4363.518) (-4363.689) -- 0:03:34
      307000 -- [-4362.254] (-4362.720) (-4364.872) (-4367.291) * [-4366.070] (-4369.277) (-4368.074) (-4362.132) -- 0:03:34
      307500 -- (-4370.975) (-4365.545) (-4367.796) [-4365.010] * (-4368.776) (-4366.505) [-4361.866] (-4365.889) -- 0:03:33
      308000 -- (-4369.710) (-4366.103) [-4369.565] (-4364.552) * (-4366.483) (-4368.079) (-4366.744) [-4369.479] -- 0:03:33
      308500 -- (-4364.390) (-4362.163) (-4363.476) [-4363.374] * (-4364.151) [-4363.954] (-4367.514) (-4371.487) -- 0:03:32
      309000 -- (-4361.066) [-4361.571] (-4364.667) (-4362.976) * (-4366.555) (-4365.187) (-4366.220) [-4370.661] -- 0:03:32
      309500 -- (-4365.986) [-4361.372] (-4362.184) (-4365.597) * (-4364.246) (-4367.844) [-4364.169] (-4362.175) -- 0:03:34
      310000 -- (-4368.784) [-4362.697] (-4362.956) (-4374.877) * [-4360.757] (-4366.723) (-4360.905) (-4364.863) -- 0:03:33

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-4364.078) [-4364.183] (-4366.050) (-4365.741) * (-4363.389) (-4367.095) (-4364.240) [-4364.325] -- 0:03:33
      311000 -- [-4367.177] (-4370.392) (-4367.838) (-4367.842) * (-4366.369) [-4361.011] (-4361.866) (-4366.811) -- 0:03:32
      311500 -- (-4364.014) [-4367.620] (-4364.636) (-4370.849) * [-4369.218] (-4361.460) (-4367.856) (-4364.455) -- 0:03:32
      312000 -- (-4370.807) [-4368.970] (-4373.033) (-4363.248) * (-4366.804) [-4365.476] (-4367.366) (-4365.834) -- 0:03:31
      312500 -- (-4366.381) (-4367.130) [-4369.886] (-4365.159) * (-4369.643) (-4368.047) (-4363.751) [-4363.742] -- 0:03:33
      313000 -- (-4364.992) (-4366.216) [-4367.349] (-4366.877) * (-4361.739) [-4370.337] (-4369.627) (-4365.934) -- 0:03:32
      313500 -- (-4374.006) [-4363.686] (-4369.899) (-4373.117) * [-4370.438] (-4362.168) (-4367.189) (-4364.756) -- 0:03:32
      314000 -- (-4369.229) (-4365.978) [-4365.783] (-4369.239) * (-4360.569) (-4362.517) [-4369.143] (-4369.731) -- 0:03:31
      314500 -- [-4368.253] (-4370.896) (-4370.270) (-4366.250) * (-4373.064) [-4363.041] (-4363.893) (-4362.592) -- 0:03:31
      315000 -- [-4363.796] (-4366.699) (-4362.603) (-4372.556) * (-4368.278) (-4363.650) [-4364.249] (-4366.293) -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-4377.746) [-4370.537] (-4373.228) (-4371.392) * [-4364.770] (-4365.632) (-4367.400) (-4368.886) -- 0:03:30
      316000 -- (-4365.372) (-4375.264) [-4367.630] (-4366.104) * (-4366.131) (-4367.103) (-4362.161) [-4362.598] -- 0:03:32
      316500 -- (-4377.459) (-4371.566) [-4370.133] (-4370.418) * (-4366.853) [-4366.191] (-4361.518) (-4364.451) -- 0:03:31
      317000 -- (-4371.908) [-4367.510] (-4368.727) (-4361.091) * (-4363.253) [-4366.883] (-4361.106) (-4369.040) -- 0:03:31
      317500 -- (-4366.333) [-4367.625] (-4363.741) (-4365.688) * (-4375.234) (-4361.104) [-4360.948] (-4365.833) -- 0:03:30
      318000 -- (-4372.940) [-4362.438] (-4366.016) (-4362.264) * [-4364.743] (-4361.073) (-4367.446) (-4362.564) -- 0:03:30
      318500 -- [-4359.202] (-4365.532) (-4364.753) (-4369.358) * (-4368.032) [-4363.634] (-4363.423) (-4369.692) -- 0:03:29
      319000 -- [-4360.096] (-4366.751) (-4359.952) (-4371.108) * [-4363.324] (-4367.080) (-4365.352) (-4369.065) -- 0:03:31
      319500 -- (-4365.199) (-4364.819) (-4361.696) [-4366.603] * (-4363.769) [-4363.603] (-4367.628) (-4362.414) -- 0:03:30
      320000 -- (-4364.606) [-4367.975] (-4367.611) (-4370.643) * (-4369.404) (-4367.369) (-4367.220) [-4363.791] -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-4369.158) (-4370.431) [-4367.936] (-4363.775) * (-4365.705) (-4368.752) [-4365.549] (-4374.861) -- 0:03:29
      321000 -- (-4374.239) [-4370.369] (-4364.626) (-4363.221) * [-4365.223] (-4374.106) (-4362.791) (-4366.494) -- 0:03:29
      321500 -- (-4364.805) (-4367.474) [-4367.008] (-4368.368) * (-4364.335) (-4374.246) (-4360.965) [-4367.197] -- 0:03:28
      322000 -- (-4369.896) [-4371.047] (-4370.720) (-4367.419) * (-4361.220) [-4368.883] (-4362.417) (-4368.187) -- 0:03:28
      322500 -- [-4368.548] (-4359.046) (-4371.273) (-4365.771) * (-4370.679) (-4369.094) (-4364.225) [-4364.956] -- 0:03:30
      323000 -- (-4366.724) (-4363.487) (-4370.846) [-4371.973] * [-4371.376] (-4366.597) (-4371.716) (-4371.013) -- 0:03:29
      323500 -- [-4362.803] (-4368.083) (-4368.187) (-4371.640) * (-4369.053) [-4370.978] (-4370.215) (-4368.004) -- 0:03:29
      324000 -- (-4370.197) [-4374.392] (-4361.231) (-4370.699) * (-4374.595) (-4365.312) (-4361.591) [-4367.835] -- 0:03:28
      324500 -- (-4372.356) (-4370.488) (-4366.180) [-4365.736] * (-4378.191) (-4368.804) (-4363.447) [-4372.686] -- 0:03:28
      325000 -- [-4367.678] (-4368.178) (-4365.637) (-4360.518) * [-4363.355] (-4371.715) (-4366.028) (-4363.027) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-4362.993) (-4365.825) (-4368.821) [-4366.082] * (-4367.239) (-4367.055) (-4369.106) [-4362.986] -- 0:03:29
      326000 -- (-4363.588) (-4360.770) [-4360.486] (-4373.645) * (-4370.358) (-4366.339) [-4367.001] (-4368.200) -- 0:03:28
      326500 -- [-4363.787] (-4367.855) (-4363.539) (-4367.260) * (-4371.023) (-4368.135) [-4367.102] (-4365.985) -- 0:03:28
      327000 -- (-4364.545) (-4368.575) [-4368.484] (-4362.885) * [-4360.593] (-4369.813) (-4372.706) (-4368.926) -- 0:03:27
      327500 -- (-4365.756) [-4361.241] (-4368.083) (-4364.765) * [-4366.064] (-4373.671) (-4360.992) (-4367.931) -- 0:03:27
      328000 -- (-4361.601) (-4368.268) [-4363.083] (-4366.020) * (-4366.207) (-4373.648) [-4365.681] (-4363.864) -- 0:03:26
      328500 -- (-4371.905) (-4367.941) (-4361.656) [-4367.361] * (-4364.066) (-4372.115) [-4361.457] (-4365.010) -- 0:03:26
      329000 -- (-4373.081) (-4369.745) [-4365.376] (-4371.535) * [-4360.767] (-4367.418) (-4367.076) (-4369.623) -- 0:03:28
      329500 -- (-4369.361) [-4366.585] (-4374.520) (-4364.921) * (-4364.605) (-4366.112) [-4363.478] (-4365.750) -- 0:03:27
      330000 -- (-4365.921) (-4369.098) [-4365.358] (-4363.797) * (-4364.757) (-4361.976) (-4361.404) [-4368.959] -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-4370.126) [-4365.394] (-4367.372) (-4364.285) * [-4363.760] (-4364.021) (-4359.155) (-4363.720) -- 0:03:26
      331000 -- [-4366.572] (-4367.021) (-4365.953) (-4363.962) * [-4366.606] (-4367.577) (-4368.579) (-4365.357) -- 0:03:26
      331500 -- (-4364.422) (-4366.695) [-4370.542] (-4367.122) * (-4369.164) [-4366.102] (-4370.601) (-4360.241) -- 0:03:25
      332000 -- [-4362.393] (-4373.506) (-4370.207) (-4363.253) * (-4370.243) (-4361.953) (-4369.474) [-4363.877] -- 0:03:27
      332500 -- (-4368.736) (-4364.844) (-4364.715) [-4363.465] * (-4375.203) (-4368.649) [-4363.231] (-4362.993) -- 0:03:26
      333000 -- (-4375.575) [-4364.925] (-4368.709) (-4370.072) * (-4374.497) (-4369.021) (-4361.443) [-4365.909] -- 0:03:26
      333500 -- [-4362.332] (-4362.114) (-4370.100) (-4367.626) * (-4373.791) (-4369.846) (-4365.971) [-4365.241] -- 0:03:25
      334000 -- (-4364.754) (-4371.324) [-4362.772] (-4364.194) * (-4364.041) [-4369.867] (-4366.782) (-4365.151) -- 0:03:25
      334500 -- (-4364.526) [-4365.674] (-4369.645) (-4364.158) * (-4372.838) (-4364.855) [-4369.208] (-4364.914) -- 0:03:24
      335000 -- (-4370.302) (-4362.446) (-4369.795) [-4365.544] * (-4369.302) (-4371.116) (-4375.360) [-4363.968] -- 0:03:24

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-4362.307) (-4362.432) [-4369.004] (-4369.025) * (-4368.106) (-4372.847) (-4364.107) [-4365.569] -- 0:03:25
      336000 -- (-4362.955) (-4366.577) (-4368.141) [-4367.262] * (-4368.881) (-4373.360) [-4368.830] (-4364.351) -- 0:03:25
      336500 -- (-4368.826) (-4365.675) [-4361.372] (-4371.662) * (-4366.977) (-4367.643) [-4367.926] (-4364.883) -- 0:03:25
      337000 -- (-4360.403) (-4370.936) (-4364.273) [-4366.293] * (-4367.134) [-4365.349] (-4367.460) (-4362.858) -- 0:03:24
      337500 -- (-4364.420) [-4364.987] (-4362.026) (-4368.111) * [-4370.540] (-4366.899) (-4362.429) (-4367.985) -- 0:03:24
      338000 -- [-4374.568] (-4368.451) (-4367.687) (-4377.622) * (-4370.300) (-4361.425) (-4363.071) [-4369.357] -- 0:03:23
      338500 -- (-4376.832) (-4364.632) [-4360.998] (-4366.909) * (-4367.535) (-4368.046) [-4367.463] (-4371.002) -- 0:03:25
      339000 -- (-4365.325) (-4366.030) (-4370.685) [-4363.812] * (-4367.917) [-4364.752] (-4367.272) (-4367.662) -- 0:03:24
      339500 -- (-4369.021) (-4363.450) [-4368.982] (-4369.743) * (-4363.267) (-4370.872) [-4365.108] (-4370.351) -- 0:03:24
      340000 -- [-4367.402] (-4366.550) (-4364.001) (-4373.977) * (-4363.451) (-4362.202) [-4366.053] (-4366.009) -- 0:03:23

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-4365.830] (-4362.559) (-4365.366) (-4369.158) * [-4368.717] (-4376.062) (-4368.263) (-4367.297) -- 0:03:23
      341000 -- (-4362.712) [-4365.065] (-4367.525) (-4367.474) * (-4370.540) [-4369.500] (-4367.547) (-4362.041) -- 0:03:22
      341500 -- (-4365.353) (-4363.160) (-4363.932) [-4367.177] * [-4362.646] (-4373.729) (-4369.779) (-4361.389) -- 0:03:24
      342000 -- (-4365.442) [-4366.801] (-4362.291) (-4370.150) * (-4361.136) [-4368.045] (-4372.929) (-4361.097) -- 0:03:23
      342500 -- (-4367.370) (-4361.926) (-4366.179) [-4364.000] * (-4363.065) (-4375.461) [-4370.199] (-4362.987) -- 0:03:23
      343000 -- (-4370.922) (-4368.201) (-4370.264) [-4370.219] * (-4360.375) (-4367.700) (-4367.717) [-4365.434] -- 0:03:23
      343500 -- (-4369.251) [-4369.450] (-4366.543) (-4365.722) * (-4367.010) [-4367.283] (-4361.945) (-4370.251) -- 0:03:22
      344000 -- (-4370.126) (-4368.364) [-4362.977] (-4365.335) * (-4365.878) (-4364.545) [-4362.066] (-4370.273) -- 0:03:22
      344500 -- (-4366.902) (-4367.117) [-4360.876] (-4376.114) * [-4363.760] (-4368.420) (-4375.890) (-4366.460) -- 0:03:21
      345000 -- [-4363.176] (-4370.532) (-4367.038) (-4367.302) * [-4362.698] (-4371.108) (-4365.762) (-4363.363) -- 0:03:23

      Average standard deviation of split frequencies: 0.000000

      345500 -- [-4361.935] (-4363.821) (-4364.765) (-4365.379) * (-4365.843) (-4364.639) (-4369.271) [-4365.183] -- 0:03:22
      346000 -- (-4364.052) [-4361.130] (-4364.432) (-4364.587) * (-4364.472) [-4364.559] (-4364.705) (-4364.736) -- 0:03:22
      346500 -- (-4363.166) (-4367.481) [-4364.732] (-4371.654) * (-4367.118) (-4362.697) [-4365.060] (-4366.720) -- 0:03:21
      347000 -- (-4362.018) [-4363.326] (-4372.431) (-4365.911) * (-4372.241) [-4367.952] (-4364.280) (-4375.367) -- 0:03:21
      347500 -- (-4371.975) (-4366.944) [-4362.943] (-4362.969) * (-4370.092) (-4365.735) (-4366.404) [-4368.315] -- 0:03:20
      348000 -- (-4372.840) [-4362.486] (-4366.615) (-4368.948) * (-4365.991) (-4363.881) (-4373.200) [-4362.993] -- 0:03:22
      348500 -- (-4373.426) (-4366.256) (-4370.114) [-4364.957] * (-4363.604) [-4368.832] (-4370.540) (-4364.027) -- 0:03:21
      349000 -- [-4366.561] (-4367.448) (-4366.102) (-4371.958) * [-4361.016] (-4370.674) (-4369.814) (-4364.319) -- 0:03:21
      349500 -- (-4370.525) [-4362.522] (-4381.593) (-4367.443) * (-4373.600) [-4365.084] (-4369.681) (-4361.165) -- 0:03:21
      350000 -- (-4366.777) (-4374.769) (-4368.252) [-4368.556] * (-4363.630) (-4368.450) (-4366.965) [-4368.926] -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-4376.127) [-4366.400] (-4367.173) (-4373.923) * (-4365.405) (-4372.035) [-4362.548] (-4369.580) -- 0:03:20
      351000 -- (-4369.865) [-4368.276] (-4367.050) (-4367.859) * (-4363.789) (-4370.990) [-4369.240] (-4364.301) -- 0:03:19
      351500 -- (-4364.203) [-4365.852] (-4363.496) (-4367.667) * (-4366.381) [-4373.247] (-4368.752) (-4366.311) -- 0:03:21
      352000 -- (-4372.825) [-4357.452] (-4365.801) (-4365.330) * (-4366.658) (-4368.924) (-4372.250) [-4367.596] -- 0:03:20
      352500 -- (-4364.783) (-4360.101) (-4364.554) [-4364.668] * (-4367.248) (-4366.471) (-4361.727) [-4369.821] -- 0:03:20
      353000 -- [-4370.710] (-4364.172) (-4370.921) (-4362.099) * (-4364.688) (-4364.856) (-4366.025) [-4362.839] -- 0:03:19
      353500 -- (-4371.849) (-4366.372) [-4365.306] (-4373.631) * (-4370.045) (-4369.578) (-4368.081) [-4365.065] -- 0:03:19
      354000 -- (-4369.074) (-4376.343) [-4366.520] (-4368.256) * [-4366.059] (-4365.437) (-4370.239) (-4368.406) -- 0:03:18
      354500 -- (-4364.453) [-4364.769] (-4365.393) (-4369.563) * (-4367.068) [-4361.637] (-4358.999) (-4368.669) -- 0:03:20
      355000 -- (-4369.613) [-4364.299] (-4368.459) (-4362.288) * (-4370.410) [-4361.779] (-4364.197) (-4368.244) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-4363.364) (-4363.529) [-4369.934] (-4365.949) * (-4375.996) (-4359.722) [-4368.153] (-4372.831) -- 0:03:19
      356000 -- (-4364.981) (-4367.470) [-4367.826] (-4367.888) * (-4366.574) (-4365.678) (-4374.030) [-4373.574] -- 0:03:18
      356500 -- [-4362.652] (-4363.634) (-4363.096) (-4369.357) * (-4361.473) [-4360.574] (-4369.613) (-4370.768) -- 0:03:18
      357000 -- (-4374.967) (-4368.422) [-4370.500] (-4363.457) * (-4371.233) [-4365.294] (-4369.804) (-4368.068) -- 0:03:18
      357500 -- (-4363.424) (-4367.481) (-4363.855) [-4365.659] * (-4368.482) [-4367.039] (-4365.959) (-4366.975) -- 0:03:17
      358000 -- [-4365.762] (-4367.233) (-4372.590) (-4363.282) * (-4369.371) (-4365.212) (-4368.022) [-4366.319] -- 0:03:19
      358500 -- (-4366.927) (-4369.720) (-4367.984) [-4365.685] * (-4373.337) [-4364.783] (-4366.720) (-4365.180) -- 0:03:18
      359000 -- (-4363.246) [-4369.309] (-4372.704) (-4371.803) * (-4371.966) (-4366.874) [-4367.309] (-4360.599) -- 0:03:18
      359500 -- (-4362.891) (-4367.855) (-4365.783) [-4366.111] * (-4380.974) (-4365.161) (-4373.032) [-4368.573] -- 0:03:17
      360000 -- [-4361.905] (-4363.597) (-4371.866) (-4366.068) * (-4372.081) (-4375.955) (-4368.927) [-4370.154] -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-4373.851) (-4371.762) [-4365.938] (-4375.985) * (-4370.071) [-4366.127] (-4362.350) (-4367.557) -- 0:03:16
      361000 -- (-4369.512) (-4371.365) (-4363.651) [-4365.660] * [-4364.468] (-4367.664) (-4367.245) (-4365.809) -- 0:03:18
      361500 -- (-4379.377) (-4369.062) [-4371.293] (-4361.890) * [-4369.294] (-4367.838) (-4368.557) (-4366.732) -- 0:03:17
      362000 -- (-4373.789) (-4362.014) (-4371.167) [-4366.857] * (-4365.924) (-4369.046) (-4366.708) [-4367.038] -- 0:03:17
      362500 -- (-4368.463) (-4364.015) (-4367.979) [-4364.351] * (-4364.982) (-4368.734) [-4367.895] (-4361.051) -- 0:03:16
      363000 -- (-4363.935) (-4365.895) (-4365.143) [-4365.264] * (-4364.899) [-4365.025] (-4364.200) (-4365.300) -- 0:03:16
      363500 -- (-4374.421) (-4368.787) [-4362.697] (-4364.844) * (-4362.224) [-4364.719] (-4370.058) (-4367.346) -- 0:03:16
      364000 -- (-4372.908) (-4367.271) [-4363.951] (-4368.534) * (-4367.552) (-4370.944) (-4372.678) [-4363.078] -- 0:03:15
      364500 -- (-4371.008) (-4367.202) (-4367.942) [-4365.816] * (-4361.493) [-4363.870] (-4363.792) (-4364.577) -- 0:03:17
      365000 -- (-4367.468) (-4370.630) (-4372.284) [-4365.423] * (-4364.963) (-4365.419) [-4366.003] (-4364.706) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      365500 -- [-4365.229] (-4371.133) (-4366.521) (-4369.951) * [-4363.009] (-4368.093) (-4370.702) (-4368.759) -- 0:03:16
      366000 -- [-4367.850] (-4366.003) (-4364.890) (-4364.002) * (-4364.745) (-4372.685) (-4368.449) [-4365.598] -- 0:03:15
      366500 -- (-4364.331) (-4369.365) (-4365.194) [-4365.315] * [-4366.020] (-4367.843) (-4374.677) (-4363.196) -- 0:03:15
      367000 -- (-4366.883) (-4370.729) (-4361.531) [-4365.405] * (-4364.899) [-4364.077] (-4372.627) (-4367.379) -- 0:03:14
      367500 -- (-4366.444) (-4368.008) (-4366.819) [-4369.722] * (-4362.144) (-4366.765) (-4366.471) [-4364.728] -- 0:03:16
      368000 -- (-4364.367) (-4370.302) (-4365.252) [-4364.160] * (-4360.409) [-4361.204] (-4365.135) (-4365.322) -- 0:03:15
      368500 -- (-4369.508) (-4369.382) [-4363.072] (-4366.208) * [-4372.500] (-4368.648) (-4360.579) (-4372.496) -- 0:03:15
      369000 -- (-4363.012) (-4363.463) (-4363.458) [-4366.960] * (-4369.778) (-4372.748) (-4363.406) [-4360.524] -- 0:03:14
      369500 -- (-4382.059) (-4371.720) [-4367.558] (-4359.465) * (-4376.479) (-4365.254) [-4360.563] (-4368.310) -- 0:03:14
      370000 -- [-4362.974] (-4362.445) (-4369.576) (-4365.286) * (-4368.271) (-4365.842) [-4363.651] (-4361.750) -- 0:03:14

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-4364.879) [-4363.319] (-4367.292) (-4367.598) * [-4365.896] (-4363.894) (-4365.335) (-4364.140) -- 0:03:13
      371000 -- (-4365.145) [-4367.760] (-4365.082) (-4371.004) * [-4367.161] (-4369.618) (-4360.626) (-4366.871) -- 0:03:14
      371500 -- [-4377.395] (-4371.200) (-4361.056) (-4363.971) * (-4369.615) (-4375.456) [-4366.866] (-4366.242) -- 0:03:14
      372000 -- (-4367.210) (-4366.133) (-4362.978) [-4367.584] * [-4364.100] (-4376.243) (-4364.972) (-4371.005) -- 0:03:14
      372500 -- (-4366.685) [-4365.909] (-4369.049) (-4364.106) * (-4365.615) (-4378.380) (-4365.303) [-4362.580] -- 0:03:13
      373000 -- (-4375.444) (-4369.268) [-4367.234] (-4365.152) * (-4365.715) (-4371.108) [-4361.479] (-4366.421) -- 0:03:13
      373500 -- (-4375.092) (-4368.322) (-4364.145) [-4363.315] * (-4369.246) (-4370.166) [-4360.402] (-4369.583) -- 0:03:12
      374000 -- (-4375.845) [-4360.317] (-4368.512) (-4372.295) * (-4363.950) [-4365.462] (-4368.118) (-4363.872) -- 0:03:14
      374500 -- (-4368.661) (-4365.931) (-4370.085) [-4365.053] * [-4366.820] (-4365.484) (-4368.475) (-4362.369) -- 0:03:13
      375000 -- (-4372.131) [-4367.537] (-4366.974) (-4371.106) * (-4365.253) [-4362.968] (-4365.555) (-4363.735) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-4366.133) [-4363.801] (-4366.443) (-4370.726) * (-4363.866) (-4365.922) [-4359.426] (-4363.204) -- 0:03:12
      376000 -- [-4365.652] (-4365.644) (-4367.039) (-4367.938) * (-4365.695) (-4371.534) (-4367.486) [-4369.076] -- 0:03:12
      376500 -- (-4363.048) [-4368.307] (-4369.201) (-4368.200) * (-4371.619) [-4363.532] (-4367.601) (-4368.164) -- 0:03:12
      377000 -- [-4368.532] (-4367.483) (-4372.349) (-4370.524) * (-4366.350) [-4362.143] (-4371.253) (-4363.039) -- 0:03:11
      377500 -- (-4363.791) [-4372.078] (-4365.024) (-4368.393) * (-4371.085) (-4365.608) (-4368.569) [-4367.498] -- 0:03:12
      378000 -- [-4365.277] (-4371.027) (-4364.058) (-4369.192) * (-4361.777) [-4360.919] (-4364.970) (-4367.966) -- 0:03:12
      378500 -- (-4362.361) [-4366.315] (-4370.970) (-4364.831) * (-4370.240) [-4362.464] (-4365.130) (-4368.132) -- 0:03:12
      379000 -- (-4365.187) (-4369.079) [-4363.682] (-4370.632) * (-4366.972) [-4363.132] (-4362.562) (-4362.680) -- 0:03:11
      379500 -- [-4369.598] (-4369.363) (-4368.204) (-4366.603) * (-4366.967) (-4362.463) [-4366.682] (-4361.952) -- 0:03:11
      380000 -- (-4370.524) [-4365.895] (-4364.065) (-4365.530) * (-4367.856) (-4369.385) (-4379.960) [-4377.055] -- 0:03:10

      Average standard deviation of split frequencies: 0.000000

      380500 -- (-4380.558) (-4367.346) (-4364.293) [-4368.149] * (-4368.151) (-4367.034) [-4368.381] (-4367.972) -- 0:03:12
      381000 -- [-4365.511] (-4365.543) (-4363.094) (-4371.228) * (-4370.273) (-4365.967) [-4368.053] (-4364.874) -- 0:03:11
      381500 -- (-4364.884) (-4368.753) [-4361.221] (-4368.340) * (-4365.793) (-4365.511) [-4366.523] (-4365.348) -- 0:03:11
      382000 -- [-4364.793] (-4376.791) (-4364.857) (-4367.753) * [-4370.644] (-4365.067) (-4367.043) (-4366.684) -- 0:03:10
      382500 -- [-4365.007] (-4365.151) (-4366.492) (-4366.208) * (-4370.537) (-4368.754) [-4363.938] (-4365.765) -- 0:03:10
      383000