--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:27:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/tagA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -784.90          -788.00
2       -784.92          -787.61
--------------------------------------
TOTAL     -784.91          -787.82
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893332    0.088201    0.346307    1.477585    0.865922   1501.00   1501.00    1.000
r(A<->C){all}   0.165368    0.020733    0.000016    0.469779    0.126843    205.59    256.57    1.004
r(A<->G){all}   0.174624    0.022625    0.000160    0.479510    0.129116    143.16    224.20    1.000
r(A<->T){all}   0.159640    0.018657    0.000127    0.432878    0.120647    223.87    266.81    1.004
r(C<->G){all}   0.156316    0.017701    0.000141    0.421860    0.121222    168.19    253.09    1.000
r(C<->T){all}   0.160873    0.020044    0.000003    0.443948    0.119338    229.78    250.90    1.000
r(G<->T){all}   0.183179    0.023372    0.000047    0.489102    0.141934    135.96    138.29    1.002
pi(A){all}      0.180886    0.000255    0.149445    0.211441    0.180416   1179.29   1257.50    1.000
pi(C){all}      0.274484    0.000332    0.240476    0.311083    0.274486   1460.36   1468.64    1.000
pi(G){all}      0.331206    0.000396    0.290908    0.368294    0.330769   1235.08   1323.14    1.000
pi(T){all}      0.213424    0.000293    0.178028    0.245671    0.213436   1453.12   1477.06    1.000
alpha{1,2}      0.429403    0.242445    0.000342    1.424146    0.263465   1407.63   1428.01    1.000
alpha{3}        0.462110    0.255652    0.000456    1.460591    0.299466   1393.83   1447.42    1.000
pinvar{all}     0.997275    0.000011    0.991429    0.999999    0.998261   1284.04   1296.79    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-769.263488
Model 2: PositiveSelection	-769.263743
Model 0: one-ratio	-769.263845
Model 7: beta	-769.26341
Model 8: beta&w>1	-769.26341


Model 0 vs 1	7.13999999788939E-4

Model 2 vs 1	5.099999998492422E-4

Model 8 vs 7	0.0
>C1
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C2
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C3
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C4
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C5
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C6
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=192 

C1              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C2              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C3              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C4              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C5              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C6              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
                **************************************************

C1              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C2              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C3              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C4              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C5              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C6              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
                **************************************************

C1              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C2              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C3              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C4              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C5              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C6              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
                **************************************************

C1              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C2              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C3              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C4              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C5              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C6              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
                ******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5760]--->[5760]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.718 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C2              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C3              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C4              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C5              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C6              VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
                **************************************************

C1              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C2              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C3              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C4              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C5              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C6              QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
                **************************************************

C1              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C2              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C3              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C4              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C5              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C6              KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
                **************************************************

C1              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C2              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C3              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C4              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C5              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C6              AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
                ******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C2              GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C3              GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C4              GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C5              GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C6              GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
                **************************************************

C1              GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C2              GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C3              GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C4              GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C5              GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C6              GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
                **************************************************

C1              CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C2              CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C3              CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C4              CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C5              CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C6              CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
                **************************************************

C1              CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C2              CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C3              CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C4              CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C5              CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C6              CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
                **************************************************

C1              GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C2              GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C3              GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C4              GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C5              GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C6              GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
                **************************************************

C1              CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C2              CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C3              CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C4              CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C5              CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C6              CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
                **************************************************

C1              AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C2              AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C3              AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C4              AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C5              AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C6              AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
                **************************************************

C1              TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C2              TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C3              TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C4              TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C5              TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C6              TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
                **************************************************

C1              CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C2              CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C3              CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C4              CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C5              CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C6              CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
                **************************************************

C1              GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C2              GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C3              GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C4              GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C5              GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C6              GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
                **************************************************

C1              TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C2              TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C3              TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C4              TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C5              TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C6              TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
                **************************************************

C1              GTACTTGCTGGGTGCCTCCAACACGG
C2              GTACTTGCTGGGTGCCTCCAACACGG
C3              GTACTTGCTGGGTGCCTCCAACACGG
C4              GTACTTGCTGGGTGCCTCCAACACGG
C5              GTACTTGCTGGGTGCCTCCAACACGG
C6              GTACTTGCTGGGTGCCTCCAACACGG
                **************************



>C1
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C2
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C3
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C4
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C5
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C6
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C1
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C2
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C3
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C4
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C5
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C6
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 576 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789595
      Setting output file names to "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 385013644
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0091221185
      Seed = 480633468
      Swapseed = 1579789595
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1289.115611 -- -24.965149
         Chain 2 -- -1289.115536 -- -24.965149
         Chain 3 -- -1289.115536 -- -24.965149
         Chain 4 -- -1289.115611 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1289.115536 -- -24.965149
         Chain 2 -- -1289.115415 -- -24.965149
         Chain 3 -- -1289.115611 -- -24.965149
         Chain 4 -- -1289.115536 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1289.116] (-1289.116) (-1289.116) (-1289.116) * [-1289.116] (-1289.115) (-1289.116) (-1289.116) 
        500 -- (-799.035) [-793.787] (-808.179) (-799.840) * (-808.214) (-802.940) [-794.037] (-801.019) -- 0:00:00
       1000 -- (-797.178) [-793.614] (-798.268) (-790.485) * (-797.924) (-795.114) [-794.223] (-791.124) -- 0:00:00
       1500 -- (-799.537) [-793.013] (-799.216) (-789.180) * [-793.887] (-797.426) (-794.525) (-798.980) -- 0:11:05
       2000 -- (-794.776) [-794.808] (-794.795) (-800.067) * (-797.781) [-792.813] (-788.222) (-799.037) -- 0:08:19
       2500 -- [-791.470] (-789.765) (-793.933) (-789.589) * (-800.253) [-796.234] (-796.019) (-793.991) -- 0:06:39
       3000 -- (-797.179) [-790.162] (-788.827) (-792.262) * [-790.538] (-790.734) (-798.544) (-789.122) -- 0:05:32
       3500 -- (-793.836) [-792.082] (-789.235) (-791.858) * [-798.218] (-796.040) (-797.511) (-797.219) -- 0:04:44
       4000 -- [-797.149] (-793.685) (-801.829) (-792.796) * (-791.946) (-798.108) (-790.478) [-790.460] -- 0:04:09
       4500 -- (-800.100) [-790.710] (-790.975) (-788.533) * (-800.029) (-792.820) [-791.545] (-801.564) -- 0:03:41
       5000 -- (-796.468) (-789.652) (-803.157) [-792.347] * (-799.932) [-797.218] (-793.146) (-795.917) -- 0:03:19

      Average standard deviation of split frequencies: 0.097274

       5500 -- (-795.496) (-789.478) (-798.638) [-790.813] * [-792.062] (-799.280) (-801.342) (-795.189) -- 0:03:00
       6000 -- (-797.864) [-789.343] (-791.017) (-805.098) * (-793.805) (-797.208) (-800.237) [-794.585] -- 0:02:45
       6500 -- (-790.578) [-794.206] (-805.606) (-789.657) * (-792.531) [-789.665] (-805.758) (-806.148) -- 0:02:32
       7000 -- (-793.234) [-792.681] (-800.118) (-790.716) * (-795.834) [-791.289] (-799.839) (-797.965) -- 0:02:21
       7500 -- (-796.320) (-795.584) (-790.363) [-792.625] * (-791.980) [-790.045] (-793.273) (-811.384) -- 0:02:12
       8000 -- (-791.682) [-794.782] (-801.895) (-794.651) * (-796.201) [-796.757] (-789.299) (-796.430) -- 0:02:04
       8500 -- (-798.142) (-791.361) [-792.318] (-801.683) * (-798.398) (-796.711) (-797.015) [-790.675] -- 0:01:56
       9000 -- (-796.687) (-796.937) [-792.643] (-805.445) * (-793.753) (-795.557) [-794.058] (-796.154) -- 0:01:50
       9500 -- (-796.666) (-790.862) (-792.694) [-798.653] * (-795.963) (-800.635) (-799.731) [-795.550] -- 0:01:44
      10000 -- (-796.796) [-789.567] (-794.003) (-795.993) * [-792.161] (-795.865) (-794.795) (-795.481) -- 0:01:39

      Average standard deviation of split frequencies: 0.072106

      10500 -- (-791.448) (-791.493) [-798.043] (-799.212) * (-795.011) (-792.645) (-801.301) [-799.139] -- 0:01:34
      11000 -- [-794.460] (-793.957) (-792.265) (-800.229) * [-798.773] (-789.318) (-799.596) (-794.069) -- 0:01:29
      11500 -- (-792.980) [-791.131] (-794.046) (-799.229) * (-789.184) (-792.682) (-794.428) [-790.487] -- 0:01:25
      12000 -- (-795.055) (-801.132) [-797.839] (-792.595) * [-789.727] (-796.401) (-794.719) (-798.477) -- 0:01:22
      12500 -- (-792.275) (-794.827) (-796.408) [-789.564] * [-789.610] (-792.796) (-799.500) (-794.902) -- 0:01:19
      13000 -- [-794.019] (-797.502) (-790.559) (-797.892) * [-791.414] (-791.864) (-801.541) (-791.924) -- 0:01:15
      13500 -- (-791.925) [-798.907] (-804.508) (-792.015) * (-796.330) [-794.386] (-793.981) (-793.194) -- 0:01:13
      14000 -- [-790.789] (-795.877) (-793.226) (-797.477) * (-795.607) (-809.072) (-794.062) [-794.797] -- 0:01:10
      14500 -- [-798.311] (-805.388) (-786.029) (-815.990) * (-791.549) (-786.715) (-796.859) [-798.570] -- 0:01:07
      15000 -- (-812.358) [-797.992] (-786.032) (-793.287) * (-798.477) [-788.900] (-792.859) (-790.746) -- 0:01:05

      Average standard deviation of split frequencies: 0.070383

      15500 -- [-794.361] (-797.060) (-785.487) (-797.619) * (-799.161) (-784.609) (-790.629) [-793.002] -- 0:01:03
      16000 -- (-800.228) (-795.444) (-784.372) [-789.947] * (-792.716) (-786.205) [-793.900] (-791.690) -- 0:01:01
      16500 -- [-801.472] (-802.506) (-784.366) (-797.654) * (-798.894) (-784.491) (-791.373) [-790.122] -- 0:01:59
      17000 -- (-793.648) [-794.965] (-784.372) (-792.623) * (-795.586) (-785.425) [-789.968] (-796.624) -- 0:01:55
      17500 -- (-804.346) (-790.750) (-786.995) [-794.453] * [-793.974] (-787.186) (-791.448) (-791.642) -- 0:01:52
      18000 -- (-793.026) [-793.580] (-788.099) (-796.242) * (-793.098) (-784.202) [-802.384] (-791.014) -- 0:01:49
      18500 -- (-802.037) (-792.082) (-785.317) [-794.441] * (-798.171) (-787.719) (-794.694) [-788.101] -- 0:01:46
      19000 -- [-791.053] (-796.815) (-785.413) (-791.255) * (-793.900) [-784.243] (-798.169) (-792.697) -- 0:01:43
      19500 -- (-797.180) [-792.348] (-785.180) (-796.917) * (-806.997) (-784.059) (-810.314) [-790.187] -- 0:01:40
      20000 -- (-792.270) (-796.753) [-783.527] (-794.973) * (-796.636) [-784.183] (-805.008) (-791.865) -- 0:01:38

      Average standard deviation of split frequencies: 0.051622

      20500 -- (-799.184) (-788.758) [-783.983] (-792.716) * (-802.110) (-788.093) (-797.628) [-797.467] -- 0:01:35
      21000 -- [-799.505] (-794.344) (-783.612) (-795.732) * (-793.014) [-784.069] (-789.041) (-789.218) -- 0:01:33
      21500 -- (-800.103) (-789.908) (-783.415) [-796.865] * (-798.845) (-784.064) (-789.347) [-794.266] -- 0:01:31
      22000 -- (-791.971) (-794.673) (-787.581) [-800.914] * (-797.155) [-784.845] (-784.639) (-794.970) -- 0:01:28
      22500 -- (-793.802) [-790.862] (-785.557) (-788.975) * (-789.186) [-784.311] (-784.961) (-797.267) -- 0:01:26
      23000 -- (-795.200) [-793.284] (-785.691) (-797.429) * [-794.913] (-785.171) (-786.756) (-796.970) -- 0:01:24
      23500 -- [-792.028] (-796.249) (-785.820) (-796.856) * (-792.786) (-786.371) [-783.607] (-790.857) -- 0:01:23
      24000 -- [-790.839] (-796.896) (-786.049) (-796.009) * [-796.248] (-783.437) (-786.178) (-786.683) -- 0:01:21
      24500 -- [-792.538] (-796.699) (-787.243) (-800.117) * (-791.651) (-784.022) [-788.033] (-786.871) -- 0:01:19
      25000 -- (-792.378) [-792.426] (-785.729) (-807.608) * [-787.195] (-789.696) (-786.850) (-785.976) -- 0:01:18

      Average standard deviation of split frequencies: 0.034685

      25500 -- (-797.100) [-792.779] (-787.097) (-797.025) * (-792.182) (-787.675) (-792.534) [-787.454] -- 0:01:16
      26000 -- (-796.365) [-792.699] (-786.285) (-795.813) * (-793.436) [-785.078] (-784.543) (-784.642) -- 0:01:14
      26500 -- (-796.200) (-792.207) [-784.229] (-799.383) * [-793.079] (-786.025) (-783.792) (-784.212) -- 0:01:13
      27000 -- [-793.324] (-793.427) (-784.489) (-794.939) * [-789.551] (-785.161) (-784.038) (-787.587) -- 0:01:12
      27500 -- (-792.370) [-795.806] (-784.280) (-804.007) * (-793.095) (-784.650) [-784.279] (-787.312) -- 0:01:10
      28000 -- (-797.822) (-791.445) (-786.217) [-789.897] * (-807.085) (-783.627) [-784.916] (-785.483) -- 0:01:09
      28500 -- (-793.171) (-796.525) (-785.785) [-794.048] * (-799.606) (-785.826) (-786.056) [-788.005] -- 0:01:08
      29000 -- (-794.630) [-795.593] (-784.132) (-797.805) * (-793.839) (-786.465) (-787.640) [-787.724] -- 0:01:06
      29500 -- (-789.574) (-793.023) [-784.243] (-798.639) * (-797.527) (-786.426) [-787.282] (-785.714) -- 0:01:05
      30000 -- [-790.313] (-805.019) (-783.484) (-797.064) * (-800.846) (-784.627) [-785.574] (-785.902) -- 0:01:04

      Average standard deviation of split frequencies: 0.034404

      30500 -- (-799.506) [-796.198] (-784.781) (-791.454) * [-800.264] (-785.391) (-785.419) (-788.556) -- 0:01:35
      31000 -- (-799.438) (-802.091) [-786.104] (-796.383) * (-789.393) (-786.181) [-786.935] (-787.395) -- 0:01:33
      31500 -- (-791.495) (-785.364) [-784.425] (-795.772) * (-790.788) (-784.564) (-784.674) [-785.829] -- 0:01:32
      32000 -- (-791.622) (-784.743) [-785.665] (-791.866) * (-802.165) [-783.568] (-784.022) (-786.816) -- 0:01:30
      32500 -- [-794.053] (-785.271) (-785.480) (-794.675) * [-798.147] (-785.245) (-788.805) (-784.696) -- 0:01:29
      33000 -- (-795.803) (-787.647) (-784.932) [-791.348] * [-793.343] (-787.143) (-784.681) (-790.506) -- 0:01:27
      33500 -- (-796.714) (-785.742) (-789.768) [-790.775] * (-797.457) [-784.458] (-785.403) (-785.655) -- 0:01:26
      34000 -- (-792.758) (-785.623) [-786.204] (-802.705) * (-797.219) (-783.464) [-787.667] (-786.571) -- 0:01:25
      34500 -- (-803.378) (-785.661) [-784.835] (-794.611) * (-798.529) (-786.296) [-784.408] (-788.053) -- 0:01:23
      35000 -- (-796.018) (-786.115) (-785.063) [-796.229] * [-790.387] (-786.996) (-787.578) (-787.272) -- 0:01:22

      Average standard deviation of split frequencies: 0.034295

      35500 -- (-799.834) [-785.704] (-784.519) (-794.059) * (-798.120) [-791.004] (-783.870) (-788.011) -- 0:01:21
      36000 -- (-794.473) [-788.181] (-787.226) (-792.553) * (-798.443) (-792.413) (-784.727) [-786.961] -- 0:01:20
      36500 -- (-806.274) [-785.870] (-785.586) (-798.218) * (-796.624) (-790.392) (-786.315) [-787.258] -- 0:01:19
      37000 -- (-789.558) [-785.933] (-783.434) (-792.982) * (-799.633) [-785.156] (-784.157) (-786.870) -- 0:01:18
      37500 -- (-785.193) (-785.951) (-784.602) [-793.799] * (-798.980) [-785.912] (-786.957) (-785.281) -- 0:01:17
      38000 -- (-787.977) (-788.280) (-784.280) [-794.620] * (-799.155) [-786.731] (-787.242) (-786.210) -- 0:01:15
      38500 -- [-784.327] (-788.102) (-784.680) (-790.284) * (-804.371) (-785.227) [-784.410] (-786.396) -- 0:01:14
      39000 -- (-785.677) (-786.745) (-786.065) [-803.186] * (-795.069) (-787.292) [-783.776] (-785.141) -- 0:01:13
      39500 -- (-783.421) (-784.185) [-784.840] (-795.894) * (-799.958) (-787.577) [-785.658] (-785.820) -- 0:01:12
      40000 -- (-783.873) (-784.078) (-785.984) [-792.397] * (-800.021) (-785.896) [-788.777] (-786.706) -- 0:01:12

      Average standard deviation of split frequencies: 0.038640

      40500 -- [-784.375] (-784.342) (-785.971) (-793.564) * [-795.666] (-786.735) (-793.938) (-786.857) -- 0:01:11
      41000 -- (-786.882) (-787.536) [-786.714] (-791.812) * (-794.071) (-789.058) [-784.506] (-787.764) -- 0:01:10
      41500 -- (-786.490) (-788.368) (-783.854) [-790.542] * (-792.302) (-784.911) [-785.027] (-785.963) -- 0:01:09
      42000 -- (-784.528) (-786.029) (-784.236) [-790.318] * (-799.609) [-784.574] (-786.473) (-786.164) -- 0:01:08
      42500 -- [-784.829] (-785.950) (-783.516) (-802.692) * (-790.880) [-784.864] (-787.300) (-787.060) -- 0:01:07
      43000 -- (-784.155) [-786.369] (-786.780) (-792.831) * [-795.625] (-786.687) (-784.332) (-784.830) -- 0:01:06
      43500 -- (-787.157) (-784.124) (-785.179) [-791.223] * (-799.430) [-787.719] (-783.365) (-785.423) -- 0:01:05
      44000 -- (-793.931) (-783.679) [-787.134] (-794.512) * (-801.280) (-788.220) (-787.027) [-783.726] -- 0:01:05
      44500 -- [-784.265] (-783.291) (-784.176) (-795.514) * (-794.198) (-787.945) [-784.598] (-785.750) -- 0:01:04
      45000 -- (-787.040) (-784.762) (-783.853) [-796.063] * [-791.300] (-786.488) (-785.930) (-789.513) -- 0:01:24

      Average standard deviation of split frequencies: 0.032901

      45500 -- (-784.626) [-785.109] (-784.377) (-794.068) * (-798.250) [-785.130] (-786.404) (-788.349) -- 0:01:23
      46000 -- (-785.150) (-787.756) [-783.992] (-792.636) * (-792.967) (-784.620) (-788.180) [-788.337] -- 0:01:22
      46500 -- (-784.658) (-785.632) [-784.168] (-797.442) * (-792.912) [-784.908] (-788.004) (-788.755) -- 0:01:22
      47000 -- (-785.543) [-786.595] (-785.070) (-796.357) * (-798.117) (-786.206) [-785.440] (-788.144) -- 0:01:21
      47500 -- (-785.543) (-786.424) [-785.608] (-797.429) * [-792.007] (-786.550) (-787.318) (-786.681) -- 0:01:20
      48000 -- (-786.903) (-786.797) [-783.735] (-799.767) * (-800.865) [-787.887] (-787.087) (-785.044) -- 0:01:19
      48500 -- (-785.253) (-788.962) [-786.670] (-795.324) * (-805.401) (-788.363) (-786.035) [-786.089] -- 0:01:18
      49000 -- (-784.560) [-787.811] (-784.566) (-792.412) * (-806.047) [-786.141] (-784.813) (-786.165) -- 0:01:17
      49500 -- (-784.331) (-786.147) (-785.423) [-793.766] * (-792.195) (-786.521) (-785.111) [-786.262] -- 0:01:16
      50000 -- (-784.527) (-785.064) [-783.862] (-790.899) * [-790.612] (-784.262) (-787.123) (-784.520) -- 0:01:16

      Average standard deviation of split frequencies: 0.023015

      50500 -- [-784.620] (-784.113) (-785.569) (-799.304) * [-795.360] (-784.392) (-788.026) (-784.589) -- 0:01:15
      51000 -- (-785.881) (-787.710) (-784.269) [-793.401] * [-795.992] (-784.207) (-790.158) (-786.215) -- 0:01:14
      51500 -- (-785.543) (-790.191) (-784.920) [-793.020] * (-802.227) (-788.341) [-784.312] (-785.646) -- 0:01:13
      52000 -- (-786.451) (-785.180) [-787.030] (-790.501) * (-798.365) (-789.340) [-784.060] (-786.113) -- 0:01:12
      52500 -- (-785.665) (-786.197) [-785.195] (-794.026) * (-795.523) (-785.494) (-787.167) [-784.964] -- 0:01:12
      53000 -- (-786.285) [-784.592] (-786.672) (-794.060) * (-789.181) (-788.687) [-784.690] (-787.048) -- 0:01:11
      53500 -- [-785.236] (-785.220) (-785.984) (-798.095) * [-795.013] (-788.410) (-784.994) (-785.445) -- 0:01:10
      54000 -- (-784.280) [-784.395] (-785.757) (-802.826) * (-796.790) [-787.066] (-785.225) (-785.976) -- 0:01:10
      54500 -- [-784.612] (-784.429) (-786.535) (-798.817) * (-793.565) [-786.501] (-788.076) (-787.492) -- 0:01:09
      55000 -- (-783.544) [-783.714] (-784.648) (-794.852) * [-789.587] (-784.624) (-792.502) (-787.165) -- 0:01:08

      Average standard deviation of split frequencies: 0.022152

      55500 -- (-784.733) (-785.251) [-783.601] (-801.008) * [-794.992] (-784.897) (-789.292) (-784.719) -- 0:01:08
      56000 -- (-785.553) [-785.598] (-785.332) (-796.739) * (-796.178) (-784.434) (-785.966) [-784.765] -- 0:01:07
      56500 -- (-786.141) (-785.823) (-786.512) [-784.754] * [-792.191] (-784.370) (-788.332) (-784.007) -- 0:01:06
      57000 -- (-787.212) (-784.120) (-784.806) [-786.825] * (-801.237) (-784.418) [-788.580] (-784.306) -- 0:01:06
      57500 -- (-787.421) (-785.605) [-784.646] (-784.063) * (-799.094) [-786.131] (-785.500) (-784.568) -- 0:01:05
      58000 -- (-788.391) (-787.250) (-783.776) [-785.295] * (-795.925) (-787.529) (-787.869) [-784.592] -- 0:01:04
      58500 -- (-788.919) [-784.832] (-784.399) (-786.395) * (-798.313) [-786.525] (-786.054) (-785.803) -- 0:01:04
      59000 -- (-786.799) (-788.330) (-785.345) [-785.314] * (-791.068) (-784.583) [-783.650] (-785.339) -- 0:01:19
      59500 -- (-786.458) (-786.435) (-783.868) [-785.561] * (-791.824) (-785.490) (-785.671) [-788.188] -- 0:01:19
      60000 -- (-785.498) [-785.454] (-786.703) (-787.401) * (-802.891) [-783.841] (-785.194) (-783.891) -- 0:01:18

      Average standard deviation of split frequencies: 0.021153

      60500 -- (-786.915) (-789.001) [-783.558] (-785.872) * [-790.747] (-786.166) (-783.812) (-784.985) -- 0:01:17
      61000 -- (-786.344) (-787.375) [-784.630] (-786.723) * [-791.056] (-788.148) (-783.438) (-783.872) -- 0:01:16
      61500 -- (-787.915) (-785.349) (-784.814) [-786.417] * (-790.079) (-787.590) [-783.890] (-787.538) -- 0:01:16
      62000 -- (-789.060) [-785.700] (-784.289) (-785.110) * (-791.875) [-791.876] (-783.312) (-786.301) -- 0:01:15
      62500 -- [-790.276] (-785.924) (-786.561) (-785.340) * (-798.697) (-787.536) [-783.311] (-788.251) -- 0:01:15
      63000 -- (-789.019) (-783.917) (-785.971) [-785.795] * (-794.844) (-787.910) (-787.020) [-785.205] -- 0:01:14
      63500 -- (-788.454) (-785.050) (-786.271) [-783.883] * (-794.246) (-787.478) (-786.866) [-785.498] -- 0:01:13
      64000 -- (-787.817) (-783.901) [-784.480] (-786.916) * (-791.998) [-786.246] (-791.370) (-788.788) -- 0:01:13
      64500 -- (-784.721) (-785.199) (-783.450) [-783.765] * [-791.466] (-793.591) (-783.532) (-787.382) -- 0:01:12
      65000 -- (-785.777) [-785.778] (-785.856) (-783.836) * (-791.006) (-785.230) [-784.119] (-790.361) -- 0:01:11

      Average standard deviation of split frequencies: 0.022179

      65500 -- (-786.611) (-783.638) (-785.543) [-787.180] * [-792.413] (-786.461) (-786.597) (-785.582) -- 0:01:11
      66000 -- (-790.114) (-786.268) (-786.236) [-785.582] * (-793.692) (-788.716) (-784.319) [-786.980] -- 0:01:10
      66500 -- [-785.280] (-787.415) (-784.892) (-785.761) * (-799.856) (-785.581) [-784.396] (-784.401) -- 0:01:10
      67000 -- (-792.747) [-786.888] (-784.796) (-784.049) * (-789.835) (-785.346) (-784.357) [-784.752] -- 0:01:09
      67500 -- (-787.513) [-787.144] (-785.458) (-785.885) * (-789.684) (-785.320) [-785.578] (-785.055) -- 0:01:09
      68000 -- [-787.691] (-785.662) (-784.763) (-785.599) * (-794.608) (-783.977) (-785.342) [-785.934] -- 0:01:08
      68500 -- (-789.409) [-784.603] (-784.163) (-785.835) * [-788.313] (-783.966) (-787.315) (-785.921) -- 0:01:07
      69000 -- (-787.302) [-784.860] (-784.977) (-783.876) * (-789.849) (-785.778) (-787.018) [-785.368] -- 0:01:07
      69500 -- [-786.866] (-787.591) (-786.054) (-785.080) * (-793.722) (-785.496) [-786.402] (-786.220) -- 0:01:06
      70000 -- (-784.423) (-786.154) [-784.355] (-788.460) * [-796.790] (-785.293) (-787.723) (-785.744) -- 0:01:06

      Average standard deviation of split frequencies: 0.023523

      70500 -- [-784.082] (-785.774) (-784.947) (-791.372) * (-792.722) [-784.192] (-789.232) (-788.960) -- 0:01:05
      71000 -- (-787.705) (-784.434) [-784.019] (-789.640) * [-792.682] (-784.692) (-791.195) (-790.128) -- 0:01:05
      71500 -- (-784.684) [-785.720] (-784.833) (-785.967) * [-794.795] (-784.282) (-784.579) (-787.154) -- 0:01:04
      72000 -- (-783.826) [-786.486] (-786.793) (-783.932) * [-795.179] (-784.335) (-788.597) (-791.339) -- 0:01:04
      72500 -- (-786.806) (-787.440) [-783.914] (-783.730) * (-797.405) (-784.278) (-786.154) [-785.598] -- 0:01:16
      73000 -- [-790.786] (-791.950) (-783.992) (-784.308) * (-798.102) [-785.189] (-784.995) (-786.766) -- 0:01:16
      73500 -- (-785.799) (-786.798) (-785.391) [-784.425] * (-796.551) (-785.904) (-784.397) [-786.162] -- 0:01:15
      74000 -- (-786.267) (-785.721) [-785.660] (-787.383) * (-795.865) (-783.795) [-784.460] (-786.714) -- 0:01:15
      74500 -- (-786.521) [-785.583] (-785.042) (-784.410) * (-799.527) [-783.991] (-787.211) (-787.325) -- 0:01:14
      75000 -- (-784.529) (-783.900) (-784.949) [-784.215] * (-796.091) [-783.980] (-790.216) (-787.355) -- 0:01:14

      Average standard deviation of split frequencies: 0.023505

      75500 -- [-785.381] (-787.128) (-784.198) (-786.325) * (-794.371) [-783.933] (-789.331) (-785.450) -- 0:01:13
      76000 -- (-784.677) (-786.383) (-785.474) [-785.643] * (-798.772) [-784.576] (-783.748) (-790.391) -- 0:01:12
      76500 -- (-785.359) [-783.672] (-784.876) (-785.492) * (-795.777) (-784.079) (-787.126) [-789.029] -- 0:01:12
      77000 -- (-788.147) (-784.320) (-783.169) [-785.653] * (-799.310) (-783.588) [-784.316] (-788.610) -- 0:01:11
      77500 -- (-785.095) (-784.132) [-784.464] (-784.635) * [-792.490] (-784.196) (-786.502) (-789.649) -- 0:01:11
      78000 -- (-786.856) [-785.699] (-785.078) (-786.421) * (-795.516) [-785.095] (-783.721) (-786.524) -- 0:01:10
      78500 -- (-785.688) (-784.893) (-783.622) [-785.522] * [-794.447] (-785.074) (-790.078) (-785.823) -- 0:01:10
      79000 -- (-783.820) [-783.772] (-787.008) (-787.003) * [-789.745] (-788.354) (-786.308) (-787.529) -- 0:01:09
      79500 -- (-784.185) (-787.315) [-783.982] (-788.987) * [-791.958] (-784.922) (-786.748) (-789.087) -- 0:01:09
      80000 -- [-786.192] (-786.153) (-787.781) (-789.885) * (-798.115) [-788.128] (-787.357) (-788.072) -- 0:01:09

      Average standard deviation of split frequencies: 0.020454

      80500 -- (-790.212) (-787.643) [-784.768] (-783.886) * (-799.050) (-789.008) (-787.444) [-784.880] -- 0:01:08
      81000 -- [-786.203] (-785.762) (-784.699) (-787.812) * [-790.435] (-787.691) (-785.067) (-789.269) -- 0:01:08
      81500 -- [-785.595] (-785.495) (-785.702) (-783.740) * (-796.370) [-785.564] (-785.435) (-788.213) -- 0:01:07
      82000 -- (-784.971) [-786.134] (-786.573) (-784.490) * [-789.654] (-791.286) (-788.932) (-786.394) -- 0:01:07
      82500 -- [-784.313] (-785.331) (-787.018) (-785.377) * [-798.456] (-792.750) (-787.495) (-784.152) -- 0:01:06
      83000 -- (-786.781) (-786.075) (-788.372) [-787.561] * [-791.273] (-791.086) (-786.578) (-785.403) -- 0:01:06
      83500 -- (-784.439) (-784.531) (-785.617) [-785.160] * (-798.692) (-785.371) (-788.246) [-786.310] -- 0:01:05
      84000 -- (-784.719) (-784.912) (-786.363) [-784.286] * (-797.083) [-784.209] (-787.979) (-784.277) -- 0:01:05
      84500 -- (-784.751) [-784.250] (-785.894) (-784.286) * (-792.721) (-784.518) (-785.235) [-784.292] -- 0:01:05
      85000 -- (-784.694) (-784.632) (-784.652) [-784.083] * (-793.613) [-786.661] (-786.536) (-783.425) -- 0:01:04

      Average standard deviation of split frequencies: 0.019041

      85500 -- (-786.692) [-784.164] (-785.409) (-784.431) * (-797.760) (-785.879) [-784.226] (-786.266) -- 0:01:04
      86000 -- (-784.481) (-784.666) [-784.795] (-785.585) * (-797.901) (-786.226) (-784.194) [-787.818] -- 0:01:03
      86500 -- (-789.122) [-784.666] (-784.129) (-784.599) * (-791.569) [-788.604] (-784.517) (-784.864) -- 0:01:03
      87000 -- (-784.854) (-784.160) [-785.237] (-785.230) * (-800.776) [-789.062] (-784.035) (-785.566) -- 0:01:02
      87500 -- (-784.240) (-785.158) [-784.583] (-784.308) * (-791.269) (-783.443) [-784.076] (-784.365) -- 0:01:13
      88000 -- [-786.025] (-783.893) (-784.414) (-787.311) * (-788.768) (-784.074) (-787.409) [-783.856] -- 0:01:12
      88500 -- (-785.487) (-788.124) (-784.623) [-785.015] * (-795.872) (-784.281) [-785.990] (-788.028) -- 0:01:12
      89000 -- (-785.444) [-784.946] (-783.988) (-786.332) * (-792.795) (-784.190) [-785.080] (-784.075) -- 0:01:11
      89500 -- (-786.717) (-784.831) (-784.843) [-786.648] * (-805.192) (-788.956) [-783.970] (-783.814) -- 0:01:11
      90000 -- (-788.867) (-784.535) [-784.513] (-786.141) * [-794.878] (-789.555) (-784.618) (-785.704) -- 0:01:10

      Average standard deviation of split frequencies: 0.018061

      90500 -- (-785.973) [-784.130] (-784.790) (-786.150) * (-791.627) [-789.081] (-785.163) (-784.095) -- 0:01:10
      91000 -- (-788.800) (-784.238) (-786.355) [-790.484] * [-796.073] (-785.873) (-787.848) (-783.833) -- 0:01:09
      91500 -- [-784.741] (-790.496) (-787.039) (-786.623) * (-789.139) (-789.222) [-783.929] (-785.633) -- 0:01:09
      92000 -- [-784.671] (-786.998) (-785.293) (-787.293) * (-797.769) (-787.825) [-784.107] (-784.117) -- 0:01:09
      92500 -- (-784.927) [-785.137] (-787.141) (-783.376) * [-799.922] (-785.308) (-786.939) (-787.668) -- 0:01:08
      93000 -- (-785.060) (-789.319) [-785.609] (-785.080) * (-794.185) (-787.517) (-788.998) [-784.545] -- 0:01:08
      93500 -- (-785.394) [-785.609] (-783.686) (-788.966) * [-796.038] (-785.288) (-785.031) (-785.288) -- 0:01:07
      94000 -- (-784.280) (-786.966) (-784.239) [-787.108] * (-791.975) (-787.847) (-785.494) [-787.192] -- 0:01:07
      94500 -- (-784.589) (-784.150) (-784.822) [-786.252] * (-793.338) (-788.674) (-787.375) [-786.461] -- 0:01:07
      95000 -- (-784.025) [-785.440] (-785.860) (-786.181) * (-797.673) (-784.076) [-785.418] (-786.245) -- 0:01:06

      Average standard deviation of split frequencies: 0.017833

      95500 -- (-784.022) (-785.417) [-785.062] (-785.821) * (-798.344) (-784.186) (-786.926) [-784.734] -- 0:01:06
      96000 -- [-784.246] (-789.108) (-785.256) (-785.348) * (-791.982) (-784.680) [-787.337] (-785.089) -- 0:01:05
      96500 -- [-783.561] (-786.034) (-790.663) (-784.526) * (-793.029) [-784.456] (-786.737) (-785.999) -- 0:01:05
      97000 -- (-783.870) [-783.907] (-790.765) (-789.946) * (-796.469) (-786.557) [-786.449] (-784.006) -- 0:01:05
      97500 -- (-783.859) (-785.770) [-788.137] (-786.380) * (-794.051) [-785.648] (-785.334) (-783.480) -- 0:01:04
      98000 -- (-785.990) (-784.804) (-787.951) [-784.925] * (-801.536) [-784.746] (-788.460) (-783.791) -- 0:01:04
      98500 -- [-784.304] (-786.276) (-787.106) (-783.271) * [-789.255] (-787.911) (-787.559) (-786.867) -- 0:01:04
      99000 -- (-785.738) (-786.704) (-788.970) [-787.596] * [-792.217] (-787.989) (-787.024) (-785.176) -- 0:01:03
      99500 -- (-786.312) (-784.134) (-794.921) [-785.074] * (-793.408) (-785.043) (-788.854) [-785.144] -- 0:01:03
      100000 -- (-786.176) (-784.501) [-787.027] (-787.238) * (-792.128) (-787.198) (-786.330) [-785.239] -- 0:01:02

      Average standard deviation of split frequencies: 0.019252

      100500 -- (-786.244) [-785.068] (-785.763) (-785.445) * (-809.232) (-787.320) [-788.734] (-785.524) -- 0:01:02
      101000 -- [-786.930] (-789.287) (-790.070) (-788.940) * (-787.706) [-785.512] (-786.770) (-787.420) -- 0:01:11
      101500 -- [-788.365] (-784.024) (-785.625) (-785.841) * (-785.227) [-784.093] (-789.369) (-784.550) -- 0:01:10
      102000 -- (-787.453) [-783.629] (-785.052) (-785.873) * (-784.285) [-785.855] (-791.816) (-784.213) -- 0:01:10
      102500 -- (-789.025) [-788.057] (-786.068) (-784.635) * (-785.300) [-786.552] (-786.036) (-783.824) -- 0:01:10
      103000 -- (-789.483) [-785.640] (-784.526) (-783.992) * (-786.192) [-789.317] (-784.702) (-785.818) -- 0:01:09
      103500 -- (-784.183) (-785.779) [-784.793] (-786.707) * (-786.987) (-791.208) (-785.136) [-786.732] -- 0:01:09
      104000 -- [-787.402] (-784.160) (-786.017) (-789.658) * (-785.780) (-791.337) [-785.043] (-788.763) -- 0:01:08
      104500 -- (-785.893) [-785.648] (-788.450) (-785.344) * (-783.866) [-784.568] (-786.331) (-792.126) -- 0:01:08
      105000 -- (-787.185) (-787.811) (-789.551) [-784.673] * (-784.953) [-784.188] (-789.304) (-787.632) -- 0:01:08

      Average standard deviation of split frequencies: 0.018283

      105500 -- [-786.416] (-788.204) (-786.386) (-784.669) * [-787.858] (-786.850) (-787.977) (-785.633) -- 0:01:07
      106000 -- (-788.265) (-787.527) (-785.536) [-786.643] * (-784.514) (-788.286) [-786.991] (-786.294) -- 0:01:07
      106500 -- (-786.224) [-787.945] (-785.431) (-787.040) * (-784.463) (-785.851) [-785.628] (-786.967) -- 0:01:07
      107000 -- (-785.893) (-786.836) [-784.953] (-786.842) * (-787.386) (-785.745) [-786.018] (-787.414) -- 0:01:06
      107500 -- (-783.556) [-786.280] (-786.053) (-785.738) * (-785.091) [-784.318] (-788.911) (-785.944) -- 0:01:06
      108000 -- [-784.532] (-788.925) (-785.963) (-785.432) * [-784.421] (-785.996) (-788.435) (-784.202) -- 0:01:06
      108500 -- [-788.811] (-785.107) (-787.218) (-784.715) * (-785.833) [-786.624] (-788.065) (-783.961) -- 0:01:05
      109000 -- (-786.156) (-787.791) [-788.052] (-785.030) * [-784.148] (-785.380) (-789.856) (-785.540) -- 0:01:05
      109500 -- [-784.151] (-786.564) (-786.379) (-787.667) * (-783.848) (-783.853) (-787.902) [-784.455] -- 0:01:05
      110000 -- (-784.378) [-784.065] (-785.670) (-787.443) * (-784.819) (-787.801) [-785.788] (-783.764) -- 0:01:04

      Average standard deviation of split frequencies: 0.017512

      110500 -- (-786.200) [-783.933] (-785.342) (-787.401) * [-784.207] (-788.265) (-784.808) (-784.212) -- 0:01:04
      111000 -- (-785.067) [-784.633] (-786.044) (-791.901) * [-784.453] (-784.238) (-786.621) (-783.517) -- 0:01:04
      111500 -- (-785.613) [-783.881] (-787.573) (-786.225) * (-784.642) (-784.613) (-786.042) [-785.076] -- 0:01:03
      112000 -- (-784.958) (-784.853) (-784.512) [-784.367] * (-788.650) (-784.770) [-785.475] (-787.345) -- 0:01:03
      112500 -- [-786.822] (-788.645) (-784.180) (-786.350) * (-787.196) (-784.920) [-785.412] (-785.402) -- 0:01:03
      113000 -- (-784.765) (-790.853) [-784.636] (-783.703) * (-786.157) (-788.340) (-783.691) [-786.049] -- 0:01:02
      113500 -- (-786.035) (-786.958) [-784.669] (-786.109) * (-783.992) [-785.159] (-786.311) (-785.056) -- 0:01:02
      114000 -- (-787.522) (-787.276) [-784.832] (-789.686) * [-786.397] (-784.969) (-788.136) (-783.585) -- 0:01:02
      114500 -- [-786.094] (-787.852) (-786.906) (-789.408) * [-786.602] (-784.363) (-786.290) (-784.156) -- 0:01:01
      115000 -- (-784.517) (-784.924) [-783.442] (-789.324) * (-785.964) (-785.300) (-786.601) [-785.518] -- 0:01:09

      Average standard deviation of split frequencies: 0.017384

      115500 -- (-784.575) (-791.288) [-784.269] (-786.155) * [-786.472] (-790.312) (-784.189) (-784.546) -- 0:01:08
      116000 -- [-787.095] (-785.460) (-784.489) (-784.633) * (-788.754) (-788.231) (-786.316) [-784.491] -- 0:01:08
      116500 -- (-788.988) [-784.306] (-787.658) (-786.668) * (-790.455) (-785.687) (-785.819) [-784.183] -- 0:01:08
      117000 -- (-785.771) (-785.512) [-785.643] (-786.061) * (-789.957) (-786.681) [-785.488] (-783.612) -- 0:01:07
      117500 -- (-787.622) [-784.861] (-785.840) (-788.873) * (-787.687) (-784.393) (-786.360) [-785.067] -- 0:01:07
      118000 -- (-785.144) (-786.059) [-784.158] (-788.766) * (-787.497) [-785.334] (-785.618) (-784.307) -- 0:01:07
      118500 -- (-785.548) (-785.514) (-785.798) [-784.838] * (-784.639) [-784.146] (-786.168) (-784.864) -- 0:01:06
      119000 -- (-788.810) [-786.691] (-786.529) (-784.054) * [-785.727] (-785.090) (-787.757) (-789.873) -- 0:01:06
      119500 -- [-784.199] (-787.773) (-787.125) (-783.770) * (-784.287) (-787.989) [-787.202] (-788.469) -- 0:01:06
      120000 -- (-786.188) (-786.177) [-784.917] (-783.566) * [-785.572] (-786.070) (-786.053) (-786.156) -- 0:01:06

      Average standard deviation of split frequencies: 0.015193

      120500 -- (-783.643) (-785.924) [-786.722] (-783.799) * (-788.009) [-784.549] (-787.643) (-786.549) -- 0:01:05
      121000 -- [-785.069] (-784.828) (-784.520) (-785.702) * (-784.603) (-789.800) (-787.061) [-785.054] -- 0:01:05
      121500 -- (-791.882) (-784.641) (-787.521) [-785.300] * [-785.241] (-794.852) (-786.722) (-787.862) -- 0:01:05
      122000 -- (-786.096) (-784.187) [-786.726] (-783.823) * (-788.225) [-790.881] (-787.657) (-786.055) -- 0:01:04
      122500 -- (-785.039) (-784.508) (-785.893) [-783.430] * (-791.852) [-786.449] (-792.695) (-785.699) -- 0:01:04
      123000 -- (-785.840) (-785.211) (-786.162) [-787.802] * (-784.395) (-790.248) [-787.687] (-783.680) -- 0:01:04
      123500 -- (-785.249) (-785.594) (-783.913) [-783.544] * (-785.189) (-791.082) (-787.619) [-784.909] -- 0:01:03
      124000 -- [-785.403] (-786.529) (-783.591) (-783.525) * (-784.002) (-787.269) (-786.266) [-786.803] -- 0:01:03
      124500 -- [-787.876] (-783.929) (-785.344) (-786.514) * (-786.238) (-786.597) (-785.144) [-784.612] -- 0:01:03
      125000 -- [-785.769] (-784.705) (-786.478) (-784.854) * (-784.801) (-787.737) (-785.016) [-785.262] -- 0:01:03

      Average standard deviation of split frequencies: 0.015162

      125500 -- [-786.634] (-783.777) (-784.904) (-789.858) * (-787.302) (-785.628) [-784.430] (-787.530) -- 0:01:02
      126000 -- (-786.589) [-784.504] (-790.018) (-785.460) * (-783.749) (-786.407) [-785.776] (-790.907) -- 0:01:02
      126500 -- (-786.189) (-784.781) [-784.714] (-785.705) * [-783.210] (-791.201) (-784.181) (-787.890) -- 0:01:02
      127000 -- [-785.964] (-785.986) (-784.735) (-788.694) * (-783.257) (-788.126) [-785.744] (-789.330) -- 0:01:01
      127500 -- (-786.798) [-784.702] (-785.351) (-788.530) * (-783.932) (-783.607) (-785.689) [-787.653] -- 0:01:01
      128000 -- (-789.939) [-785.244] (-786.086) (-785.628) * (-787.901) (-783.458) (-787.159) [-786.600] -- 0:01:01
      128500 -- (-785.967) [-785.255] (-785.314) (-786.698) * [-787.325] (-784.857) (-787.405) (-785.613) -- 0:01:07
      129000 -- (-785.051) (-784.592) [-783.888] (-786.418) * (-787.556) (-784.767) (-786.730) [-786.186] -- 0:01:07
      129500 -- (-787.404) (-786.434) [-784.567] (-785.101) * (-784.778) (-784.982) (-785.641) [-784.220] -- 0:01:07
      130000 -- (-783.750) (-783.993) (-784.285) [-783.893] * (-787.117) (-783.921) [-785.763] (-789.171) -- 0:01:06

      Average standard deviation of split frequencies: 0.013709

      130500 -- [-783.613] (-783.854) (-791.286) (-785.908) * (-786.927) (-785.981) [-785.371] (-787.865) -- 0:01:06
      131000 -- (-785.060) [-784.808] (-786.759) (-788.383) * [-785.364] (-787.945) (-785.251) (-786.780) -- 0:01:06
      131500 -- (-785.246) (-788.391) [-783.633] (-785.304) * (-786.418) (-787.706) (-786.644) [-788.912] -- 0:01:06
      132000 -- [-784.137] (-789.847) (-788.867) (-785.637) * [-783.949] (-784.966) (-785.827) (-786.799) -- 0:01:05
      132500 -- (-786.002) (-786.154) (-786.606) [-784.412] * (-786.147) (-785.124) (-785.125) [-786.140] -- 0:01:05
      133000 -- (-790.346) [-784.926] (-786.123) (-788.944) * [-787.053] (-786.784) (-785.279) (-785.190) -- 0:01:05
      133500 -- (-786.650) (-783.926) [-787.265] (-788.869) * (-784.876) (-784.501) [-784.664] (-786.059) -- 0:01:04
      134000 -- (-784.544) (-788.239) [-784.770] (-787.283) * (-784.160) [-784.708] (-783.731) (-787.335) -- 0:01:04
      134500 -- [-785.335] (-785.378) (-784.843) (-787.059) * [-784.789] (-789.967) (-786.557) (-785.315) -- 0:01:04
      135000 -- (-785.543) [-784.668] (-784.461) (-784.823) * [-785.713] (-785.855) (-784.264) (-786.468) -- 0:01:04

      Average standard deviation of split frequencies: 0.016638

      135500 -- [-784.650] (-784.165) (-784.161) (-785.310) * (-785.124) (-786.878) (-783.600) [-785.540] -- 0:01:03
      136000 -- (-784.047) (-785.349) (-786.669) [-783.404] * (-786.025) [-786.362] (-787.171) (-785.359) -- 0:01:03
      136500 -- (-785.910) (-785.830) [-787.910] (-788.246) * (-789.495) [-784.104] (-789.600) (-786.095) -- 0:01:03
      137000 -- (-785.110) [-785.023] (-788.649) (-788.131) * (-785.208) (-785.263) (-787.567) [-787.489] -- 0:01:02
      137500 -- (-784.125) (-785.093) [-785.852] (-785.767) * (-785.239) (-788.622) [-785.529] (-787.418) -- 0:01:02
      138000 -- [-783.842] (-786.009) (-791.857) (-787.501) * [-785.125] (-787.559) (-787.755) (-786.410) -- 0:01:02
      138500 -- (-786.430) (-787.986) [-785.470] (-787.430) * [-786.058] (-786.617) (-784.505) (-788.138) -- 0:01:02
      139000 -- (-785.293) (-787.523) [-785.308] (-787.209) * [-785.348] (-783.773) (-785.490) (-785.701) -- 0:01:01
      139500 -- (-784.214) (-787.934) [-785.977] (-784.313) * (-790.172) [-783.716] (-791.472) (-786.332) -- 0:01:01
      140000 -- (-784.579) (-790.438) [-783.345] (-784.698) * (-786.771) (-785.080) (-789.564) [-788.118] -- 0:01:01

      Average standard deviation of split frequencies: 0.019102

      140500 -- (-784.283) (-791.212) [-784.806] (-785.271) * (-788.701) [-785.172] (-787.630) (-786.932) -- 0:01:01
      141000 -- (-784.061) (-788.688) [-784.586] (-785.385) * [-787.064] (-786.096) (-784.539) (-784.769) -- 0:01:00
      141500 -- (-784.704) [-785.755] (-787.856) (-787.426) * (-785.005) (-784.362) [-784.400] (-784.767) -- 0:01:00
      142000 -- (-783.428) [-785.474] (-785.166) (-785.651) * (-789.597) (-788.970) [-783.930] (-784.038) -- 0:01:06
      142500 -- (-784.541) (-786.810) [-787.280] (-787.236) * (-783.176) (-789.040) (-784.017) [-783.739] -- 0:01:06
      143000 -- [-784.056] (-789.687) (-786.511) (-783.824) * (-784.916) (-785.072) [-784.374] (-785.102) -- 0:01:05
      143500 -- (-785.858) (-786.639) (-784.780) [-785.662] * (-785.656) [-784.045] (-787.304) (-785.232) -- 0:01:05
      144000 -- (-795.707) (-783.759) [-784.598] (-787.297) * [-784.791] (-793.217) (-786.217) (-786.051) -- 0:01:05
      144500 -- (-788.498) (-785.124) (-785.073) [-785.725] * (-784.690) [-784.245] (-788.168) (-787.646) -- 0:01:05
      145000 -- (-790.407) (-784.640) [-783.226] (-784.013) * [-784.824] (-783.733) (-791.707) (-786.579) -- 0:01:04

      Average standard deviation of split frequencies: 0.017436

      145500 -- (-784.264) [-787.491] (-783.589) (-786.076) * (-784.468) [-783.625] (-792.057) (-784.464) -- 0:01:04
      146000 -- (-784.571) (-784.953) (-786.824) [-787.257] * [-785.884] (-786.514) (-784.382) (-786.214) -- 0:01:04
      146500 -- (-783.853) [-784.945] (-785.528) (-790.426) * (-786.143) (-788.366) (-784.972) [-786.468] -- 0:01:04
      147000 -- [-784.804] (-784.073) (-786.272) (-786.981) * (-784.358) (-791.520) [-785.124] (-787.705) -- 0:01:03
      147500 -- (-786.529) (-785.367) [-784.245] (-787.690) * [-785.935] (-783.894) (-787.422) (-787.108) -- 0:01:03
      148000 -- (-785.765) [-786.328] (-784.015) (-784.346) * (-785.516) [-788.738] (-787.075) (-790.242) -- 0:01:03
      148500 -- [-785.012] (-786.405) (-785.298) (-783.827) * (-788.141) [-783.482] (-787.358) (-785.772) -- 0:01:03
      149000 -- (-785.406) (-787.593) (-783.951) [-784.444] * (-786.256) (-791.418) (-788.925) [-786.049] -- 0:01:02
      149500 -- (-785.688) [-784.147] (-784.740) (-784.973) * (-786.301) [-785.011] (-785.559) (-784.677) -- 0:01:02
      150000 -- (-784.429) [-784.869] (-784.683) (-783.847) * (-785.139) (-787.486) [-783.556] (-784.680) -- 0:01:02

      Average standard deviation of split frequencies: 0.020963

      150500 -- (-785.497) (-788.614) (-787.382) [-785.037] * (-786.823) (-785.971) (-785.840) [-784.874] -- 0:01:02
      151000 -- (-789.969) (-790.316) (-783.575) [-785.645] * (-784.439) (-786.151) (-786.174) [-784.767] -- 0:01:01
      151500 -- [-785.742] (-789.310) (-784.930) (-786.169) * (-786.520) (-787.593) (-787.394) [-784.731] -- 0:01:01
      152000 -- (-783.731) [-784.187] (-789.510) (-784.586) * (-786.988) (-787.354) [-785.194] (-785.119) -- 0:01:01
      152500 -- (-784.373) (-787.406) (-788.057) [-784.889] * [-786.445] (-785.147) (-785.141) (-785.783) -- 0:01:01
      153000 -- (-783.423) (-784.744) (-787.418) [-785.701] * (-786.440) (-784.924) (-785.550) [-786.837] -- 0:01:00
      153500 -- (-784.202) (-790.596) (-785.819) [-784.541] * (-785.568) (-786.694) [-786.150] (-785.209) -- 0:01:00
      154000 -- [-785.283] (-786.271) (-784.276) (-784.914) * [-786.654] (-784.234) (-787.793) (-790.253) -- 0:01:00
      154500 -- (-786.677) [-786.447] (-788.620) (-785.943) * (-787.243) [-784.752] (-786.021) (-788.299) -- 0:01:00
      155000 -- (-790.944) [-785.044] (-790.045) (-784.166) * (-786.127) (-785.410) (-787.947) [-788.365] -- 0:00:59

      Average standard deviation of split frequencies: 0.019880

      155500 -- (-787.842) (-784.361) (-785.623) [-785.346] * (-784.645) [-785.143] (-784.868) (-787.088) -- 0:00:59
      156000 -- (-788.363) (-789.624) (-788.521) [-785.470] * (-786.769) [-785.042] (-786.141) (-788.300) -- 0:01:04
      156500 -- (-785.716) [-787.136] (-787.175) (-784.971) * [-785.206] (-785.098) (-785.555) (-785.794) -- 0:01:04
      157000 -- [-785.029] (-786.651) (-786.167) (-786.328) * [-783.682] (-791.251) (-787.929) (-785.548) -- 0:01:04
      157500 -- (-784.452) [-784.193] (-785.894) (-788.985) * (-787.858) (-786.450) [-785.561] (-786.941) -- 0:01:04
      158000 -- [-786.856] (-784.371) (-788.973) (-785.454) * [-783.843] (-783.746) (-784.247) (-784.569) -- 0:01:03
      158500 -- (-786.470) (-786.428) (-784.579) [-783.764] * [-785.201] (-784.636) (-785.766) (-783.948) -- 0:01:03
      159000 -- (-787.010) (-787.783) [-785.681] (-785.629) * (-784.930) (-787.229) (-789.356) [-788.032] -- 0:01:03
      159500 -- (-787.916) (-783.546) [-784.896] (-784.693) * [-784.595] (-788.510) (-788.428) (-784.633) -- 0:01:03
      160000 -- [-785.963] (-784.976) (-785.276) (-784.914) * (-785.783) (-786.752) (-785.611) [-788.319] -- 0:01:02

      Average standard deviation of split frequencies: 0.019952

      160500 -- (-783.969) (-787.065) (-784.862) [-784.752] * (-788.555) (-786.840) (-785.419) [-784.526] -- 0:01:02
      161000 -- (-783.998) (-785.247) [-791.152] (-784.998) * (-785.910) [-786.287] (-785.298) (-783.967) -- 0:01:02
      161500 -- [-787.086] (-787.057) (-786.838) (-787.437) * (-785.305) (-791.425) [-785.725] (-785.628) -- 0:01:02
      162000 -- (-786.466) (-788.040) (-786.091) [-786.032] * [-789.925] (-786.833) (-794.037) (-786.893) -- 0:01:02
      162500 -- (-785.912) [-783.949] (-785.927) (-785.816) * (-791.436) (-788.038) [-784.242] (-784.302) -- 0:01:01
      163000 -- (-787.354) [-785.242] (-786.105) (-783.488) * (-785.925) (-788.290) [-786.594] (-785.877) -- 0:01:01
      163500 -- (-783.521) (-784.692) [-784.736] (-786.477) * (-785.133) [-783.668] (-785.802) (-790.256) -- 0:01:01
      164000 -- (-784.603) [-786.159] (-784.726) (-787.234) * [-785.763] (-783.789) (-785.358) (-784.426) -- 0:01:01
      164500 -- [-785.787] (-784.995) (-784.257) (-788.874) * (-784.036) (-784.485) (-787.733) [-785.706] -- 0:01:00
      165000 -- [-784.641] (-784.226) (-786.147) (-790.772) * (-784.899) (-786.291) [-787.589] (-787.341) -- 0:01:00

      Average standard deviation of split frequencies: 0.020588

      165500 -- (-787.075) (-783.728) [-785.487] (-788.580) * (-786.102) (-784.159) [-786.385] (-783.889) -- 0:01:00
      166000 -- (-784.314) (-788.335) (-786.274) [-786.124] * (-785.880) [-785.411] (-789.534) (-785.554) -- 0:01:00
      166500 -- (-785.424) (-786.919) [-784.737] (-785.257) * (-784.126) (-784.686) [-785.898] (-784.688) -- 0:01:00
      167000 -- (-783.519) (-784.451) [-788.511] (-784.156) * (-791.255) (-791.147) (-786.199) [-785.803] -- 0:00:59
      167500 -- (-785.331) (-784.263) [-785.832] (-783.860) * (-790.291) [-785.254] (-784.921) (-784.759) -- 0:00:59
      168000 -- (-784.210) (-786.243) (-787.121) [-783.742] * (-788.390) (-784.676) [-786.178] (-786.666) -- 0:00:59
      168500 -- (-785.096) (-789.506) (-784.445) [-783.857] * (-789.859) (-784.720) (-784.163) [-784.144] -- 0:00:59
      169000 -- (-789.199) (-784.776) (-785.278) [-789.984] * (-791.703) [-784.753] (-784.830) (-784.145) -- 0:00:59
      169500 -- [-784.946] (-784.564) (-785.148) (-786.028) * [-785.006] (-784.409) (-786.328) (-783.323) -- 0:00:58
      170000 -- [-784.129] (-784.225) (-787.089) (-786.871) * [-784.915] (-785.422) (-784.819) (-785.298) -- 0:00:58

      Average standard deviation of split frequencies: 0.021225

      170500 -- [-783.720] (-784.526) (-784.506) (-791.637) * [-787.398] (-784.702) (-784.925) (-785.506) -- 0:00:58
      171000 -- (-786.712) [-784.932] (-785.731) (-791.044) * [-788.124] (-784.504) (-784.389) (-789.392) -- 0:01:03
      171500 -- (-789.284) [-784.715] (-787.197) (-785.179) * (-785.737) [-785.780] (-784.956) (-787.950) -- 0:01:02
      172000 -- (-788.877) (-785.413) [-785.783] (-785.327) * (-787.026) (-783.916) [-786.343] (-786.612) -- 0:01:02
      172500 -- (-788.821) (-784.484) (-787.283) [-784.604] * [-784.597] (-785.803) (-788.999) (-785.008) -- 0:01:02
      173000 -- (-784.869) (-785.460) [-784.658] (-783.620) * (-785.730) [-784.059] (-784.433) (-785.505) -- 0:01:02
      173500 -- (-785.158) [-786.069] (-786.804) (-783.743) * (-784.602) (-786.804) (-784.366) [-786.733] -- 0:01:01
      174000 -- (-786.213) [-783.991] (-784.298) (-784.440) * (-788.061) (-787.024) (-786.626) [-786.708] -- 0:01:01
      174500 -- (-785.967) (-784.470) (-783.683) [-786.773] * [-785.212] (-786.370) (-787.400) (-786.927) -- 0:01:01
      175000 -- (-784.472) [-783.993] (-788.618) (-784.977) * [-785.273] (-785.905) (-787.963) (-785.289) -- 0:01:01

      Average standard deviation of split frequencies: 0.022469

      175500 -- (-788.252) (-783.962) [-789.347] (-787.426) * (-786.860) (-785.905) [-786.438] (-789.196) -- 0:01:01
      176000 -- (-784.155) (-792.164) [-786.638] (-786.085) * (-785.352) (-786.205) (-786.248) [-788.962] -- 0:01:00
      176500 -- (-787.698) [-784.811] (-785.393) (-787.078) * (-788.351) (-784.395) (-783.538) [-787.877] -- 0:01:00
      177000 -- (-791.699) [-784.938] (-783.937) (-783.573) * (-784.127) (-784.343) (-783.650) [-784.368] -- 0:01:00
      177500 -- [-784.906] (-784.169) (-786.176) (-783.850) * (-785.438) (-785.500) [-785.132] (-785.686) -- 0:01:00
      178000 -- (-786.374) (-785.180) (-783.378) [-784.036] * (-784.393) (-784.721) [-784.454] (-784.890) -- 0:01:00
      178500 -- (-785.557) [-786.413] (-783.377) (-785.794) * (-787.669) (-786.786) (-784.678) [-785.417] -- 0:00:59
      179000 -- [-785.058] (-787.018) (-784.825) (-788.012) * (-784.175) [-786.613] (-784.605) (-785.354) -- 0:00:59
      179500 -- (-785.908) [-783.611] (-787.185) (-787.806) * [-786.127] (-785.007) (-783.888) (-786.146) -- 0:00:59
      180000 -- (-785.053) (-785.212) [-784.221] (-785.550) * [-784.496] (-785.283) (-785.311) (-784.891) -- 0:00:59

      Average standard deviation of split frequencies: 0.020737

      180500 -- (-785.503) [-783.489] (-786.115) (-784.741) * (-788.645) (-789.402) [-785.365] (-785.931) -- 0:00:59
      181000 -- (-785.001) (-787.053) (-784.452) [-784.295] * (-790.242) (-784.199) [-785.365] (-784.980) -- 0:00:58
      181500 -- (-788.860) (-784.216) [-785.105] (-785.280) * [-787.154] (-787.284) (-786.102) (-783.995) -- 0:00:58
      182000 -- (-786.000) (-784.345) (-785.625) [-786.170] * (-785.650) (-787.508) (-784.088) [-786.262] -- 0:00:58
      182500 -- (-788.612) [-786.596] (-786.834) (-786.312) * (-789.517) (-787.027) [-785.115] (-788.499) -- 0:00:58
      183000 -- (-790.690) [-784.583] (-783.205) (-786.297) * [-784.757] (-785.359) (-783.643) (-788.326) -- 0:00:58
      183500 -- (-785.443) [-789.429] (-786.719) (-784.282) * (-785.886) (-785.488) [-785.508] (-784.804) -- 0:00:57
      184000 -- (-785.318) (-786.866) (-785.042) [-783.877] * (-786.043) [-787.891] (-784.379) (-784.700) -- 0:00:57
      184500 -- [-784.065] (-786.091) (-783.696) (-784.917) * (-786.041) (-793.390) [-784.635] (-784.161) -- 0:00:57
      185000 -- (-786.955) (-784.381) (-784.118) [-786.541] * (-785.612) (-785.428) [-784.143] (-790.039) -- 0:00:57

      Average standard deviation of split frequencies: 0.019075

      185500 -- (-790.128) (-786.610) [-786.013] (-784.492) * [-786.394] (-794.504) (-786.327) (-787.478) -- 0:01:01
      186000 -- (-785.037) [-785.715] (-783.818) (-784.335) * (-788.803) [-784.889] (-786.502) (-784.480) -- 0:01:01
      186500 -- (-787.065) (-787.573) [-784.157] (-785.567) * [-784.725] (-784.590) (-785.855) (-786.053) -- 0:01:01
      187000 -- [-787.024] (-784.329) (-785.416) (-786.181) * [-785.693] (-785.575) (-784.224) (-786.686) -- 0:01:00
      187500 -- (-786.573) (-784.964) [-786.458] (-786.484) * [-785.874] (-790.557) (-785.754) (-786.080) -- 0:01:00
      188000 -- (-785.025) (-784.254) (-790.365) [-784.467] * [-786.352] (-787.928) (-785.253) (-787.813) -- 0:01:00
      188500 -- (-788.667) (-783.641) [-786.773] (-785.161) * (-785.887) (-784.053) [-784.293] (-786.457) -- 0:01:00
      189000 -- (-787.644) (-783.341) (-785.031) [-784.867] * [-788.306] (-787.024) (-784.147) (-787.687) -- 0:01:00
      189500 -- (-785.293) (-784.128) [-784.811] (-783.370) * (-791.733) (-789.361) [-785.076] (-784.980) -- 0:00:59
      190000 -- (-790.390) [-784.040] (-784.628) (-784.178) * [-786.417] (-793.336) (-784.161) (-787.405) -- 0:00:59

      Average standard deviation of split frequencies: 0.016266

      190500 -- (-785.442) (-785.361) [-784.030] (-783.398) * (-785.869) (-785.672) (-788.551) [-784.462] -- 0:00:59
      191000 -- (-787.961) (-787.865) [-785.078] (-784.971) * (-785.765) [-784.353] (-783.819) (-787.049) -- 0:00:59
      191500 -- (-786.190) (-786.682) (-786.399) [-785.462] * [-785.641] (-783.290) (-783.732) (-789.174) -- 0:00:59
      192000 -- (-784.697) (-785.636) [-785.091] (-785.063) * (-786.456) [-783.870] (-783.568) (-786.056) -- 0:00:58
      192500 -- (-785.295) (-787.216) [-785.509] (-788.201) * (-785.168) (-785.300) [-791.127] (-784.273) -- 0:00:58
      193000 -- (-785.740) (-786.647) [-784.531] (-790.660) * (-784.976) [-786.142] (-790.916) (-789.166) -- 0:00:58
      193500 -- (-784.448) [-787.547] (-791.131) (-787.812) * (-784.434) (-783.245) (-784.624) [-784.567] -- 0:00:58
      194000 -- (-785.300) (-784.701) (-784.626) [-787.317] * [-784.708] (-784.677) (-783.836) (-783.980) -- 0:00:58
      194500 -- (-785.008) (-784.813) [-783.658] (-786.684) * [-784.710] (-783.256) (-786.592) (-788.838) -- 0:00:57
      195000 -- (-786.155) (-784.185) (-785.206) [-787.591] * (-784.711) (-786.118) (-784.141) [-786.994] -- 0:00:57

      Average standard deviation of split frequencies: 0.014431

      195500 -- [-786.420] (-785.042) (-786.041) (-786.796) * [-783.654] (-783.506) (-784.853) (-786.915) -- 0:00:57
      196000 -- (-784.468) (-784.992) (-790.657) [-787.411] * (-787.974) (-783.474) [-785.128] (-785.546) -- 0:00:57
      196500 -- [-785.664] (-788.083) (-786.497) (-785.006) * (-786.025) [-783.222] (-785.936) (-789.258) -- 0:00:57
      197000 -- (-783.508) (-787.872) [-784.991] (-786.430) * (-787.014) (-785.085) (-786.551) [-786.763] -- 0:00:57
      197500 -- (-783.792) (-787.606) [-785.243] (-785.625) * (-787.017) [-785.476] (-786.783) (-785.016) -- 0:00:56
      198000 -- [-784.243] (-784.027) (-784.817) (-789.928) * (-786.028) [-784.546] (-787.903) (-784.235) -- 0:00:56
      198500 -- (-784.985) [-787.785] (-785.856) (-789.386) * [-784.445] (-784.898) (-790.266) (-784.559) -- 0:00:56
      199000 -- [-784.622] (-785.769) (-784.188) (-788.244) * (-786.345) (-785.159) (-785.343) [-783.835] -- 0:00:56
      199500 -- [-784.622] (-787.948) (-787.253) (-787.161) * [-788.389] (-788.233) (-784.301) (-784.407) -- 0:00:56
      200000 -- (-783.557) [-785.039] (-787.211) (-785.843) * [-785.473] (-789.568) (-783.933) (-789.190) -- 0:00:59

      Average standard deviation of split frequencies: 0.015009

      200500 -- [-783.677] (-784.691) (-783.826) (-786.663) * [-783.760] (-786.289) (-784.757) (-789.644) -- 0:00:59
      201000 -- [-784.037] (-785.166) (-785.462) (-785.088) * [-783.633] (-785.102) (-785.054) (-793.866) -- 0:00:59
      201500 -- (-785.750) (-785.238) [-785.518] (-784.063) * [-784.705] (-785.382) (-784.725) (-789.409) -- 0:00:59
      202000 -- [-785.104] (-786.630) (-791.990) (-787.439) * (-784.270) (-784.850) (-784.781) [-786.087] -- 0:00:59
      202500 -- (-787.012) [-787.414] (-786.426) (-786.483) * [-787.323] (-786.448) (-788.354) (-785.555) -- 0:00:59
      203000 -- [-785.181] (-790.461) (-791.102) (-786.282) * (-788.681) [-784.907] (-785.477) (-784.863) -- 0:00:58
      203500 -- [-784.188] (-787.536) (-787.941) (-789.536) * [-786.986] (-783.387) (-787.187) (-785.994) -- 0:00:58
      204000 -- (-785.716) (-788.020) (-784.487) [-791.443] * [-786.787] (-786.538) (-786.177) (-787.402) -- 0:00:58
      204500 -- (-786.112) (-783.770) (-784.841) [-787.094] * (-784.901) (-789.144) (-786.461) [-784.501] -- 0:00:58
      205000 -- (-784.049) (-786.879) (-784.870) [-783.760] * [-787.711] (-784.899) (-785.667) (-784.147) -- 0:00:58

      Average standard deviation of split frequencies: 0.014366

      205500 -- [-786.384] (-785.815) (-788.039) (-786.590) * (-786.750) (-784.814) [-784.056] (-784.448) -- 0:00:57
      206000 -- (-786.196) (-785.016) [-787.011] (-788.815) * (-786.393) (-786.494) (-784.209) [-786.908] -- 0:00:57
      206500 -- [-787.366] (-787.233) (-789.754) (-786.991) * [-787.625] (-785.946) (-786.792) (-785.256) -- 0:00:57
      207000 -- (-788.915) (-786.393) [-786.847] (-785.053) * (-787.156) [-784.515] (-784.669) (-786.377) -- 0:00:57
      207500 -- [-785.367] (-787.257) (-786.464) (-784.580) * [-785.828] (-784.157) (-783.920) (-787.311) -- 0:00:57
      208000 -- (-786.444) [-783.406] (-787.029) (-785.061) * (-788.025) (-784.479) [-784.324] (-784.149) -- 0:00:57
      208500 -- (-786.815) (-785.495) (-785.411) [-784.254] * (-786.299) (-786.607) (-785.674) [-785.505] -- 0:00:56
      209000 -- (-786.671) [-784.060] (-785.094) (-788.213) * (-788.427) (-786.116) [-787.199] (-788.758) -- 0:00:56
      209500 -- (-784.635) (-785.733) (-784.583) [-784.301] * (-788.329) [-783.780] (-785.003) (-788.788) -- 0:00:56
      210000 -- (-787.400) (-784.730) [-786.843] (-793.464) * [-785.372] (-783.552) (-785.370) (-788.687) -- 0:00:56

      Average standard deviation of split frequencies: 0.013550

      210500 -- (-789.908) [-784.023] (-789.441) (-785.298) * (-785.092) [-785.804] (-786.716) (-784.955) -- 0:00:56
      211000 -- (-786.998) [-786.541] (-789.879) (-784.383) * (-784.517) (-786.255) (-784.448) [-783.856] -- 0:00:56
      211500 -- [-783.778] (-788.257) (-786.394) (-784.898) * [-784.367] (-788.125) (-784.675) (-783.455) -- 0:00:55
      212000 -- (-785.017) [-784.002] (-788.059) (-785.979) * (-786.284) [-785.086] (-784.644) (-788.925) -- 0:00:55
      212500 -- [-785.216] (-784.906) (-788.408) (-784.900) * [-786.564] (-787.128) (-785.256) (-784.475) -- 0:00:55
      213000 -- [-784.193] (-790.343) (-789.939) (-783.989) * (-783.909) [-784.663] (-784.390) (-785.046) -- 0:00:55
      213500 -- [-785.915] (-784.763) (-790.727) (-784.465) * (-785.139) [-786.196] (-784.173) (-787.208) -- 0:00:58
      214000 -- (-784.464) [-790.714] (-787.742) (-785.014) * (-784.141) (-787.615) [-786.277] (-787.681) -- 0:00:58
      214500 -- (-786.917) [-785.285] (-783.520) (-784.979) * (-783.929) [-787.021] (-786.069) (-784.312) -- 0:00:58
      215000 -- (-784.968) (-786.265) [-784.714] (-789.339) * [-784.955] (-785.317) (-784.588) (-784.475) -- 0:00:58

      Average standard deviation of split frequencies: 0.013943

      215500 -- (-785.338) (-784.777) (-784.116) [-785.949] * [-783.833] (-787.162) (-784.258) (-784.516) -- 0:00:58
      216000 -- (-786.333) (-786.550) (-784.569) [-785.831] * (-784.817) [-785.548] (-785.366) (-786.328) -- 0:00:58
      216500 -- (-787.020) (-784.331) (-790.621) [-784.836] * (-783.379) [-785.008] (-785.612) (-788.479) -- 0:00:57
      217000 -- (-785.622) (-787.473) [-785.737] (-787.188) * (-784.129) [-784.731] (-784.118) (-787.563) -- 0:00:57
      217500 -- (-784.890) (-786.407) [-786.483] (-785.160) * (-788.565) [-785.216] (-787.838) (-783.782) -- 0:00:57
      218000 -- [-785.253] (-786.965) (-784.883) (-784.902) * [-789.318] (-787.719) (-786.179) (-783.618) -- 0:00:57
      218500 -- (-784.119) [-788.630] (-787.619) (-785.002) * [-791.191] (-785.862) (-787.446) (-787.462) -- 0:00:57
      219000 -- (-785.429) (-787.867) (-783.911) [-783.756] * (-783.280) (-786.391) (-787.136) [-788.657] -- 0:00:57
      219500 -- (-787.849) (-784.620) (-786.049) [-784.509] * (-784.071) (-787.715) (-786.396) [-785.108] -- 0:00:56
      220000 -- [-785.655] (-784.350) (-785.800) (-785.183) * [-785.519] (-785.644) (-786.864) (-783.944) -- 0:00:56

      Average standard deviation of split frequencies: 0.014326

      220500 -- (-785.594) (-783.787) [-784.503] (-787.490) * (-786.078) (-786.722) (-789.793) [-785.316] -- 0:00:56
      221000 -- (-785.999) (-785.808) (-783.605) [-784.248] * [-788.584] (-786.860) (-790.267) (-794.490) -- 0:00:56
      221500 -- (-786.334) (-784.903) (-786.430) [-786.009] * (-789.641) (-785.298) (-789.930) [-789.920] -- 0:00:56
      222000 -- (-785.733) (-787.168) [-784.335] (-784.763) * (-787.105) (-787.097) (-787.127) [-787.018] -- 0:00:56
      222500 -- [-788.754] (-788.461) (-785.955) (-784.345) * (-785.314) (-788.356) [-784.999] (-787.847) -- 0:00:55
      223000 -- [-785.334] (-786.388) (-783.885) (-784.985) * [-784.372] (-786.776) (-783.907) (-788.223) -- 0:00:55
      223500 -- [-783.562] (-788.026) (-784.192) (-792.649) * [-784.853] (-786.798) (-783.819) (-785.108) -- 0:00:55
      224000 -- [-784.709] (-786.966) (-784.247) (-786.608) * (-784.483) (-786.773) (-784.768) [-784.832] -- 0:00:55
      224500 -- [-784.833] (-786.285) (-785.008) (-785.009) * (-785.317) (-786.420) [-784.954] (-786.225) -- 0:00:55
      225000 -- [-784.842] (-791.650) (-783.566) (-786.738) * [-785.461] (-787.025) (-784.567) (-785.709) -- 0:00:55

      Average standard deviation of split frequencies: 0.013095

      225500 -- (-786.570) (-786.763) [-783.659] (-785.646) * [-784.203] (-786.862) (-785.224) (-788.237) -- 0:00:54
      226000 -- (-789.777) [-787.688] (-784.830) (-783.930) * (-786.758) (-785.728) (-788.964) [-790.178] -- 0:00:54
      226500 -- (-784.198) (-788.798) (-785.208) [-784.609] * [-785.601] (-784.754) (-787.679) (-786.423) -- 0:00:54
      227000 -- (-785.358) (-786.911) (-790.298) [-788.484] * [-785.098] (-784.136) (-783.634) (-785.371) -- 0:00:54
      227500 -- (-786.125) [-784.995] (-784.234) (-785.106) * (-790.063) [-786.468] (-783.718) (-789.023) -- 0:00:57
      228000 -- (-785.263) (-786.534) (-784.233) [-786.994] * (-786.022) (-785.165) [-785.051] (-787.088) -- 0:00:57
      228500 -- (-783.870) (-786.728) (-784.233) [-787.238] * (-784.781) (-786.974) [-783.529] (-789.596) -- 0:00:57
      229000 -- (-788.442) [-790.641] (-784.821) (-783.749) * (-785.720) [-785.009] (-783.938) (-787.986) -- 0:00:57
      229500 -- [-787.227] (-787.445) (-784.703) (-784.196) * (-786.031) [-785.779] (-787.691) (-784.774) -- 0:00:57
      230000 -- (-790.632) (-788.356) [-783.806] (-786.062) * [-783.688] (-783.674) (-786.767) (-787.711) -- 0:00:56

      Average standard deviation of split frequencies: 0.012743

      230500 -- (-789.114) [-786.964] (-783.684) (-784.893) * (-783.745) (-784.913) [-786.892] (-789.604) -- 0:00:56
      231000 -- (-788.086) (-786.053) [-787.173] (-790.483) * [-784.127] (-785.083) (-789.391) (-792.376) -- 0:00:56
      231500 -- [-785.723] (-786.319) (-786.939) (-784.615) * (-784.158) (-786.497) [-786.214] (-784.891) -- 0:00:56
      232000 -- [-786.773] (-790.583) (-786.129) (-785.713) * (-785.225) (-785.467) (-784.734) [-785.908] -- 0:00:56
      232500 -- [-784.486] (-787.251) (-786.786) (-783.548) * (-783.987) (-784.024) [-785.622] (-788.056) -- 0:00:56
      233000 -- (-784.361) [-785.421] (-784.607) (-784.195) * (-787.560) (-784.001) [-787.208] (-787.783) -- 0:00:55
      233500 -- [-783.801] (-785.306) (-788.423) (-788.184) * (-786.798) [-786.049] (-786.423) (-788.591) -- 0:00:55
      234000 -- [-786.726] (-785.867) (-786.768) (-791.941) * (-786.942) (-789.240) [-786.678] (-787.580) -- 0:00:55
      234500 -- (-786.469) (-783.532) (-790.847) [-785.860] * (-789.867) (-786.988) (-785.181) [-785.111] -- 0:00:55
      235000 -- (-784.244) (-784.670) (-787.676) [-787.723] * (-785.291) [-784.656] (-784.580) (-785.627) -- 0:00:55

      Average standard deviation of split frequencies: 0.011652

      235500 -- (-785.530) [-784.289] (-791.579) (-785.518) * (-790.055) (-786.465) [-783.946] (-784.564) -- 0:00:55
      236000 -- (-785.553) [-787.542] (-786.062) (-788.953) * (-785.625) (-786.457) [-785.170] (-785.296) -- 0:00:55
      236500 -- (-786.002) [-789.724] (-785.044) (-788.014) * (-787.213) (-785.915) (-784.539) [-784.310] -- 0:00:54
      237000 -- (-784.779) [-784.817] (-784.202) (-786.538) * [-784.719] (-788.675) (-784.663) (-784.156) -- 0:00:54
      237500 -- (-787.722) (-786.850) [-784.055] (-784.236) * (-787.218) [-783.375] (-784.176) (-783.561) -- 0:00:54
      238000 -- (-791.169) [-784.740] (-785.271) (-785.043) * (-786.020) [-784.957] (-786.345) (-785.653) -- 0:00:54
      238500 -- (-787.465) (-784.013) [-786.251] (-784.663) * [-784.059] (-784.159) (-786.095) (-783.854) -- 0:00:54
      239000 -- (-787.274) [-785.517] (-784.269) (-785.398) * (-788.315) [-784.003] (-785.509) (-785.356) -- 0:00:54
      239500 -- (-789.392) (-786.838) (-783.705) [-786.890] * (-785.853) (-784.412) (-785.860) [-785.588] -- 0:00:53
      240000 -- [-787.450] (-790.803) (-784.437) (-786.324) * (-784.352) (-784.209) (-786.614) [-786.201] -- 0:00:53

      Average standard deviation of split frequencies: 0.011861

      240500 -- (-785.312) [-783.950] (-783.556) (-787.394) * (-784.647) (-783.820) (-786.277) [-785.732] -- 0:00:53
      241000 -- (-788.084) (-784.871) [-785.013] (-784.944) * (-784.545) [-784.330] (-785.673) (-786.378) -- 0:00:53
      241500 -- (-790.561) [-784.487] (-786.163) (-784.179) * (-784.630) (-785.439) [-787.408] (-784.707) -- 0:00:53
      242000 -- (-788.046) (-784.527) (-784.746) [-784.323] * (-787.525) (-788.694) (-788.244) [-788.443] -- 0:00:53
      242500 -- (-789.564) (-785.054) (-789.500) [-784.921] * (-786.127) (-786.143) [-786.688] (-786.330) -- 0:00:53
      243000 -- (-786.321) [-784.829] (-785.884) (-785.320) * (-787.523) [-786.706] (-786.346) (-787.342) -- 0:00:56
      243500 -- (-787.877) [-785.135] (-785.644) (-784.429) * [-787.949] (-786.978) (-788.240) (-785.694) -- 0:00:55
      244000 -- (-784.182) (-784.429) (-784.083) [-785.372] * (-791.165) (-787.783) [-783.485] (-784.117) -- 0:00:55
      244500 -- (-785.421) (-788.269) [-785.372] (-785.282) * (-785.627) (-792.719) (-786.400) [-786.974] -- 0:00:55
      245000 -- (-786.515) (-785.971) (-784.783) [-784.553] * (-787.678) (-787.680) (-787.201) [-787.931] -- 0:00:55

      Average standard deviation of split frequencies: 0.012103

      245500 -- (-784.657) [-784.856] (-784.422) (-784.163) * (-785.109) (-788.423) [-792.173] (-785.909) -- 0:00:55
      246000 -- [-789.368] (-787.249) (-786.249) (-786.266) * [-784.154] (-786.792) (-788.849) (-785.643) -- 0:00:55
      246500 -- (-787.488) (-783.659) [-786.890] (-788.325) * (-785.127) (-784.260) [-783.950] (-784.053) -- 0:00:55
      247000 -- (-784.447) (-784.938) [-784.823] (-784.113) * (-785.158) (-785.512) [-784.267] (-787.848) -- 0:00:54
      247500 -- (-784.294) (-786.537) (-788.085) [-783.641] * (-786.006) (-798.649) [-785.191] (-786.903) -- 0:00:54
      248000 -- [-783.937] (-784.624) (-787.445) (-784.810) * (-785.726) (-792.737) [-784.312] (-789.069) -- 0:00:54
      248500 -- [-784.498] (-785.259) (-788.622) (-786.132) * [-784.177] (-783.547) (-786.195) (-784.227) -- 0:00:54
      249000 -- [-784.957] (-784.773) (-787.745) (-787.962) * (-783.766) (-783.414) (-785.877) [-783.849] -- 0:00:54
      249500 -- (-786.630) (-783.783) (-787.221) [-785.414] * (-784.525) [-783.560] (-786.229) (-783.748) -- 0:00:54
      250000 -- (-786.885) [-784.672] (-783.434) (-783.686) * (-786.814) (-784.199) [-785.929] (-785.866) -- 0:00:54

      Average standard deviation of split frequencies: 0.012867

      250500 -- (-788.880) (-785.173) [-784.196] (-785.437) * (-786.944) [-783.534] (-785.645) (-784.780) -- 0:00:53
      251000 -- (-784.927) [-786.224] (-795.991) (-787.353) * (-786.763) [-784.096] (-787.169) (-784.075) -- 0:00:53
      251500 -- (-784.123) (-790.198) (-790.482) [-784.530] * (-785.058) [-784.892] (-788.307) (-783.997) -- 0:00:53
      252000 -- (-785.486) [-786.434] (-784.013) (-783.881) * (-784.569) (-783.272) (-784.912) [-784.100] -- 0:00:53
      252500 -- (-789.178) [-784.334] (-785.831) (-784.097) * [-784.313] (-784.285) (-785.309) (-785.663) -- 0:00:53
      253000 -- (-788.991) (-784.732) (-784.974) [-784.673] * (-784.994) (-785.640) [-784.789] (-785.472) -- 0:00:53
      253500 -- (-784.411) (-790.594) [-784.548] (-786.035) * (-785.257) (-788.203) (-784.840) [-783.836] -- 0:00:53
      254000 -- (-784.091) [-784.639] (-785.394) (-784.845) * (-783.918) [-789.140] (-785.589) (-785.005) -- 0:00:52
      254500 -- (-784.466) (-783.455) (-786.346) [-784.287] * (-785.820) [-784.761] (-786.085) (-784.043) -- 0:00:52
      255000 -- [-787.035] (-783.625) (-784.767) (-784.353) * (-784.539) [-786.505] (-784.334) (-786.026) -- 0:00:52

      Average standard deviation of split frequencies: 0.012072

      255500 -- (-786.166) (-783.615) [-786.673] (-784.504) * (-785.167) (-791.215) [-785.362] (-786.539) -- 0:00:52
      256000 -- (-786.454) [-784.319] (-787.835) (-784.826) * (-785.605) (-785.490) [-786.346] (-795.844) -- 0:00:52
      256500 -- [-787.320] (-785.830) (-789.474) (-785.220) * (-784.221) (-785.895) (-784.290) [-785.179] -- 0:00:52
      257000 -- (-786.559) (-784.379) (-790.428) [-784.895] * (-785.042) (-785.715) (-785.880) [-787.114] -- 0:00:52
      257500 -- [-788.896] (-784.380) (-784.675) (-791.000) * (-784.206) [-786.956] (-787.281) (-784.888) -- 0:00:54
      258000 -- (-788.154) [-784.971] (-784.021) (-784.745) * (-789.039) (-786.276) [-785.668] (-785.937) -- 0:00:54
      258500 -- (-786.399) [-785.315] (-787.660) (-784.801) * (-783.728) (-787.008) [-784.968] (-786.244) -- 0:00:54
      259000 -- [-783.477] (-785.876) (-793.561) (-784.635) * [-784.631] (-784.850) (-785.259) (-785.284) -- 0:00:54
      259500 -- (-783.938) (-784.388) [-787.887] (-785.972) * [-784.631] (-787.338) (-785.093) (-788.927) -- 0:00:54
      260000 -- (-783.644) (-789.594) [-788.641] (-783.870) * (-783.654) (-786.982) [-786.800] (-785.356) -- 0:00:54

      Average standard deviation of split frequencies: 0.011353

      260500 -- (-786.988) (-787.238) [-785.125] (-784.477) * [-783.485] (-788.371) (-789.230) (-784.513) -- 0:00:53
      261000 -- (-784.854) [-786.549] (-783.757) (-784.331) * (-787.323) (-790.837) (-785.601) [-785.247] -- 0:00:53
      261500 -- (-783.507) (-789.366) [-783.886] (-783.844) * (-785.145) (-789.274) [-785.371] (-785.023) -- 0:00:53
      262000 -- [-785.045] (-784.837) (-785.675) (-786.506) * (-785.602) (-787.375) [-783.886] (-787.612) -- 0:00:53
      262500 -- [-784.279] (-786.541) (-785.871) (-784.867) * [-787.566] (-786.858) (-787.226) (-792.062) -- 0:00:53
      263000 -- (-785.828) (-785.305) (-786.245) [-787.948] * (-790.922) (-785.932) [-787.808] (-784.639) -- 0:00:53
      263500 -- (-787.789) (-786.547) [-786.105] (-787.891) * (-785.724) (-785.451) [-786.992] (-784.390) -- 0:00:53
      264000 -- (-789.098) (-785.111) (-789.449) [-785.120] * [-785.562] (-786.482) (-789.865) (-785.371) -- 0:00:52
      264500 -- (-785.272) [-783.373] (-784.438) (-787.391) * (-785.742) (-787.943) [-784.126] (-785.054) -- 0:00:52
      265000 -- (-785.140) (-786.277) (-786.886) [-785.566] * (-785.981) (-788.107) (-786.758) [-786.237] -- 0:00:52

      Average standard deviation of split frequencies: 0.011379

      265500 -- [-784.391] (-787.737) (-787.584) (-788.706) * (-785.568) (-788.645) [-785.505] (-784.031) -- 0:00:52
      266000 -- (-784.027) [-786.606] (-784.200) (-784.893) * [-785.926] (-788.543) (-783.493) (-785.271) -- 0:00:52
      266500 -- (-784.553) (-787.932) (-785.227) [-786.642] * (-784.835) (-788.608) [-789.162] (-785.394) -- 0:00:52
      267000 -- (-787.135) (-785.284) [-784.592] (-787.051) * (-785.174) (-788.032) (-788.205) [-785.536] -- 0:00:52
      267500 -- (-786.970) (-784.738) [-785.999] (-787.071) * (-783.784) (-786.048) [-785.650] (-786.511) -- 0:00:52
      268000 -- (-786.935) [-786.658] (-786.922) (-787.641) * [-783.586] (-783.942) (-785.628) (-784.738) -- 0:00:51
      268500 -- (-787.847) [-786.709] (-786.213) (-786.543) * [-787.432] (-784.069) (-787.176) (-785.472) -- 0:00:51
      269000 -- (-785.848) (-788.376) [-786.093] (-783.777) * (-783.522) (-785.290) (-787.020) [-784.247] -- 0:00:51
      269500 -- (-783.588) [-788.315] (-784.587) (-786.708) * [-788.110] (-786.098) (-786.466) (-784.412) -- 0:00:51
      270000 -- (-783.555) (-784.108) (-783.460) [-785.231] * (-787.507) [-787.337] (-786.380) (-786.813) -- 0:00:51

      Average standard deviation of split frequencies: 0.010740

      270500 -- [-784.060] (-785.303) (-783.805) (-786.920) * (-786.532) [-784.167] (-786.205) (-787.895) -- 0:00:51
      271000 -- (-783.870) (-785.960) [-784.877] (-784.484) * (-784.197) [-784.123] (-786.352) (-784.623) -- 0:00:51
      271500 -- (-787.745) (-784.955) (-786.303) [-784.797] * (-785.968) (-787.366) [-784.930] (-783.987) -- 0:00:50
      272000 -- (-785.672) (-788.572) [-784.225] (-784.304) * (-790.760) (-787.745) (-784.826) [-785.521] -- 0:00:53
      272500 -- (-791.746) (-788.488) [-785.612] (-786.508) * (-790.906) (-784.164) (-785.131) [-785.509] -- 0:00:53
      273000 -- (-794.089) [-783.954] (-786.534) (-784.779) * (-787.980) [-784.511] (-785.154) (-783.596) -- 0:00:53
      273500 -- [-785.516] (-785.895) (-785.124) (-786.087) * (-785.851) (-784.666) [-788.035] (-783.618) -- 0:00:53
      274000 -- (-787.926) [-785.426] (-783.477) (-786.192) * (-783.919) [-785.346] (-785.310) (-785.722) -- 0:00:52
      274500 -- [-787.559] (-785.087) (-784.157) (-784.336) * (-785.795) (-787.060) (-785.376) [-784.843] -- 0:00:52
      275000 -- (-792.624) (-785.115) [-788.474] (-785.454) * (-784.747) (-786.880) (-783.805) [-784.635] -- 0:00:52

      Average standard deviation of split frequencies: 0.011766

      275500 -- (-787.279) (-789.457) (-784.138) [-784.526] * (-784.216) (-785.106) [-788.671] (-786.836) -- 0:00:52
      276000 -- (-786.912) (-784.353) [-784.481] (-786.033) * (-784.620) (-785.397) [-784.901] (-786.138) -- 0:00:52
      276500 -- (-787.117) [-785.419] (-785.935) (-784.884) * (-784.391) (-790.440) [-786.336] (-787.356) -- 0:00:52
      277000 -- [-785.492] (-783.992) (-784.618) (-786.958) * [-784.341] (-787.278) (-790.299) (-785.659) -- 0:00:52
      277500 -- (-786.892) (-784.601) [-785.088] (-785.023) * [-785.267] (-787.963) (-785.943) (-785.254) -- 0:00:52
      278000 -- (-784.040) (-786.214) (-784.060) [-783.546] * (-788.409) [-785.825] (-786.166) (-786.940) -- 0:00:51
      278500 -- (-786.952) (-786.739) [-784.536] (-783.923) * (-789.111) (-784.198) [-784.619] (-787.432) -- 0:00:51
      279000 -- (-784.792) (-786.455) [-784.256] (-787.317) * (-789.839) (-786.904) (-785.305) [-785.958] -- 0:00:51
      279500 -- (-784.606) (-791.207) (-784.883) [-783.353] * (-787.526) [-787.458] (-784.520) (-784.153) -- 0:00:51
      280000 -- (-785.411) [-786.427] (-787.392) (-785.511) * (-787.871) [-783.535] (-784.495) (-785.754) -- 0:00:51

      Average standard deviation of split frequencies: 0.010824

      280500 -- (-786.781) (-787.193) (-785.612) [-785.161] * (-785.790) (-783.949) (-788.266) [-785.138] -- 0:00:51
      281000 -- [-784.007] (-787.618) (-787.902) (-784.764) * [-786.276] (-784.428) (-783.922) (-786.814) -- 0:00:51
      281500 -- (-788.898) (-786.877) [-785.626] (-785.068) * [-785.173] (-783.726) (-788.551) (-788.984) -- 0:00:51
      282000 -- [-790.631] (-784.794) (-784.790) (-784.020) * [-785.065] (-785.148) (-786.662) (-784.462) -- 0:00:50
      282500 -- [-785.604] (-783.528) (-784.876) (-783.686) * (-784.480) [-783.674] (-784.517) (-785.087) -- 0:00:50
      283000 -- (-785.900) (-784.122) (-786.655) [-784.453] * (-783.730) [-784.079] (-784.373) (-784.281) -- 0:00:50
      283500 -- (-789.404) (-783.985) (-783.628) [-783.913] * (-783.949) (-784.530) [-786.420] (-785.516) -- 0:00:50
      284000 -- (-787.540) (-783.532) [-785.493] (-785.666) * (-786.396) [-787.325] (-787.376) (-785.385) -- 0:00:50
      284500 -- (-784.007) (-787.392) (-785.206) [-785.517] * [-786.313] (-789.978) (-784.234) (-784.696) -- 0:00:50
      285000 -- (-783.528) (-785.521) (-784.154) [-785.507] * (-783.812) [-784.382] (-786.500) (-785.777) -- 0:00:50

      Average standard deviation of split frequencies: 0.011829

      285500 -- [-785.502] (-785.575) (-784.125) (-788.809) * (-787.514) (-785.427) [-784.660] (-785.137) -- 0:00:50
      286000 -- (-785.370) (-785.039) [-785.348] (-787.088) * (-789.930) (-784.559) (-789.021) [-787.700] -- 0:00:49
      286500 -- [-787.566] (-784.759) (-785.141) (-784.592) * (-786.937) [-785.369] (-785.006) (-794.464) -- 0:00:49
      287000 -- (-784.800) (-785.038) (-787.198) [-784.025] * [-786.287] (-785.500) (-784.742) (-786.866) -- 0:00:52
      287500 -- [-783.587] (-785.944) (-787.765) (-786.121) * [-786.806] (-788.573) (-783.253) (-784.745) -- 0:00:52
      288000 -- [-784.279] (-784.398) (-787.758) (-786.120) * [-785.151] (-786.388) (-786.433) (-787.340) -- 0:00:51
      288500 -- (-784.007) (-783.680) (-789.454) [-788.126] * (-785.001) (-786.476) [-785.439] (-788.973) -- 0:00:51
      289000 -- [-784.531] (-786.127) (-785.138) (-787.288) * (-784.101) [-786.529] (-786.463) (-785.065) -- 0:00:51
      289500 -- (-785.523) (-788.394) (-783.891) [-789.032] * (-785.354) (-785.304) [-785.395] (-786.800) -- 0:00:51
      290000 -- [-784.204] (-787.630) (-784.501) (-783.612) * [-785.373] (-785.644) (-786.298) (-787.550) -- 0:00:51

      Average standard deviation of split frequencies: 0.012593

      290500 -- (-789.110) (-785.352) [-785.434] (-785.954) * (-787.857) [-788.626] (-788.325) (-785.860) -- 0:00:51
      291000 -- (-789.073) [-784.174] (-783.937) (-784.290) * [-785.328] (-785.930) (-789.872) (-784.239) -- 0:00:51
      291500 -- [-789.700] (-785.876) (-784.398) (-784.834) * (-785.028) (-785.325) (-791.189) [-784.909] -- 0:00:51
      292000 -- (-786.376) (-785.166) (-785.189) [-786.486] * [-783.828] (-785.188) (-786.811) (-784.647) -- 0:00:50
      292500 -- (-784.848) (-786.238) (-785.257) [-785.089] * (-786.779) (-784.877) [-786.171] (-786.516) -- 0:00:50
      293000 -- (-787.671) (-783.485) [-786.079] (-789.595) * (-786.084) (-784.756) [-787.227] (-787.523) -- 0:00:50
      293500 -- (-784.078) (-792.372) [-784.671] (-789.900) * [-786.631] (-785.968) (-792.625) (-787.214) -- 0:00:50
      294000 -- (-784.342) [-785.633] (-786.297) (-787.524) * (-785.831) (-785.559) (-787.170) [-785.035] -- 0:00:50
      294500 -- (-787.242) (-786.454) (-787.756) [-789.585] * (-789.902) (-784.959) (-789.084) [-783.975] -- 0:00:50
      295000 -- (-786.197) (-784.457) [-785.811] (-788.766) * (-787.770) (-786.146) [-785.654] (-785.079) -- 0:00:50

      Average standard deviation of split frequencies: 0.012179

      295500 -- (-785.330) (-783.587) [-787.411] (-788.326) * (-784.964) [-790.073] (-785.025) (-786.121) -- 0:00:50
      296000 -- (-784.696) [-785.125] (-786.968) (-787.071) * (-783.391) [-783.762] (-785.386) (-785.349) -- 0:00:49
      296500 -- (-786.437) (-785.748) (-785.437) [-784.127] * [-784.524] (-787.459) (-791.943) (-785.004) -- 0:00:49
      297000 -- (-785.739) [-784.080] (-786.365) (-793.778) * [-784.110] (-786.253) (-783.716) (-784.145) -- 0:00:49
      297500 -- [-784.099] (-787.099) (-787.110) (-787.014) * [-784.885] (-790.143) (-787.008) (-790.121) -- 0:00:49
      298000 -- (-786.549) [-785.291] (-793.358) (-783.872) * [-787.724] (-784.854) (-784.388) (-786.768) -- 0:00:49
      298500 -- (-785.871) (-785.736) [-785.053] (-784.935) * (-787.444) (-783.711) (-783.748) [-784.645] -- 0:00:49
      299000 -- (-785.182) (-785.838) [-785.228] (-785.822) * (-787.762) (-786.719) (-788.551) [-784.621] -- 0:00:49
      299500 -- (-786.193) (-786.690) [-785.305] (-786.214) * (-787.631) (-784.448) [-785.763] (-785.163) -- 0:00:49
      300000 -- (-784.407) (-786.402) (-785.085) [-787.085] * (-786.417) [-784.109] (-784.924) (-784.937) -- 0:00:48

      Average standard deviation of split frequencies: 0.012194

      300500 -- (-784.870) (-787.522) (-787.207) [-785.654] * (-786.224) (-788.349) (-783.389) [-786.370] -- 0:00:48
      301000 -- (-788.924) (-790.338) (-786.666) [-786.980] * (-785.867) (-785.196) (-783.900) [-788.019] -- 0:00:48
      301500 -- (-789.143) [-788.163] (-785.553) (-785.038) * [-785.116] (-785.695) (-785.080) (-786.235) -- 0:00:50
      302000 -- (-786.965) [-789.072] (-787.083) (-785.718) * (-790.190) (-785.855) (-786.193) [-783.853] -- 0:00:50
      302500 -- (-785.029) (-786.043) (-784.656) [-786.714] * (-788.845) [-784.212] (-784.752) (-786.161) -- 0:00:50
      303000 -- [-785.118] (-787.968) (-784.545) (-786.923) * (-784.619) (-783.569) [-785.232] (-785.536) -- 0:00:50
      303500 -- (-783.859) (-784.563) (-784.086) [-790.521] * (-785.541) (-784.537) (-784.320) [-785.837] -- 0:00:50
      304000 -- [-786.820] (-789.714) (-786.134) (-786.146) * (-785.661) [-785.792] (-786.350) (-785.453) -- 0:00:50
      304500 -- (-786.454) (-786.935) [-786.876] (-787.778) * (-784.220) (-786.198) [-785.678] (-785.085) -- 0:00:50
      305000 -- (-787.346) [-784.072] (-786.161) (-784.769) * (-785.126) (-786.638) (-787.118) [-785.920] -- 0:00:50

      Average standard deviation of split frequencies: 0.012892

      305500 -- [-785.595] (-785.816) (-789.222) (-790.031) * [-788.417] (-783.568) (-785.370) (-785.927) -- 0:00:50
      306000 -- (-791.033) (-784.211) (-786.591) [-784.679] * (-786.643) (-785.912) [-785.972] (-789.370) -- 0:00:49
      306500 -- [-787.381] (-787.312) (-786.328) (-787.582) * (-784.766) (-785.211) (-787.693) [-785.529] -- 0:00:49
      307000 -- (-785.227) [-786.251] (-786.293) (-785.801) * (-785.170) (-785.941) [-786.013] (-786.838) -- 0:00:49
      307500 -- (-785.873) (-784.800) (-788.622) [-785.678] * (-786.534) [-784.860] (-784.394) (-784.631) -- 0:00:49
      308000 -- [-784.859] (-787.659) (-785.353) (-784.852) * (-787.350) [-785.689] (-785.645) (-787.457) -- 0:00:49
      308500 -- (-784.493) [-784.142] (-789.738) (-786.833) * (-784.137) (-785.129) (-787.450) [-785.697] -- 0:00:49
      309000 -- [-784.924] (-785.861) (-786.970) (-789.762) * [-784.600] (-785.027) (-785.105) (-787.220) -- 0:00:49
      309500 -- (-785.530) (-783.913) [-784.725] (-787.271) * (-784.605) (-785.821) (-788.881) [-786.652] -- 0:00:49
      310000 -- (-786.070) [-787.622] (-788.109) (-788.607) * (-787.504) (-784.671) [-784.037] (-786.262) -- 0:00:48

      Average standard deviation of split frequencies: 0.013657

      310500 -- [-791.149] (-787.972) (-786.562) (-787.104) * [-787.140] (-784.039) (-788.388) (-788.244) -- 0:00:48
      311000 -- (-786.451) (-789.991) [-785.149] (-784.662) * (-787.059) [-786.038] (-783.854) (-788.408) -- 0:00:48
      311500 -- (-785.803) [-784.728] (-786.266) (-786.975) * (-788.403) (-790.884) [-784.088] (-787.837) -- 0:00:48
      312000 -- (-786.194) (-784.065) (-785.460) [-785.646] * (-784.805) (-786.017) [-785.039] (-787.531) -- 0:00:48
      312500 -- (-785.189) (-784.101) [-787.586] (-784.516) * [-784.028] (-786.373) (-784.804) (-786.775) -- 0:00:48
      313000 -- (-787.944) (-786.751) [-786.787] (-785.009) * (-786.019) [-786.636] (-786.001) (-786.403) -- 0:00:48
      313500 -- [-789.372] (-787.820) (-787.191) (-786.565) * (-788.286) (-785.949) [-787.110] (-786.836) -- 0:00:48
      314000 -- (-784.965) (-786.738) [-785.330] (-784.041) * [-788.561] (-785.806) (-785.847) (-791.087) -- 0:00:48
      314500 -- (-783.677) (-785.725) (-787.013) [-785.675] * (-787.257) [-785.914] (-784.589) (-783.845) -- 0:00:47
      315000 -- (-786.031) [-785.423] (-785.178) (-785.875) * (-788.828) [-784.099] (-784.528) (-784.349) -- 0:00:47

      Average standard deviation of split frequencies: 0.012987

      315500 -- [-786.091] (-785.071) (-784.378) (-785.322) * (-784.543) [-785.759] (-785.193) (-787.926) -- 0:00:47
      316000 -- [-786.031] (-788.659) (-784.927) (-783.672) * (-787.585) (-785.499) (-784.002) [-788.104] -- 0:00:47
      316500 -- (-787.334) (-784.839) [-784.580] (-788.643) * (-783.467) [-785.766] (-785.779) (-786.808) -- 0:00:49
      317000 -- (-785.157) [-783.821] (-784.051) (-783.649) * [-783.352] (-786.903) (-787.922) (-785.265) -- 0:00:49
      317500 -- (-785.353) (-786.218) [-786.419] (-788.341) * (-783.755) [-785.035] (-786.750) (-787.868) -- 0:00:49
      318000 -- (-786.331) [-786.018] (-788.638) (-789.571) * (-783.464) [-789.533] (-786.949) (-783.576) -- 0:00:49
      318500 -- (-785.180) (-785.233) [-787.971] (-792.203) * [-785.473] (-785.361) (-787.890) (-783.959) -- 0:00:49
      319000 -- (-784.975) [-785.444] (-787.388) (-787.319) * (-787.110) (-786.650) (-785.559) [-786.162] -- 0:00:49
      319500 -- (-783.356) (-785.909) (-785.992) [-786.154] * [-783.911] (-787.720) (-789.001) (-785.159) -- 0:00:48
      320000 -- [-785.864] (-784.220) (-785.913) (-786.282) * [-785.013] (-784.881) (-784.366) (-784.695) -- 0:00:48

      Average standard deviation of split frequencies: 0.013802

      320500 -- [-784.169] (-784.328) (-785.821) (-784.595) * [-784.292] (-784.348) (-783.643) (-784.435) -- 0:00:48
      321000 -- (-786.675) [-785.947] (-784.878) (-786.374) * [-785.911] (-785.804) (-784.852) (-792.921) -- 0:00:48
      321500 -- (-786.520) (-783.700) (-787.928) [-785.526] * [-785.751] (-785.732) (-786.042) (-788.054) -- 0:00:48
      322000 -- (-787.608) (-786.656) [-784.828] (-785.991) * (-785.608) [-784.784] (-786.176) (-789.041) -- 0:00:48
      322500 -- (-785.441) [-787.006] (-783.474) (-788.746) * (-785.122) (-787.954) [-786.015] (-786.466) -- 0:00:48
      323000 -- (-785.513) (-785.203) (-786.331) [-786.038] * (-785.295) (-788.988) [-786.341] (-785.782) -- 0:00:48
      323500 -- (-786.728) (-785.723) (-788.060) [-785.060] * [-783.788] (-785.468) (-785.576) (-787.810) -- 0:00:48
      324000 -- (-784.748) (-784.732) [-789.935] (-786.081) * [-786.350] (-785.145) (-784.190) (-786.090) -- 0:00:47
      324500 -- [-783.364] (-784.963) (-788.134) (-786.004) * [-788.825] (-784.901) (-786.281) (-784.399) -- 0:00:47
      325000 -- (-783.887) (-787.174) [-786.148] (-788.268) * [-787.541] (-784.059) (-783.861) (-790.050) -- 0:00:47

      Average standard deviation of split frequencies: 0.014460

      325500 -- [-784.486] (-786.807) (-783.919) (-788.019) * (-785.969) (-785.198) [-785.371] (-787.805) -- 0:00:47
      326000 -- [-783.460] (-788.565) (-785.183) (-786.956) * [-785.691] (-784.110) (-784.375) (-789.773) -- 0:00:47
      326500 -- (-789.355) [-786.901] (-784.027) (-787.125) * (-786.586) [-784.089] (-785.378) (-785.705) -- 0:00:47
      327000 -- (-785.016) [-787.577] (-784.552) (-783.962) * (-789.346) (-785.615) [-784.570] (-789.749) -- 0:00:47
      327500 -- [-784.078] (-786.180) (-784.252) (-784.241) * (-784.531) (-784.673) [-784.380] (-787.686) -- 0:00:47
      328000 -- [-785.206] (-785.963) (-784.783) (-786.587) * [-786.314] (-787.279) (-785.037) (-787.774) -- 0:00:47
      328500 -- (-786.150) [-789.847] (-787.219) (-785.094) * (-789.622) (-786.873) (-786.019) [-787.285] -- 0:00:47
      329000 -- [-784.936] (-789.544) (-788.490) (-784.670) * (-787.125) (-787.027) (-785.869) [-786.542] -- 0:00:46
      329500 -- [-785.579] (-789.944) (-784.735) (-788.414) * (-787.034) [-786.298] (-787.835) (-785.255) -- 0:00:46
      330000 -- (-783.559) (-789.212) (-786.518) [-784.091] * (-786.479) [-784.945] (-790.349) (-784.059) -- 0:00:46

      Average standard deviation of split frequencies: 0.014177

      330500 -- (-786.936) (-785.344) (-785.772) [-785.389] * (-786.584) (-787.201) [-785.283] (-785.692) -- 0:00:46
      331000 -- (-784.337) (-787.077) (-785.578) [-784.879] * (-787.024) (-787.682) [-788.237] (-784.023) -- 0:00:46
      331500 -- (-786.446) (-787.461) [-787.187] (-786.897) * (-783.954) [-785.378] (-785.093) (-784.089) -- 0:00:48
      332000 -- (-785.374) [-785.805] (-786.156) (-785.294) * (-785.450) (-789.438) [-791.234] (-788.505) -- 0:00:48
      332500 -- [-786.129] (-786.653) (-784.561) (-786.060) * (-784.331) (-788.107) (-798.737) [-789.755] -- 0:00:48
      333000 -- [-785.215] (-785.448) (-785.988) (-783.498) * (-787.858) (-786.730) [-785.430] (-787.099) -- 0:00:48
      333500 -- [-785.879] (-785.775) (-784.336) (-783.419) * (-787.530) (-783.734) [-785.486] (-785.751) -- 0:00:47
      334000 -- (-785.697) [-786.135] (-784.007) (-786.472) * (-790.651) (-784.997) (-785.584) [-785.898] -- 0:00:47
      334500 -- (-789.149) (-784.176) (-788.177) [-783.256] * (-787.307) (-784.349) [-783.970] (-784.156) -- 0:00:47
      335000 -- (-784.030) [-784.121] (-784.686) (-785.091) * (-785.712) [-786.171] (-784.884) (-784.549) -- 0:00:47

      Average standard deviation of split frequencies: 0.013173

      335500 -- [-784.653] (-787.362) (-784.826) (-785.091) * (-785.711) [-786.083] (-784.404) (-787.666) -- 0:00:47
      336000 -- (-785.173) [-787.311] (-789.097) (-784.975) * (-784.710) (-788.232) [-785.210] (-785.820) -- 0:00:47
      336500 -- (-784.491) [-785.103] (-787.275) (-784.050) * (-785.552) (-786.267) (-784.265) [-786.488] -- 0:00:47
      337000 -- (-784.202) (-787.343) [-784.192] (-785.426) * (-786.103) (-783.621) [-786.063] (-786.541) -- 0:00:47
      337500 -- (-784.957) [-784.858] (-790.963) (-790.268) * (-786.125) [-784.786] (-787.866) (-785.716) -- 0:00:47
      338000 -- (-788.461) [-787.166] (-786.460) (-787.898) * (-787.985) (-784.206) [-786.103] (-785.022) -- 0:00:47
      338500 -- (-787.412) (-783.818) (-791.255) [-786.690] * [-785.935] (-786.252) (-785.321) (-786.859) -- 0:00:46
      339000 -- (-785.162) [-784.147] (-788.760) (-784.919) * (-785.737) (-785.089) (-784.274) [-785.269] -- 0:00:46
      339500 -- (-785.365) (-784.177) (-788.696) [-783.714] * (-786.005) [-785.011] (-785.094) (-785.199) -- 0:00:46
      340000 -- [-784.710] (-785.714) (-783.748) (-784.124) * [-785.927] (-784.973) (-787.625) (-785.273) -- 0:00:46

      Average standard deviation of split frequencies: 0.013349

      340500 -- (-785.074) (-791.273) [-784.281] (-784.089) * (-787.470) (-784.631) (-786.582) [-786.556] -- 0:00:46
      341000 -- (-785.518) (-784.166) [-788.365] (-784.602) * [-785.339] (-784.257) (-789.491) (-790.047) -- 0:00:46
      341500 -- [-783.995] (-785.557) (-785.019) (-785.250) * (-791.175) (-788.384) [-785.085] (-785.874) -- 0:00:46
      342000 -- (-785.452) (-785.205) (-786.250) [-784.432] * (-783.730) (-785.652) (-783.884) [-786.139] -- 0:00:46
      342500 -- (-787.017) (-787.020) (-786.704) [-784.728] * (-785.294) (-784.944) [-783.409] (-786.233) -- 0:00:46
      343000 -- (-788.048) (-788.347) (-786.439) [-789.740] * (-783.857) [-786.552] (-783.772) (-786.330) -- 0:00:45
      343500 -- (-789.221) (-783.509) (-786.038) [-785.735] * (-787.931) [-785.720] (-787.850) (-787.056) -- 0:00:45
      344000 -- (-783.328) (-785.147) (-786.577) [-784.462] * (-784.426) (-786.053) [-783.572] (-785.734) -- 0:00:45
      344500 -- (-786.385) [-786.677] (-784.985) (-785.716) * [-783.650] (-784.110) (-784.293) (-786.231) -- 0:00:45
      345000 -- (-784.660) [-785.071] (-785.594) (-785.412) * (-784.698) [-787.346] (-785.145) (-785.734) -- 0:00:45

      Average standard deviation of split frequencies: 0.013624

      345500 -- (-787.104) (-785.551) (-784.217) [-789.328] * (-785.511) (-786.867) (-785.464) [-784.091] -- 0:00:45
      346000 -- (-785.275) [-785.202] (-784.119) (-788.551) * (-785.753) [-787.280] (-784.683) (-783.953) -- 0:00:45
      346500 -- [-787.801] (-785.106) (-783.772) (-784.997) * (-784.936) (-786.557) (-784.300) [-784.286] -- 0:00:45
      347000 -- (-786.351) (-785.543) [-785.549] (-790.911) * (-786.055) (-785.166) (-784.293) [-784.077] -- 0:00:47
      347500 -- (-786.133) [-788.682] (-785.730) (-788.038) * (-788.409) [-787.445] (-784.455) (-785.003) -- 0:00:46
      348000 -- [-790.129] (-785.380) (-783.893) (-783.719) * [-787.059] (-785.741) (-784.717) (-786.859) -- 0:00:46
      348500 -- (-788.454) [-784.117] (-788.609) (-784.870) * (-786.139) (-787.741) (-784.604) [-785.536] -- 0:00:46
      349000 -- (-787.866) (-783.436) [-784.130] (-783.774) * (-789.130) [-785.333] (-786.551) (-786.897) -- 0:00:46
      349500 -- (-785.642) (-783.413) (-793.730) [-789.112] * (-786.709) (-785.726) (-787.831) [-784.657] -- 0:00:46
      350000 -- [-784.493] (-788.446) (-784.668) (-786.900) * [-784.000] (-785.725) (-785.569) (-784.426) -- 0:00:46

      Average standard deviation of split frequencies: 0.012995

      350500 -- (-787.179) (-785.521) (-784.345) [-784.452] * (-784.343) (-783.697) (-785.499) [-785.172] -- 0:00:46
      351000 -- (-788.729) (-784.808) (-783.634) [-788.069] * [-785.809] (-791.024) (-785.463) (-784.559) -- 0:00:46
      351500 -- [-788.688] (-787.382) (-783.665) (-787.035) * (-784.228) (-789.234) [-786.892] (-785.951) -- 0:00:46
      352000 -- [-785.168] (-786.984) (-785.559) (-784.933) * (-785.610) (-784.542) (-785.576) [-788.072] -- 0:00:46
      352500 -- (-784.787) (-785.489) (-783.854) [-784.523] * [-786.290] (-783.983) (-786.040) (-784.353) -- 0:00:45
      353000 -- [-784.455] (-783.815) (-783.650) (-786.525) * [-787.051] (-784.141) (-785.888) (-784.640) -- 0:00:45
      353500 -- (-783.800) [-783.542] (-783.345) (-784.853) * (-787.475) [-785.423] (-785.007) (-784.235) -- 0:00:45
      354000 -- (-786.240) (-784.539) (-784.216) [-785.237] * [-784.805] (-785.047) (-783.842) (-787.119) -- 0:00:45
      354500 -- (-785.289) [-784.250] (-784.235) (-787.567) * (-783.749) (-784.657) (-785.030) [-787.085] -- 0:00:45
      355000 -- (-787.395) (-784.518) [-784.154] (-788.053) * (-784.338) (-784.872) (-784.339) [-785.787] -- 0:00:45

      Average standard deviation of split frequencies: 0.012580

      355500 -- (-785.095) (-787.003) [-787.516] (-786.636) * (-784.526) [-785.421] (-785.894) (-785.193) -- 0:00:45
      356000 -- (-787.588) [-783.550] (-788.028) (-785.512) * (-784.668) (-787.004) [-785.156] (-791.233) -- 0:00:45
      356500 -- (-788.339) (-784.058) (-785.925) [-786.527] * [-784.593] (-785.481) (-784.919) (-784.965) -- 0:00:45
      357000 -- (-785.193) (-784.310) (-788.726) [-785.674] * (-784.911) [-786.195] (-785.156) (-785.355) -- 0:00:45
      357500 -- (-786.163) (-784.265) (-790.165) [-787.388] * (-785.273) (-788.094) (-789.904) [-784.445] -- 0:00:44
      358000 -- (-784.561) [-788.269] (-783.788) (-786.993) * (-788.081) (-786.407) [-785.172] (-785.700) -- 0:00:44
      358500 -- (-785.320) [-786.136] (-785.928) (-787.072) * (-788.677) (-786.870) [-784.399] (-786.370) -- 0:00:44
      359000 -- [-783.582] (-785.171) (-786.938) (-783.413) * (-785.548) [-785.451] (-787.280) (-788.138) -- 0:00:44
      359500 -- (-789.942) [-785.075] (-785.425) (-786.307) * (-783.666) [-785.122] (-787.922) (-787.066) -- 0:00:44
      360000 -- (-784.297) [-784.508] (-783.750) (-788.972) * [-784.269] (-788.104) (-785.676) (-786.036) -- 0:00:44

      Average standard deviation of split frequencies: 0.011302

      360500 -- (-784.385) (-784.641) (-785.721) [-786.933] * (-783.613) (-790.245) (-783.605) [-784.537] -- 0:00:44
      361000 -- (-784.583) [-784.429] (-786.395) (-785.294) * (-784.011) [-786.748] (-785.332) (-784.942) -- 0:00:44
      361500 -- (-786.192) (-784.176) [-785.431] (-785.974) * (-784.912) (-789.522) (-785.864) [-785.265] -- 0:00:44
      362000 -- (-786.537) (-785.773) [-785.481] (-786.998) * [-785.276] (-784.208) (-783.711) (-785.338) -- 0:00:45
      362500 -- (-784.743) (-786.413) [-785.368] (-787.693) * (-785.056) [-784.751] (-785.323) (-786.664) -- 0:00:45
      363000 -- [-787.537] (-786.384) (-784.257) (-786.734) * [-785.810] (-786.790) (-787.490) (-788.562) -- 0:00:45
      363500 -- (-786.040) (-784.876) [-786.747] (-785.886) * (-784.469) (-786.236) [-786.660] (-787.214) -- 0:00:45
      364000 -- [-784.798] (-785.950) (-787.900) (-784.943) * (-784.174) (-786.432) [-785.639] (-784.724) -- 0:00:45
      364500 -- (-786.030) [-784.217] (-786.878) (-783.702) * (-786.529) [-783.666] (-785.311) (-784.485) -- 0:00:45
      365000 -- [-784.708] (-785.720) (-787.871) (-786.833) * (-785.634) [-785.003] (-783.752) (-785.732) -- 0:00:45

      Average standard deviation of split frequencies: 0.011321

      365500 -- (-791.341) (-789.314) [-790.564] (-787.246) * (-785.336) [-786.140] (-784.272) (-786.949) -- 0:00:45
      366000 -- (-787.105) (-787.041) [-787.175] (-785.325) * (-785.067) [-784.553] (-784.662) (-785.976) -- 0:00:45
      366500 -- (-784.076) (-789.336) [-787.448] (-786.321) * [-783.826] (-785.771) (-785.355) (-788.701) -- 0:00:44
      367000 -- (-783.871) (-784.818) [-785.677] (-786.613) * (-791.974) (-785.597) (-785.719) [-783.802] -- 0:00:44
      367500 -- (-784.494) (-784.012) [-785.487] (-789.120) * (-787.344) (-784.571) (-785.064) [-785.789] -- 0:00:44
      368000 -- [-784.617] (-784.200) (-785.349) (-788.356) * (-783.457) [-783.855] (-786.171) (-786.539) -- 0:00:44
      368500 -- (-786.062) (-785.119) (-787.106) [-786.171] * (-784.111) [-784.649] (-785.037) (-786.335) -- 0:00:44
      369000 -- [-785.111] (-787.898) (-783.772) (-785.752) * [-784.904] (-784.534) (-786.309) (-783.797) -- 0:00:44
      369500 -- (-784.450) (-784.695) (-787.490) [-783.996] * [-784.862] (-783.690) (-788.248) (-791.753) -- 0:00:44
      370000 -- (-786.243) [-785.418] (-786.804) (-785.007) * (-785.630) [-787.398] (-787.810) (-785.538) -- 0:00:44

      Average standard deviation of split frequencies: 0.010643

      370500 -- (-785.728) (-785.440) [-787.009] (-784.822) * (-786.745) [-786.658] (-788.470) (-784.574) -- 0:00:44
      371000 -- [-788.222] (-784.143) (-787.435) (-787.772) * (-786.716) [-785.189] (-786.294) (-787.038) -- 0:00:44
      371500 -- (-789.328) (-786.498) (-787.644) [-784.237] * (-784.185) (-788.693) (-784.857) [-787.253] -- 0:00:43
      372000 -- (-784.464) (-786.768) (-787.382) [-785.877] * (-784.333) (-785.013) (-784.092) [-786.192] -- 0:00:43
      372500 -- (-784.221) (-783.715) [-784.409] (-785.750) * (-787.150) (-792.478) [-784.960] (-784.500) -- 0:00:43
      373000 -- (-783.643) [-786.094] (-786.561) (-783.762) * (-784.263) (-789.032) (-786.490) [-785.102] -- 0:00:43
      373500 -- (-784.630) (-784.388) (-785.715) [-784.280] * (-787.598) [-789.806] (-786.350) (-789.059) -- 0:00:43
      374000 -- (-784.834) (-784.756) (-787.725) [-784.674] * (-787.999) (-785.082) (-789.524) [-789.206] -- 0:00:43
      374500 -- (-790.291) (-784.738) [-786.579] (-785.192) * (-786.920) [-784.534] (-786.051) (-785.748) -- 0:00:43
      375000 -- (-788.751) (-786.007) (-786.367) [-786.040] * (-795.627) [-783.930] (-784.128) (-787.793) -- 0:00:43

      Average standard deviation of split frequencies: 0.010726

      375500 -- [-784.869] (-786.298) (-784.321) (-784.979) * (-786.348) [-784.205] (-784.046) (-787.419) -- 0:00:43
      376000 -- (-784.654) (-785.680) (-784.521) [-784.222] * (-785.716) [-785.065] (-784.583) (-787.478) -- 0:00:43
      376500 -- (-784.952) (-785.000) [-784.632] (-784.827) * (-785.875) (-785.210) [-784.125] (-785.242) -- 0:00:43
      377000 -- [-786.815] (-787.371) (-784.095) (-786.022) * (-786.566) (-787.729) (-784.090) [-785.040] -- 0:00:44
      377500 -- (-784.689) [-784.226] (-786.514) (-785.170) * (-786.811) [-788.231] (-786.332) (-790.447) -- 0:00:44
      378000 -- (-784.679) [-785.220] (-789.928) (-784.740) * [-783.948] (-785.329) (-783.577) (-784.996) -- 0:00:44
      378500 -- (-784.730) (-785.848) [-789.055] (-783.984) * (-784.826) (-784.395) (-784.052) [-784.356] -- 0:00:44
      379000 -- (-783.879) (-787.026) [-791.696] (-788.747) * (-786.042) (-786.423) [-784.397] (-786.953) -- 0:00:44
      379500 -- (-783.839) (-784.132) [-789.261] (-786.515) * (-786.741) (-785.445) [-784.900] (-785.493) -- 0:00:44
      380000 -- [-786.058] (-783.243) (-793.418) (-784.127) * (-785.771) [-785.380] (-786.320) (-785.663) -- 0:00:44

      Average standard deviation of split frequencies: 0.010198

      380500 -- (-788.368) (-788.532) [-785.866] (-789.385) * (-785.527) (-788.302) (-784.663) [-784.900] -- 0:00:43
      381000 -- (-786.154) (-783.876) (-783.472) [-787.107] * (-786.685) [-785.966] (-785.899) (-789.082) -- 0:00:43
      381500 -- (-784.543) (-785.622) (-783.555) [-784.451] * (-786.302) [-787.448] (-785.083) (-791.696) -- 0:00:43
      382000 -- (-784.549) (-783.456) [-788.830] (-790.174) * [-783.937] (-787.201) (-787.205) (-785.810) -- 0:00:43
      382500 -- (-787.428) (-783.752) [-788.642] (-784.946) * [-785.685] (-785.342) (-788.835) (-784.235) -- 0:00:43
      383000 -- (-786.984) [-785.147] (-788.211) (-792.270) * (-784.166) [-785.007] (-785.432) (-786.410) -- 0:00:43
      383500 -- (-785.492) [-785.468] (-786.485) (-788.279) * [-785.017] (-785.815) (-785.653) (-787.406) -- 0:00:43
      384000 -- (-785.844) (-788.981) (-785.962) [-783.919] * (-785.068) [-788.467] (-786.112) (-784.463) -- 0:00:43
      384500 -- (-785.551) [-788.065] (-785.329) (-786.032) * [-786.095] (-787.866) (-787.525) (-785.072) -- 0:00:43
      385000 -- (-786.505) (-785.868) [-783.822] (-785.962) * [-785.934] (-783.454) (-785.420) (-784.558) -- 0:00:43

      Average standard deviation of split frequencies: 0.010313

      385500 -- (-783.661) (-787.292) [-786.068] (-787.310) * (-783.714) (-785.744) [-784.121] (-787.798) -- 0:00:43
      386000 -- (-784.376) (-790.920) (-789.676) [-783.915] * [-788.656] (-787.341) (-785.442) (-788.203) -- 0:00:42
      386500 -- (-784.595) [-788.129] (-785.917) (-785.039) * (-784.337) (-788.914) [-784.913] (-787.626) -- 0:00:42
      387000 -- (-784.548) (-790.562) (-788.447) [-786.354] * [-787.136] (-785.405) (-785.460) (-785.181) -- 0:00:42
      387500 -- (-787.472) (-785.117) (-788.292) [-787.266] * (-784.261) (-784.214) [-785.415] (-785.065) -- 0:00:42
      388000 -- (-785.921) (-785.411) [-785.315] (-787.471) * (-789.524) (-784.567) [-784.128] (-788.630) -- 0:00:42
      388500 -- (-789.259) (-784.070) (-784.588) [-788.004] * (-787.236) (-784.545) (-785.940) [-783.269] -- 0:00:42
      389000 -- (-783.882) (-785.040) (-784.140) [-785.475] * [-783.878] (-784.785) (-784.274) (-785.850) -- 0:00:42
      389500 -- (-784.488) (-784.888) [-783.568] (-788.824) * [-784.409] (-783.519) (-784.274) (-783.475) -- 0:00:42
      390000 -- (-783.974) [-785.874] (-784.150) (-785.931) * (-784.265) [-784.662] (-788.142) (-784.089) -- 0:00:42

      Average standard deviation of split frequencies: 0.010525

      390500 -- [-784.462] (-790.095) (-786.540) (-784.691) * (-786.585) (-784.094) (-784.319) [-786.006] -- 0:00:42
      391000 -- (-785.458) (-786.941) (-785.562) [-785.087] * (-786.233) (-784.808) (-783.517) [-787.138] -- 0:00:42
      391500 -- [-784.169] (-788.844) (-785.724) (-786.622) * (-784.943) (-785.393) [-784.663] (-786.593) -- 0:00:43
      392000 -- (-785.482) [-787.338] (-784.046) (-795.261) * (-786.539) (-785.387) (-784.154) [-785.213] -- 0:00:43
      392500 -- (-785.397) (-786.116) (-784.451) [-790.777] * [-785.961] (-788.963) (-784.119) (-784.336) -- 0:00:43
      393000 -- (-787.445) (-783.716) [-784.714] (-784.808) * (-785.227) (-784.711) (-784.944) [-786.103] -- 0:00:43
      393500 -- [-785.530] (-784.408) (-786.004) (-785.261) * (-786.340) (-784.088) (-786.270) [-790.532] -- 0:00:43
      394000 -- (-790.826) (-784.993) [-785.217] (-783.263) * (-787.628) (-786.252) [-786.108] (-792.041) -- 0:00:43
      394500 -- (-785.988) (-786.045) (-784.755) [-783.486] * (-783.393) (-787.707) (-786.619) [-785.679] -- 0:00:42
      395000 -- [-786.113] (-784.909) (-786.203) (-783.717) * (-784.167) (-787.431) [-786.431] (-785.497) -- 0:00:42

      Average standard deviation of split frequencies: 0.010515

      395500 -- (-784.815) (-784.633) (-784.498) [-784.937] * [-786.894] (-785.726) (-786.723) (-785.379) -- 0:00:42
      396000 -- (-784.278) (-786.972) [-787.619] (-787.002) * [-786.687] (-786.035) (-791.134) (-785.552) -- 0:00:42
      396500 -- [-784.926] (-785.365) (-786.108) (-786.946) * (-784.915) (-785.434) [-786.979] (-784.254) -- 0:00:42
      397000 -- (-787.150) [-787.842] (-786.737) (-789.115) * (-788.374) (-788.566) (-785.397) [-784.317] -- 0:00:42
      397500 -- [-785.516] (-784.951) (-784.955) (-786.754) * (-788.622) (-785.903) (-783.523) [-785.281] -- 0:00:42
      398000 -- (-787.234) [-788.444] (-784.828) (-784.598) * (-788.116) (-784.706) [-786.532] (-784.412) -- 0:00:42
      398500 -- (-790.783) [-785.786] (-785.067) (-784.949) * (-788.494) [-786.562] (-785.974) (-785.585) -- 0:00:42
      399000 -- (-785.019) (-785.537) (-786.249) [-785.577] * (-784.384) (-786.341) [-785.014] (-786.674) -- 0:00:42
      399500 -- [-785.370] (-786.544) (-786.284) (-788.067) * [-784.472] (-786.603) (-787.976) (-788.314) -- 0:00:42
      400000 -- (-783.519) (-787.445) [-784.103] (-784.111) * (-786.665) (-787.963) (-786.048) [-786.385] -- 0:00:41

      Average standard deviation of split frequencies: 0.009274

      400500 -- (-783.337) [-785.838] (-786.785) (-784.665) * (-784.612) (-789.018) [-785.041] (-786.991) -- 0:00:41
      401000 -- (-784.419) [-785.014] (-785.629) (-784.441) * (-786.273) [-786.459] (-785.829) (-786.019) -- 0:00:41
      401500 -- (-784.663) (-783.733) [-785.704] (-784.386) * (-785.712) [-783.467] (-786.814) (-787.069) -- 0:00:41
      402000 -- (-787.652) [-784.088] (-787.030) (-785.343) * [-784.649] (-784.118) (-786.884) (-785.855) -- 0:00:41
      402500 -- (-785.050) (-784.968) [-785.185] (-783.871) * [-786.486] (-785.693) (-788.326) (-783.445) -- 0:00:41
      403000 -- (-786.747) [-784.618] (-787.821) (-788.210) * (-787.148) (-786.068) [-786.495] (-784.595) -- 0:00:41
      403500 -- (-785.061) [-785.568] (-785.350) (-783.979) * (-785.381) (-785.074) [-788.310] (-788.138) -- 0:00:41
      404000 -- (-785.189) [-784.264] (-785.293) (-787.728) * (-785.701) (-789.041) (-786.357) [-784.258] -- 0:00:41
      404500 -- (-785.328) (-789.879) (-786.501) [-790.809] * (-786.598) (-784.439) [-785.436] (-783.991) -- 0:00:41
      405000 -- (-784.418) (-790.880) [-785.004] (-788.315) * (-783.608) (-786.722) (-785.487) [-785.790] -- 0:00:41

      Average standard deviation of split frequencies: 0.008837

      405500 -- (-785.708) (-786.836) (-788.466) [-786.989] * (-784.596) (-785.846) [-785.309] (-787.292) -- 0:00:42
      406000 -- (-787.103) (-786.740) [-785.454] (-788.818) * (-787.648) [-785.560] (-783.905) (-785.739) -- 0:00:42
      406500 -- [-784.561] (-784.952) (-784.479) (-785.207) * [-788.791] (-787.566) (-784.979) (-787.611) -- 0:00:42
      407000 -- [-784.883] (-784.686) (-786.477) (-785.336) * [-787.806] (-784.805) (-786.680) (-787.171) -- 0:00:42
      407500 -- (-783.837) (-785.564) (-791.357) [-784.147] * (-786.567) (-784.360) [-788.142] (-785.740) -- 0:00:42
      408000 -- [-785.197] (-794.116) (-784.977) (-784.606) * (-785.478) (-788.647) (-787.354) [-786.797] -- 0:00:42
      408500 -- [-786.783] (-789.223) (-786.251) (-788.244) * (-784.940) (-788.296) [-788.558] (-784.119) -- 0:00:41
      409000 -- (-785.860) (-785.594) (-787.058) [-788.994] * (-784.629) [-785.032] (-784.347) (-787.490) -- 0:00:41
      409500 -- (-789.637) (-788.233) [-785.468] (-785.355) * (-784.628) [-786.048] (-785.190) (-788.174) -- 0:00:41
      410000 -- (-784.659) (-787.377) (-785.246) [-786.125] * (-784.545) (-790.571) [-783.983] (-785.290) -- 0:00:41

      Average standard deviation of split frequencies: 0.008992

      410500 -- [-786.569] (-787.754) (-787.293) (-783.764) * (-784.929) [-788.054] (-785.694) (-785.673) -- 0:00:41
      411000 -- (-783.432) (-787.462) (-785.508) [-785.145] * [-786.541] (-787.461) (-786.399) (-786.576) -- 0:00:41
      411500 -- (-785.202) (-784.625) [-785.069] (-785.529) * (-789.933) (-789.709) [-784.734] (-786.327) -- 0:00:41
      412000 -- (-786.587) (-784.212) [-785.658] (-788.613) * (-788.391) [-786.132] (-786.021) (-784.556) -- 0:00:41
      412500 -- (-786.138) [-786.805] (-784.215) (-788.217) * [-787.835] (-784.886) (-791.124) (-788.259) -- 0:00:41
      413000 -- [-790.994] (-788.750) (-790.901) (-784.841) * (-789.020) [-785.550] (-785.811) (-785.929) -- 0:00:41
      413500 -- (-787.252) (-786.521) [-789.690] (-787.308) * (-788.573) (-784.900) (-789.855) [-785.493] -- 0:00:41
      414000 -- (-785.073) (-786.361) [-788.188] (-786.525) * (-789.321) (-785.733) (-785.455) [-784.810] -- 0:00:41
      414500 -- (-785.792) [-788.116] (-786.912) (-785.471) * (-785.942) (-784.370) [-783.783] (-784.380) -- 0:00:40
      415000 -- (-784.969) (-785.232) (-784.528) [-784.645] * [-786.635] (-783.809) (-786.318) (-783.700) -- 0:00:40

      Average standard deviation of split frequencies: 0.008877

      415500 -- [-785.394] (-785.494) (-785.552) (-789.910) * [-787.877] (-786.643) (-785.601) (-785.726) -- 0:00:40
      416000 -- [-785.723] (-785.579) (-784.623) (-788.348) * [-785.613] (-783.551) (-786.180) (-785.726) -- 0:00:40
      416500 -- (-786.322) (-787.769) (-785.071) [-785.137] * (-785.494) [-785.413] (-785.409) (-788.363) -- 0:00:40
      417000 -- (-788.916) (-787.656) [-783.943] (-784.847) * (-785.478) [-783.876] (-785.771) (-786.630) -- 0:00:40
      417500 -- [-790.009] (-786.278) (-786.726) (-786.630) * (-788.557) (-784.639) (-786.769) [-787.566] -- 0:00:40
      418000 -- (-786.354) [-784.254] (-793.790) (-784.374) * (-786.980) (-786.687) (-788.490) [-785.884] -- 0:00:40
      418500 -- (-785.494) (-784.260) (-788.491) [-784.957] * (-786.416) [-784.812] (-786.039) (-789.179) -- 0:00:40
      419000 -- (-784.955) (-784.356) [-787.395] (-788.641) * (-788.720) [-785.024] (-784.721) (-790.824) -- 0:00:40
      419500 -- (-786.954) [-783.726] (-784.108) (-786.930) * (-789.498) [-784.751] (-785.712) (-789.863) -- 0:00:40
      420000 -- (-786.186) (-786.112) (-787.917) [-785.537] * (-784.233) [-786.319] (-784.971) (-787.204) -- 0:00:40

      Average standard deviation of split frequencies: 0.009294

      420500 -- (-786.670) (-785.286) (-785.010) [-786.887] * (-787.043) (-784.136) (-785.941) [-784.029] -- 0:00:41
      421000 -- (-785.024) (-783.634) (-784.531) [-785.303] * (-787.466) (-786.725) (-788.344) [-784.726] -- 0:00:41
      421500 -- (-787.443) [-784.632] (-787.097) (-784.131) * [-784.712] (-788.692) (-787.346) (-786.074) -- 0:00:41
      422000 -- (-786.717) (-786.782) [-784.642] (-784.998) * [-784.094] (-788.730) (-784.238) (-786.773) -- 0:00:41
      422500 -- (-786.246) (-786.746) [-783.823] (-789.024) * [-783.828] (-784.035) (-787.532) (-787.252) -- 0:00:41
      423000 -- (-786.525) (-784.063) [-783.493] (-786.249) * (-785.692) [-790.059] (-791.019) (-786.727) -- 0:00:40
      423500 -- (-788.086) (-784.814) [-783.401] (-784.578) * (-788.132) [-786.332] (-785.888) (-784.389) -- 0:00:40
      424000 -- [-786.557] (-788.760) (-784.180) (-786.706) * (-785.169) (-785.841) (-785.111) [-785.090] -- 0:00:40
      424500 -- (-786.890) [-784.840] (-784.525) (-787.130) * [-783.920] (-785.566) (-785.223) (-783.880) -- 0:00:40
      425000 -- (-787.144) (-786.243) [-785.725] (-784.262) * [-784.875] (-784.087) (-787.736) (-784.104) -- 0:00:40

      Average standard deviation of split frequencies: 0.009529

      425500 -- (-785.761) [-785.492] (-785.513) (-785.142) * (-785.083) [-784.128] (-786.204) (-786.132) -- 0:00:40
      426000 -- (-785.048) (-788.306) [-785.451] (-784.265) * [-786.607] (-785.991) (-783.902) (-786.148) -- 0:00:40
      426500 -- (-784.195) (-789.171) (-784.127) [-784.591] * (-788.561) (-788.028) [-784.276] (-786.691) -- 0:00:40
      427000 -- (-784.853) [-786.031] (-784.343) (-786.365) * (-788.938) [-787.563] (-786.849) (-786.948) -- 0:00:40
      427500 -- [-783.723] (-788.656) (-786.021) (-784.869) * (-787.877) (-785.819) (-785.182) [-785.660] -- 0:00:40
      428000 -- (-784.610) (-791.594) [-784.100] (-786.692) * (-797.601) [-786.912] (-784.540) (-790.343) -- 0:00:40
      428500 -- (-787.982) (-792.424) (-790.912) [-785.725] * (-797.782) [-786.110] (-785.133) (-787.734) -- 0:00:40
      429000 -- [-786.324] (-785.752) (-785.573) (-785.489) * (-785.938) [-788.787] (-784.877) (-786.220) -- 0:00:39
      429500 -- (-787.339) (-787.638) (-786.517) [-784.769] * (-784.694) (-785.980) [-785.044] (-784.769) -- 0:00:39
      430000 -- (-784.953) (-785.799) (-789.907) [-786.188] * [-783.804] (-784.860) (-785.099) (-784.136) -- 0:00:39

      Average standard deviation of split frequencies: 0.009426

      430500 -- [-785.824] (-786.087) (-794.131) (-787.592) * (-785.118) (-788.553) [-783.908] (-784.907) -- 0:00:39
      431000 -- (-787.031) [-785.810] (-791.291) (-784.847) * (-787.394) (-784.468) (-787.391) [-783.991] -- 0:00:39
      431500 -- (-783.816) (-785.648) [-785.689] (-786.718) * (-785.432) (-787.728) [-788.146] (-784.294) -- 0:00:39
      432000 -- (-785.247) [-785.515] (-784.007) (-785.739) * (-786.110) (-785.577) (-784.500) [-783.912] -- 0:00:39
      432500 -- (-783.792) (-783.791) (-784.275) [-783.792] * (-783.394) [-784.858] (-785.183) (-783.682) -- 0:00:39
      433000 -- (-786.522) (-783.378) (-784.523) [-790.959] * (-784.116) (-787.313) (-784.935) [-786.352] -- 0:00:39
      433500 -- (-783.518) [-783.471] (-786.601) (-783.786) * (-785.605) (-788.790) [-784.539] (-787.955) -- 0:00:39
      434000 -- (-785.611) (-788.008) (-787.193) [-787.461] * (-788.361) [-785.112] (-786.254) (-786.089) -- 0:00:39
      434500 -- (-788.972) (-787.672) (-786.079) [-785.912] * (-786.500) (-786.213) [-785.911] (-784.401) -- 0:00:39
      435000 -- (-789.521) [-785.003] (-785.380) (-786.657) * (-784.522) (-784.118) [-785.550] (-785.965) -- 0:00:40

      Average standard deviation of split frequencies: 0.009190

      435500 -- (-785.208) [-784.079] (-788.168) (-785.914) * [-784.555] (-787.124) (-786.461) (-784.686) -- 0:00:40
      436000 -- (-788.754) (-786.445) [-790.336] (-786.343) * (-784.331) [-786.718] (-786.063) (-785.636) -- 0:00:40
      436500 -- (-783.932) (-785.920) (-784.084) [-787.316] * (-785.253) (-785.460) [-785.912] (-785.581) -- 0:00:40
      437000 -- (-784.847) (-787.145) (-785.296) [-783.594] * (-785.078) [-784.291] (-785.224) (-786.163) -- 0:00:39
      437500 -- (-785.690) [-785.679] (-784.813) (-785.717) * (-785.632) [-784.745] (-785.752) (-785.556) -- 0:00:39
      438000 -- (-785.138) [-785.462] (-784.377) (-784.063) * [-784.254] (-784.768) (-787.547) (-783.702) -- 0:00:39
      438500 -- [-784.856] (-785.751) (-783.742) (-784.159) * [-785.097] (-784.475) (-785.185) (-784.235) -- 0:00:39
      439000 -- (-783.757) (-784.082) [-785.285] (-785.740) * [-784.200] (-785.033) (-783.864) (-784.636) -- 0:00:39
      439500 -- [-787.322] (-785.316) (-784.136) (-786.767) * [-784.067] (-785.331) (-783.602) (-784.021) -- 0:00:39
      440000 -- (-784.568) [-784.852] (-783.666) (-783.931) * (-783.718) [-785.209] (-785.884) (-784.447) -- 0:00:39

      Average standard deviation of split frequencies: 0.009568

      440500 -- (-785.422) [-785.132] (-784.074) (-784.657) * (-784.631) (-785.446) (-786.171) [-783.876] -- 0:00:39
      441000 -- (-785.154) (-785.578) (-784.074) [-786.687] * (-784.888) [-783.579] (-789.121) (-784.095) -- 0:00:39
      441500 -- [-786.142] (-785.732) (-783.573) (-785.000) * (-783.461) (-784.140) [-787.991] (-784.438) -- 0:00:39
      442000 -- (-785.248) [-783.278] (-784.545) (-786.879) * (-784.644) (-787.377) [-784.446] (-790.953) -- 0:00:39
      442500 -- (-786.527) [-785.554] (-786.321) (-784.450) * [-785.403] (-786.696) (-785.430) (-785.954) -- 0:00:39
      443000 -- (-783.776) [-792.831] (-785.647) (-784.822) * (-788.247) (-788.397) (-784.578) [-789.040] -- 0:00:38
      443500 -- (-784.102) (-784.649) (-783.993) [-785.283] * (-785.436) (-787.294) [-786.707] (-784.312) -- 0:00:38
      444000 -- (-788.608) (-785.624) [-786.349] (-785.860) * [-784.602] (-791.701) (-786.251) (-784.759) -- 0:00:38
      444500 -- (-785.700) (-785.412) (-786.196) [-784.842] * (-784.347) [-785.476] (-787.381) (-785.461) -- 0:00:38
      445000 -- (-783.488) (-784.988) (-785.438) [-784.104] * (-785.772) (-787.323) [-786.026] (-788.481) -- 0:00:38

      Average standard deviation of split frequencies: 0.009982

      445500 -- (-787.505) (-784.382) (-784.826) [-783.290] * [-786.196] (-787.692) (-786.212) (-786.753) -- 0:00:38
      446000 -- (-785.727) [-786.695] (-787.373) (-783.903) * (-784.340) [-787.922] (-785.843) (-787.090) -- 0:00:38
      446500 -- (-789.448) (-788.097) [-787.917] (-785.218) * (-785.955) [-784.226] (-783.749) (-784.131) -- 0:00:38
      447000 -- [-786.932] (-784.706) (-785.110) (-786.405) * (-788.053) (-784.559) (-786.379) [-785.638] -- 0:00:38
      447500 -- (-789.726) (-785.419) (-785.526) [-785.761] * (-783.365) (-788.491) (-784.944) [-786.497] -- 0:00:38
      448000 -- (-788.002) (-784.380) [-785.387] (-785.328) * (-785.541) (-786.702) [-789.779] (-788.249) -- 0:00:38
      448500 -- [-786.973] (-789.702) (-786.661) (-785.699) * (-785.710) [-787.165] (-788.650) (-785.794) -- 0:00:38
      449000 -- [-785.828] (-787.194) (-784.546) (-786.345) * (-786.956) (-796.815) [-785.597] (-785.176) -- 0:00:39
      449500 -- (-784.997) (-791.890) [-787.677] (-784.921) * [-784.634] (-797.063) (-786.521) (-786.370) -- 0:00:39
      450000 -- (-786.516) (-785.437) (-785.888) [-786.616] * (-784.463) (-793.530) [-785.545] (-789.451) -- 0:00:39

      Average standard deviation of split frequencies: 0.009705

      450500 -- (-787.155) (-787.170) [-784.636] (-786.304) * (-785.797) (-785.433) (-785.720) [-786.392] -- 0:00:39
      451000 -- (-786.253) (-788.020) [-787.965] (-785.855) * [-784.239] (-785.701) (-786.972) (-785.576) -- 0:00:38
      451500 -- (-786.162) (-786.857) (-788.534) [-787.322] * (-783.471) (-786.231) [-784.830] (-783.883) -- 0:00:38
      452000 -- (-786.128) (-787.503) (-786.792) [-784.065] * (-788.101) (-784.810) (-785.829) [-786.425] -- 0:00:38
      452500 -- [-785.751] (-784.591) (-784.115) (-784.609) * [-784.591] (-786.318) (-790.121) (-784.358) -- 0:00:38
      453000 -- (-786.525) (-786.923) [-785.988] (-784.230) * (-787.383) (-785.002) (-791.462) [-784.353] -- 0:00:38
      453500 -- [-786.503] (-784.596) (-785.269) (-784.308) * (-787.326) (-785.326) [-788.484] (-786.801) -- 0:00:38
      454000 -- (-788.825) (-784.464) [-784.577] (-783.769) * (-786.859) (-784.625) (-785.089) [-784.100] -- 0:00:38
      454500 -- [-789.285] (-787.251) (-786.577) (-787.833) * (-787.305) [-785.706] (-785.828) (-783.958) -- 0:00:38
      455000 -- (-789.101) (-792.711) [-789.551] (-788.992) * (-787.245) [-786.470] (-786.668) (-784.932) -- 0:00:38

      Average standard deviation of split frequencies: 0.010051

      455500 -- (-785.984) (-784.844) [-787.072] (-787.140) * (-784.909) [-785.127] (-789.255) (-785.394) -- 0:00:38
      456000 -- (-787.533) [-785.463] (-784.162) (-785.727) * (-785.714) (-783.315) [-784.280] (-784.464) -- 0:00:38
      456500 -- (-784.739) (-785.734) (-783.893) [-784.256] * (-785.936) (-789.737) (-784.284) [-784.863] -- 0:00:38
      457000 -- (-787.199) (-787.533) [-785.448] (-785.840) * (-786.634) [-787.566] (-786.104) (-785.534) -- 0:00:38
      457500 -- (-786.029) (-784.964) (-786.683) [-786.689] * (-785.092) (-786.478) (-788.564) [-789.122] -- 0:00:37
      458000 -- [-783.735] (-783.771) (-786.253) (-791.476) * [-788.541] (-787.918) (-787.127) (-788.372) -- 0:00:37
      458500 -- (-784.557) (-784.900) [-785.635] (-786.374) * [-784.052] (-785.661) (-789.200) (-786.979) -- 0:00:37
      459000 -- (-785.750) (-784.792) [-786.902] (-788.688) * (-783.704) (-785.613) (-784.515) [-784.481] -- 0:00:37
      459500 -- [-784.791] (-784.356) (-784.849) (-786.182) * (-785.256) (-785.476) (-788.609) [-783.628] -- 0:00:37
      460000 -- (-785.580) (-786.715) (-791.389) [-784.129] * (-788.997) (-785.163) (-786.476) [-783.802] -- 0:00:37

      Average standard deviation of split frequencies: 0.009892

      460500 -- (-788.137) (-783.908) (-784.877) [-783.315] * (-790.917) (-786.884) [-786.105] (-787.650) -- 0:00:37
      461000 -- (-788.895) (-784.351) [-786.243] (-785.682) * (-786.263) (-784.969) (-786.373) [-787.064] -- 0:00:37
      461500 -- (-785.601) [-786.838] (-784.066) (-787.851) * (-786.263) (-787.199) [-790.352] (-785.054) -- 0:00:37
      462000 -- (-785.218) [-785.689] (-784.639) (-786.757) * [-785.256] (-784.300) (-785.658) (-783.659) -- 0:00:37
      462500 -- (-784.514) (-788.328) (-786.368) [-784.239] * [-783.654] (-785.960) (-785.942) (-787.085) -- 0:00:37
      463000 -- [-786.087] (-794.984) (-787.927) (-784.238) * [-783.727] (-784.515) (-788.390) (-785.340) -- 0:00:37
      463500 -- (-783.825) (-790.801) [-788.159] (-787.992) * (-784.090) (-785.734) [-783.880] (-791.020) -- 0:00:37
      464000 -- (-785.914) (-784.903) (-785.682) [-785.956] * (-786.923) [-786.974] (-784.663) (-788.854) -- 0:00:38
      464500 -- (-783.614) [-784.361] (-783.432) (-788.203) * (-788.878) (-783.947) [-784.223] (-784.806) -- 0:00:38
      465000 -- [-785.736] (-785.155) (-784.000) (-787.970) * (-787.115) (-784.392) (-785.882) [-788.319] -- 0:00:37

      Average standard deviation of split frequencies: 0.009891

      465500 -- [-784.355] (-786.064) (-784.731) (-783.616) * (-787.839) [-785.540] (-785.285) (-788.061) -- 0:00:37
      466000 -- (-787.241) (-786.448) (-786.788) [-784.273] * [-786.824] (-788.048) (-788.475) (-784.324) -- 0:00:37
      466500 -- (-784.930) (-785.061) (-784.906) [-787.127] * (-789.205) (-787.171) [-784.274] (-785.411) -- 0:00:37
      467000 -- (-787.287) [-785.481] (-789.713) (-786.196) * (-788.602) [-784.472] (-784.189) (-784.434) -- 0:00:37
      467500 -- (-785.823) (-789.390) [-787.227] (-785.738) * [-787.674] (-788.105) (-783.535) (-785.488) -- 0:00:37
      468000 -- (-786.373) [-788.257] (-784.314) (-783.850) * (-785.129) (-786.098) (-785.698) [-784.401] -- 0:00:37
      468500 -- (-786.755) (-788.861) (-784.170) [-783.998] * [-783.799] (-785.157) (-788.627) (-784.551) -- 0:00:37
      469000 -- (-790.502) (-784.605) (-794.200) [-784.499] * (-785.540) (-787.003) (-788.839) [-786.633] -- 0:00:37
      469500 -- (-789.173) (-785.095) (-786.902) [-784.237] * (-787.146) (-785.586) [-786.248] (-787.321) -- 0:00:37
      470000 -- (-787.934) [-784.013] (-785.647) (-789.266) * [-785.173] (-787.747) (-789.765) (-785.357) -- 0:00:37

      Average standard deviation of split frequencies: 0.009070

      470500 -- (-789.242) [-784.291] (-783.802) (-786.601) * [-785.394] (-785.140) (-784.861) (-788.648) -- 0:00:37
      471000 -- (-790.891) (-784.751) [-789.983] (-786.437) * (-786.617) (-786.564) (-786.949) [-783.873] -- 0:00:37
      471500 -- (-788.567) (-784.799) (-787.118) [-784.054] * (-786.750) [-784.491] (-785.857) (-787.096) -- 0:00:36
      472000 -- (-785.148) [-787.353] (-787.637) (-784.044) * [-784.395] (-785.169) (-783.853) (-785.421) -- 0:00:36
      472500 -- (-788.414) (-785.876) (-783.831) [-788.986] * (-786.161) [-786.048] (-784.938) (-787.991) -- 0:00:36
      473000 -- (-786.575) [-785.771] (-784.562) (-785.644) * [-785.405] (-790.569) (-787.634) (-784.600) -- 0:00:36
      473500 -- [-784.137] (-784.375) (-787.065) (-784.133) * (-788.684) (-787.589) (-786.987) [-787.209] -- 0:00:36
      474000 -- (-785.431) (-792.660) [-786.284] (-784.061) * [-786.199] (-785.353) (-787.011) (-788.139) -- 0:00:36
      474500 -- (-786.654) (-790.144) (-784.602) [-785.471] * (-787.565) [-785.420] (-784.991) (-785.762) -- 0:00:36
      475000 -- [-786.563] (-785.542) (-783.875) (-786.136) * (-783.761) (-787.134) (-788.426) [-785.299] -- 0:00:36

      Average standard deviation of split frequencies: 0.009188

      475500 -- [-784.721] (-787.848) (-788.400) (-790.874) * (-784.686) (-787.089) (-786.550) [-785.155] -- 0:00:36
      476000 -- (-786.292) (-791.487) [-784.286] (-787.531) * (-784.688) (-787.096) (-785.378) [-785.724] -- 0:00:36
      476500 -- [-787.519] (-786.445) (-786.517) (-786.318) * (-784.996) (-789.386) [-783.730] (-793.239) -- 0:00:36
      477000 -- (-784.574) [-783.977] (-794.091) (-788.211) * (-785.076) (-784.967) [-786.618] (-786.950) -- 0:00:36
      477500 -- (-785.642) (-784.862) (-786.601) [-788.985] * (-785.608) (-786.277) (-784.348) [-787.083] -- 0:00:36
      478000 -- (-789.998) (-784.747) [-786.040] (-785.660) * [-786.269] (-787.489) (-784.514) (-786.554) -- 0:00:36
      478500 -- (-786.948) [-784.314] (-784.626) (-788.254) * (-784.152) (-786.561) [-784.392] (-791.822) -- 0:00:37
      479000 -- [-785.482] (-784.229) (-785.349) (-790.687) * [-783.271] (-785.482) (-785.422) (-783.339) -- 0:00:36
      479500 -- (-785.567) [-785.221] (-785.713) (-788.264) * (-785.391) [-786.094] (-789.692) (-785.972) -- 0:00:36
      480000 -- (-785.799) (-784.552) [-784.628] (-783.775) * [-784.963] (-787.427) (-784.958) (-784.434) -- 0:00:36

      Average standard deviation of split frequencies: 0.009461

      480500 -- [-788.850] (-786.761) (-784.742) (-785.720) * (-786.143) [-785.119] (-784.157) (-784.350) -- 0:00:36
      481000 -- (-786.679) (-786.035) (-785.558) [-784.553] * (-786.233) (-783.872) [-783.636] (-785.376) -- 0:00:36
      481500 -- [-787.287] (-788.926) (-784.935) (-785.697) * (-786.700) (-784.020) [-784.659] (-784.813) -- 0:00:36
      482000 -- (-785.794) [-788.272] (-783.795) (-785.584) * (-784.068) (-784.560) [-784.444] (-787.166) -- 0:00:36
      482500 -- [-785.192] (-784.147) (-783.926) (-785.843) * [-788.375] (-783.918) (-784.619) (-790.226) -- 0:00:36
      483000 -- (-785.345) (-788.703) [-784.834] (-785.551) * (-785.190) (-783.858) (-785.530) [-788.483] -- 0:00:36
      483500 -- (-784.394) (-783.757) (-784.764) [-785.204] * (-786.553) (-784.736) [-785.653] (-786.580) -- 0:00:36
      484000 -- (-784.247) [-784.148] (-786.543) (-785.515) * (-785.792) (-786.557) [-784.972] (-785.785) -- 0:00:36
      484500 -- (-783.735) (-785.384) [-787.336] (-784.430) * [-784.156] (-787.689) (-786.882) (-784.179) -- 0:00:36
      485000 -- (-784.382) (-785.034) (-788.552) [-785.906] * [-784.694] (-787.117) (-785.944) (-784.704) -- 0:00:36

      Average standard deviation of split frequencies: 0.009072

      485500 -- (-784.750) (-787.896) [-787.728] (-785.294) * (-783.403) [-784.399] (-785.803) (-787.825) -- 0:00:36
      486000 -- [-783.962] (-786.535) (-784.655) (-784.516) * (-783.714) (-786.788) (-790.116) [-785.406] -- 0:00:35
      486500 -- (-784.612) (-786.785) (-783.568) [-785.643] * [-783.605] (-789.543) (-784.557) (-787.069) -- 0:00:35
      487000 -- (-785.079) (-784.908) [-784.439] (-783.991) * (-783.572) (-785.049) (-786.321) [-786.322] -- 0:00:35
      487500 -- (-784.444) (-783.993) [-787.763] (-785.543) * (-785.589) [-783.997] (-788.511) (-790.282) -- 0:00:35
      488000 -- [-786.217] (-786.554) (-786.467) (-785.872) * [-785.330] (-784.042) (-784.307) (-788.782) -- 0:00:35
      488500 -- (-783.751) (-792.752) (-784.976) [-785.646] * (-789.916) (-784.498) [-785.640] (-788.241) -- 0:00:35
      489000 -- (-788.449) (-786.392) [-784.893] (-785.506) * [-788.487] (-787.859) (-786.923) (-786.844) -- 0:00:35
      489500 -- [-785.349] (-789.666) (-786.049) (-787.743) * (-785.666) (-785.170) [-783.697] (-790.599) -- 0:00:35
      490000 -- (-786.604) [-785.774] (-785.634) (-785.504) * (-788.159) (-786.577) [-783.392] (-788.560) -- 0:00:35

      Average standard deviation of split frequencies: 0.008590

      490500 -- (-786.369) [-788.001] (-785.186) (-785.604) * (-783.702) [-784.505] (-784.353) (-784.750) -- 0:00:35
      491000 -- (-786.903) (-789.021) [-784.026] (-783.753) * (-786.129) [-785.699] (-787.189) (-783.635) -- 0:00:35
      491500 -- (-784.970) (-784.002) (-784.832) [-785.847] * (-785.880) (-786.433) (-785.165) [-784.789] -- 0:00:35
      492000 -- (-792.737) [-784.644] (-785.028) (-785.258) * (-786.000) (-784.671) (-785.341) [-785.827] -- 0:00:35
      492500 -- (-790.215) [-784.043] (-788.791) (-784.871) * (-789.244) (-787.626) (-785.304) [-786.404] -- 0:00:35
      493000 -- (-784.608) (-785.197) (-786.510) [-784.764] * (-787.511) (-786.308) (-783.693) [-785.906] -- 0:00:34
      493500 -- (-786.090) (-784.546) (-785.654) [-784.164] * (-783.779) (-783.665) [-784.782] (-784.622) -- 0:00:35
      494000 -- (-790.520) (-785.683) [-786.492] (-784.165) * (-788.787) (-785.785) (-785.556) [-784.797] -- 0:00:35
      494500 -- (-785.437) (-789.504) [-783.633] (-783.276) * (-784.629) (-786.164) (-783.830) [-785.541] -- 0:00:35
      495000 -- (-791.785) (-791.224) (-785.506) [-783.417] * (-786.788) (-783.854) [-784.856] (-787.739) -- 0:00:35

      Average standard deviation of split frequencies: 0.007827

      495500 -- [-784.617] (-787.333) (-785.675) (-784.368) * (-783.726) [-784.442] (-784.568) (-785.363) -- 0:00:35
      496000 -- (-787.746) (-784.529) [-787.190] (-783.774) * [-785.343] (-786.980) (-784.208) (-786.605) -- 0:00:35
      496500 -- [-783.667] (-786.419) (-789.221) (-786.818) * [-785.940] (-785.646) (-784.226) (-785.320) -- 0:00:35
      497000 -- [-785.458] (-784.255) (-783.763) (-787.498) * (-783.598) (-784.746) (-783.446) [-785.389] -- 0:00:35
      497500 -- (-785.158) (-786.004) (-783.846) [-790.731] * (-784.812) (-785.088) [-783.980] (-783.785) -- 0:00:35
      498000 -- [-785.569] (-784.110) (-791.020) (-784.533) * (-783.436) (-794.070) (-794.298) [-784.027] -- 0:00:35
      498500 -- [-784.614] (-785.987) (-784.513) (-784.458) * (-785.724) [-787.774] (-785.105) (-787.466) -- 0:00:35
      499000 -- (-785.788) [-784.732] (-786.107) (-786.853) * (-785.049) (-783.789) [-789.189] (-786.232) -- 0:00:35
      499500 -- (-785.033) [-784.805] (-786.676) (-789.628) * (-785.554) [-783.818] (-784.902) (-788.506) -- 0:00:35
      500000 -- (-783.842) [-785.578] (-786.562) (-787.938) * [-785.979] (-784.048) (-785.271) (-786.698) -- 0:00:35

      Average standard deviation of split frequencies: 0.008356

      500500 -- (-784.784) [-786.392] (-784.049) (-787.341) * (-784.734) (-788.775) [-784.101] (-787.213) -- 0:00:34
      501000 -- (-784.553) [-784.616] (-786.583) (-786.012) * (-788.830) [-787.001] (-786.915) (-785.218) -- 0:00:34
      501500 -- (-785.930) (-783.746) [-785.089] (-786.111) * (-788.561) [-785.283] (-790.245) (-784.048) -- 0:00:34
      502000 -- (-789.101) [-786.411] (-788.245) (-789.180) * (-786.979) (-786.594) [-783.762] (-787.027) -- 0:00:34
      502500 -- [-788.088] (-785.616) (-784.706) (-785.705) * (-784.274) (-784.483) (-785.391) [-783.631] -- 0:00:34
      503000 -- (-788.774) (-785.495) [-785.087] (-785.278) * [-784.368] (-787.260) (-785.614) (-785.549) -- 0:00:34
      503500 -- [-791.275] (-785.855) (-789.244) (-785.374) * (-786.562) (-784.867) [-783.338] (-785.161) -- 0:00:34
      504000 -- [-787.394] (-792.272) (-786.012) (-785.383) * [-784.388] (-784.875) (-786.798) (-786.142) -- 0:00:34
      504500 -- (-785.084) [-783.767] (-784.927) (-786.267) * (-784.053) (-785.015) (-790.055) [-785.119] -- 0:00:34
      505000 -- (-783.785) (-787.743) (-791.246) [-786.970] * (-786.855) (-783.616) (-787.053) [-784.317] -- 0:00:34

      Average standard deviation of split frequencies: 0.008385

      505500 -- (-784.828) [-784.106] (-785.467) (-784.328) * (-790.366) [-784.778] (-784.928) (-785.167) -- 0:00:34
      506000 -- (-783.803) (-785.176) (-792.301) [-787.949] * [-787.413] (-787.453) (-788.202) (-784.078) -- 0:00:34
      506500 -- (-787.859) (-787.759) (-785.282) [-786.388] * (-784.685) (-785.070) [-787.599] (-785.050) -- 0:00:34
      507000 -- (-786.221) (-784.057) [-785.438] (-790.446) * [-784.956] (-784.090) (-788.867) (-788.020) -- 0:00:34
      507500 -- [-785.878] (-786.393) (-785.427) (-787.136) * (-785.513) [-786.232] (-784.386) (-788.607) -- 0:00:33
      508000 -- (-786.046) (-787.156) [-785.756] (-788.425) * (-785.790) (-785.627) (-789.258) [-786.824] -- 0:00:33
      508500 -- (-785.187) (-787.084) [-787.178] (-784.272) * (-784.898) (-784.764) (-791.646) [-787.041] -- 0:00:34
      509000 -- [-787.448] (-786.727) (-785.342) (-785.741) * (-789.081) [-789.028] (-787.033) (-785.691) -- 0:00:34
      509500 -- (-784.520) (-785.025) [-784.435] (-788.742) * (-786.732) (-785.851) (-786.667) [-786.168] -- 0:00:34
      510000 -- (-785.984) [-784.996] (-786.406) (-784.941) * (-787.557) [-784.715] (-788.879) (-790.182) -- 0:00:34

      Average standard deviation of split frequencies: 0.008077

      510500 -- (-787.657) [-783.813] (-786.907) (-785.727) * (-783.783) (-785.838) (-789.244) [-789.300] -- 0:00:34
      511000 -- (-785.634) [-784.759] (-787.821) (-787.624) * (-786.286) [-784.508] (-785.270) (-785.357) -- 0:00:34
      511500 -- (-786.633) (-785.529) [-787.911] (-786.173) * (-787.025) (-784.426) (-785.491) [-785.892] -- 0:00:34
      512000 -- (-786.747) (-788.516) (-786.308) [-783.877] * [-784.828] (-785.530) (-784.646) (-783.839) -- 0:00:34
      512500 -- (-786.951) (-785.844) (-785.015) [-784.296] * (-786.017) (-787.589) (-784.464) [-786.608] -- 0:00:34
      513000 -- (-791.710) (-784.128) [-785.406] (-784.165) * [-785.399] (-786.585) (-787.318) (-790.528) -- 0:00:34
      513500 -- (-785.094) (-785.915) (-786.084) [-784.003] * (-785.767) [-784.146] (-784.541) (-784.128) -- 0:00:34
      514000 -- (-787.068) (-785.985) [-785.859] (-787.370) * [-784.317] (-784.798) (-784.196) (-784.103) -- 0:00:34
      514500 -- [-783.636] (-784.302) (-787.696) (-789.835) * (-784.001) [-784.720] (-787.542) (-789.151) -- 0:00:33
      515000 -- (-785.406) [-786.600] (-785.688) (-787.039) * [-787.171] (-784.936) (-785.379) (-784.591) -- 0:00:33

      Average standard deviation of split frequencies: 0.007594

      515500 -- [-784.726] (-788.993) (-783.688) (-785.345) * (-790.140) (-784.435) (-787.317) [-783.756] -- 0:00:33
      516000 -- [-785.264] (-785.976) (-788.903) (-785.070) * [-786.616] (-786.665) (-784.904) (-789.051) -- 0:00:33
      516500 -- (-784.724) (-785.604) (-788.852) [-783.637] * (-785.027) [-784.566] (-785.359) (-790.038) -- 0:00:33
      517000 -- (-786.795) (-788.532) (-790.765) [-786.350] * [-785.458] (-785.832) (-788.808) (-788.191) -- 0:00:33
      517500 -- (-787.085) (-789.326) [-787.790] (-784.488) * (-785.430) [-784.753] (-785.566) (-786.149) -- 0:00:33
      518000 -- (-784.777) [-786.160] (-784.480) (-786.654) * (-785.349) [-792.098] (-788.329) (-787.738) -- 0:00:33
      518500 -- (-786.833) (-786.761) (-784.241) [-787.791] * [-784.562] (-786.629) (-785.382) (-784.760) -- 0:00:33
      519000 -- (-788.942) (-787.007) (-784.118) [-787.109] * (-785.346) (-784.928) (-788.235) [-784.614] -- 0:00:33
      519500 -- (-787.087) (-785.064) [-787.341] (-784.868) * (-785.665) (-786.119) [-784.276] (-786.598) -- 0:00:33
      520000 -- [-786.879] (-787.509) (-786.894) (-786.854) * (-785.727) [-784.006] (-783.867) (-785.807) -- 0:00:33

      Average standard deviation of split frequencies: 0.007243

      520500 -- (-786.192) [-786.786] (-786.308) (-786.475) * (-784.854) [-785.570] (-787.846) (-784.779) -- 0:00:33
      521000 -- [-790.973] (-785.074) (-787.221) (-786.925) * (-784.363) (-788.286) (-786.575) [-784.783] -- 0:00:33
      521500 -- [-788.598] (-786.523) (-787.237) (-785.768) * (-784.883) (-785.951) [-787.024] (-783.796) -- 0:00:33
      522000 -- (-788.659) (-786.337) [-785.630] (-787.212) * (-788.968) (-787.961) (-788.472) [-784.638] -- 0:00:32
      522500 -- (-784.159) [-784.950] (-784.270) (-787.476) * (-787.965) (-783.390) [-784.353] (-784.909) -- 0:00:32
      523000 -- (-795.932) [-786.486] (-786.801) (-786.613) * (-784.663) (-786.759) [-783.829] (-785.546) -- 0:00:32
      523500 -- (-784.746) [-785.781] (-788.134) (-785.639) * (-784.036) (-786.021) (-783.652) [-784.186] -- 0:00:32
      524000 -- (-786.664) (-788.511) [-784.417] (-784.021) * [-785.972] (-785.959) (-786.026) (-785.013) -- 0:00:33
      524500 -- (-784.579) (-785.674) (-785.351) [-784.938] * (-784.011) (-784.484) (-787.380) [-784.035] -- 0:00:33
      525000 -- (-784.885) [-786.638] (-786.846) (-784.436) * (-784.076) [-785.574] (-788.207) (-788.341) -- 0:00:33

      Average standard deviation of split frequencies: 0.006722

      525500 -- [-787.872] (-784.777) (-785.561) (-785.065) * (-787.978) [-786.167] (-784.703) (-783.810) -- 0:00:33
      526000 -- (-785.625) (-787.115) (-784.540) [-784.311] * (-784.469) [-784.485] (-785.528) (-786.505) -- 0:00:33
      526500 -- (-784.281) (-787.300) [-784.390] (-789.380) * [-785.404] (-783.273) (-784.779) (-786.176) -- 0:00:33
      527000 -- (-784.179) (-787.853) (-786.056) [-788.380] * (-787.765) (-788.417) (-783.734) [-785.605] -- 0:00:33
      527500 -- (-784.755) (-784.543) (-784.634) [-785.420] * (-787.448) (-785.612) (-784.997) [-784.535] -- 0:00:33
      528000 -- (-788.244) (-785.814) (-789.162) [-787.882] * (-786.197) [-786.292] (-783.800) (-786.031) -- 0:00:33
      528500 -- (-786.389) (-790.106) (-787.491) [-784.591] * (-784.733) (-785.682) [-784.436] (-785.672) -- 0:00:33
      529000 -- (-785.263) (-784.400) (-788.344) [-786.331] * [-787.539] (-784.386) (-786.449) (-785.166) -- 0:00:32
      529500 -- (-789.845) (-783.777) [-784.004] (-787.811) * (-788.313) (-785.670) [-783.997] (-785.407) -- 0:00:32
      530000 -- (-784.352) (-784.234) (-785.645) [-784.285] * (-784.789) (-783.559) [-783.588] (-783.985) -- 0:00:32

      Average standard deviation of split frequencies: 0.006885

      530500 -- (-785.411) [-786.831] (-789.730) (-785.577) * [-785.160] (-789.296) (-785.174) (-784.746) -- 0:00:32
      531000 -- (-784.460) (-788.522) [-791.556] (-786.693) * (-784.943) [-785.143] (-786.837) (-784.853) -- 0:00:32
      531500 -- [-784.140] (-783.848) (-791.756) (-789.473) * (-784.499) [-785.405] (-785.007) (-786.743) -- 0:00:32
      532000 -- (-785.774) [-785.747] (-785.894) (-785.828) * (-787.364) (-785.511) [-784.217] (-789.178) -- 0:00:32
      532500 -- [-785.166] (-785.533) (-786.421) (-786.969) * [-785.895] (-784.763) (-784.260) (-784.450) -- 0:00:32
      533000 -- [-783.337] (-789.131) (-786.558) (-788.368) * [-789.690] (-785.281) (-783.791) (-786.150) -- 0:00:32
      533500 -- [-786.201] (-787.262) (-785.410) (-784.426) * (-788.251) [-784.207] (-784.759) (-787.696) -- 0:00:32
      534000 -- (-786.465) (-789.661) [-787.123] (-785.897) * (-786.284) (-784.816) [-784.230] (-786.043) -- 0:00:32
      534500 -- (-783.573) [-785.501] (-785.485) (-791.407) * (-785.190) (-785.522) (-783.847) [-783.891] -- 0:00:32
      535000 -- (-783.912) (-785.675) [-784.286] (-785.947) * (-787.393) (-787.386) (-783.988) [-786.161] -- 0:00:32

      Average standard deviation of split frequencies: 0.006761

      535500 -- [-784.989] (-787.394) (-783.422) (-784.434) * (-785.180) (-786.249) (-789.203) [-786.000] -- 0:00:32
      536000 -- [-789.021] (-785.111) (-789.884) (-784.640) * (-785.383) [-784.791] (-786.471) (-788.513) -- 0:00:32
      536500 -- (-787.044) (-785.010) (-784.404) [-786.182] * (-784.898) [-785.421] (-783.919) (-787.110) -- 0:00:31
      537000 -- (-788.387) (-785.295) [-783.831] (-786.330) * [-784.838] (-783.532) (-785.238) (-786.856) -- 0:00:31
      537500 -- (-787.688) (-784.950) (-784.413) [-786.038] * (-783.572) (-784.488) (-792.867) [-787.008] -- 0:00:31
      538000 -- (-785.075) [-785.013] (-784.531) (-787.918) * (-783.944) (-783.673) (-786.531) [-785.471] -- 0:00:31
      538500 -- (-785.346) (-783.688) [-783.695] (-787.329) * [-784.307] (-785.892) (-788.162) (-785.964) -- 0:00:32
      539000 -- (-788.042) (-784.649) [-784.410] (-789.971) * (-788.930) (-787.097) [-786.115] (-784.915) -- 0:00:32
      539500 -- [-785.652] (-786.728) (-784.851) (-789.753) * (-787.093) [-784.908] (-786.451) (-783.751) -- 0:00:32
      540000 -- (-788.217) [-786.608] (-785.304) (-789.727) * (-785.685) (-784.261) [-784.080] (-786.074) -- 0:00:32

      Average standard deviation of split frequencies: 0.007139

      540500 -- (-784.437) [-785.083] (-784.387) (-787.182) * (-789.084) [-785.842] (-783.943) (-787.876) -- 0:00:32
      541000 -- [-785.078] (-785.154) (-788.758) (-784.417) * (-785.391) (-785.981) [-785.923] (-788.775) -- 0:00:32
      541500 -- (-790.759) [-783.856] (-786.683) (-789.934) * [-786.092] (-785.446) (-786.241) (-783.527) -- 0:00:32
      542000 -- (-786.751) (-784.908) [-787.058] (-792.521) * (-788.325) (-784.233) [-786.008] (-784.512) -- 0:00:32
      542500 -- (-787.371) (-789.086) (-789.573) [-790.311] * [-786.933] (-784.186) (-784.754) (-784.731) -- 0:00:32
      543000 -- [-784.679] (-790.366) (-786.744) (-787.207) * (-785.149) (-785.713) [-785.706] (-788.354) -- 0:00:31
      543500 -- (-784.626) [-786.582] (-786.472) (-789.743) * (-783.786) (-789.620) [-785.556] (-785.906) -- 0:00:31
      544000 -- (-786.201) (-784.156) [-788.345] (-786.434) * [-783.802] (-785.925) (-786.559) (-786.535) -- 0:00:31
      544500 -- (-785.873) (-784.343) (-786.656) [-790.197] * (-785.665) (-791.443) (-788.390) [-787.579] -- 0:00:31
      545000 -- (-788.889) (-785.117) [-786.316] (-786.186) * [-785.796] (-787.832) (-786.510) (-783.290) -- 0:00:31

      Average standard deviation of split frequencies: 0.006853

      545500 -- (-787.384) [-783.807] (-785.913) (-790.794) * [-785.215] (-786.107) (-785.100) (-786.924) -- 0:00:31
      546000 -- [-789.009] (-783.827) (-786.009) (-791.015) * (-786.466) (-785.271) (-784.893) [-784.636] -- 0:00:31
      546500 -- (-785.432) (-787.853) [-786.533] (-789.670) * (-787.979) (-785.464) [-787.129] (-786.987) -- 0:00:31
      547000 -- (-784.683) (-789.546) (-786.166) [-785.037] * [-784.474] (-784.722) (-786.544) (-785.353) -- 0:00:31
      547500 -- (-787.259) [-787.120] (-786.637) (-788.891) * [-784.766] (-785.101) (-785.322) (-790.149) -- 0:00:31
      548000 -- (-785.446) [-785.185] (-783.901) (-785.016) * (-787.927) (-783.819) [-788.272] (-784.991) -- 0:00:31
      548500 -- (-784.782) [-784.681] (-787.967) (-783.429) * [-786.642] (-784.705) (-787.279) (-784.306) -- 0:00:31
      549000 -- [-784.632] (-786.399) (-784.267) (-796.045) * (-786.895) (-785.891) [-784.647] (-783.765) -- 0:00:31
      549500 -- (-785.009) (-785.484) (-786.189) [-786.616] * (-786.411) (-784.193) (-784.332) [-783.781] -- 0:00:31
      550000 -- [-785.621] (-785.613) (-784.652) (-787.451) * [-788.126] (-786.783) (-786.066) (-792.696) -- 0:00:31

      Average standard deviation of split frequencies: 0.006313

      550500 -- (-784.047) [-784.368] (-787.360) (-785.706) * [-788.049] (-785.020) (-785.636) (-794.239) -- 0:00:31
      551000 -- (-785.284) [-784.519] (-785.330) (-786.335) * [-786.245] (-783.627) (-785.256) (-790.165) -- 0:00:30
      551500 -- (-786.645) (-784.750) (-784.756) [-784.477] * [-784.999] (-783.844) (-788.372) (-785.428) -- 0:00:30
      552000 -- (-784.879) [-784.474] (-789.801) (-784.050) * [-785.119] (-783.512) (-784.714) (-784.552) -- 0:00:30
      552500 -- (-786.644) [-786.670] (-784.892) (-783.997) * (-784.582) (-783.513) [-784.803] (-786.254) -- 0:00:30
      553000 -- (-785.528) (-784.629) [-784.394] (-783.388) * (-785.733) (-783.508) (-783.642) [-787.684] -- 0:00:30
      553500 -- (-785.257) (-786.744) (-786.178) [-786.042] * (-786.284) (-791.548) (-784.378) [-785.563] -- 0:00:30
      554000 -- (-786.182) (-788.389) [-784.171] (-784.348) * [-786.554] (-785.423) (-790.359) (-783.256) -- 0:00:31
      554500 -- [-786.021] (-784.936) (-786.818) (-785.057) * (-785.594) [-786.172] (-787.879) (-784.574) -- 0:00:31
      555000 -- [-785.146] (-784.510) (-790.633) (-784.491) * (-783.666) (-788.241) [-784.480] (-783.769) -- 0:00:31

      Average standard deviation of split frequencies: 0.006677

      555500 -- [-784.394] (-785.490) (-786.461) (-787.551) * (-783.591) (-790.420) [-783.218] (-783.794) -- 0:00:31
      556000 -- [-790.627] (-784.240) (-785.658) (-785.794) * [-788.197] (-786.072) (-786.802) (-786.899) -- 0:00:31
      556500 -- (-785.392) (-786.833) (-785.627) [-786.657] * (-784.541) (-784.606) [-788.815] (-783.782) -- 0:00:31
      557000 -- (-791.106) [-787.740] (-787.230) (-786.541) * (-783.776) (-784.032) [-787.918] (-784.340) -- 0:00:31
      557500 -- [-786.470] (-789.952) (-786.555) (-786.881) * (-785.407) [-785.804] (-785.542) (-784.474) -- 0:00:30
      558000 -- (-786.620) (-787.119) (-784.862) [-788.893] * (-783.838) [-785.150] (-784.329) (-784.096) -- 0:00:30
      558500 -- (-785.965) (-784.664) (-784.582) [-785.652] * (-783.987) [-784.936] (-787.352) (-784.046) -- 0:00:30
      559000 -- [-785.069] (-784.223) (-785.828) (-787.204) * (-785.040) (-786.235) (-783.777) [-785.659] -- 0:00:30
      559500 -- (-789.864) (-784.616) (-786.629) [-789.156] * (-785.981) [-784.192] (-787.853) (-784.257) -- 0:00:30
      560000 -- [-784.268] (-784.942) (-785.163) (-787.409) * [-783.656] (-783.993) (-785.645) (-785.142) -- 0:00:30

      Average standard deviation of split frequencies: 0.006096

      560500 -- (-784.880) (-784.988) [-787.261] (-787.138) * [-783.500] (-787.571) (-786.338) (-787.705) -- 0:00:30
      561000 -- (-786.421) (-785.202) (-787.006) [-784.109] * (-786.422) (-785.103) [-784.674] (-787.599) -- 0:00:30
      561500 -- (-784.085) (-786.138) (-788.835) [-785.909] * (-787.850) (-786.427) (-787.764) [-784.134] -- 0:00:30
      562000 -- (-785.711) (-784.885) (-787.960) [-784.898] * (-787.394) (-786.081) [-785.630] (-784.209) -- 0:00:30
      562500 -- (-785.855) [-783.836] (-783.514) (-785.533) * (-785.690) (-786.282) (-784.936) [-785.130] -- 0:00:30
      563000 -- (-786.108) (-786.360) (-783.456) [-784.961] * (-784.315) [-788.959] (-785.039) (-789.056) -- 0:00:30
      563500 -- [-787.005] (-785.258) (-783.702) (-793.428) * (-785.481) (-787.180) [-784.509] (-785.936) -- 0:00:30
      564000 -- (-786.386) (-784.734) [-784.036] (-784.221) * [-783.771] (-788.025) (-784.312) (-789.705) -- 0:00:30
      564500 -- (-784.872) [-785.781] (-785.314) (-784.696) * (-787.026) (-787.392) [-785.807] (-783.898) -- 0:00:30
      565000 -- (-783.516) (-787.349) [-785.645] (-784.810) * (-785.411) [-784.503] (-786.609) (-787.734) -- 0:00:30

      Average standard deviation of split frequencies: 0.006611

      565500 -- (-783.422) [-786.988] (-786.470) (-784.490) * (-785.378) [-786.161] (-783.271) (-785.489) -- 0:00:29
      566000 -- [-784.041] (-790.574) (-784.038) (-790.854) * (-784.150) (-787.266) [-784.153] (-788.316) -- 0:00:29
      566500 -- (-786.068) [-787.900] (-785.373) (-786.016) * (-785.634) (-784.023) [-784.296] (-786.058) -- 0:00:29
      567000 -- (-789.065) (-786.556) (-786.517) [-786.912] * (-785.544) (-784.770) [-784.627] (-786.179) -- 0:00:29
      567500 -- (-788.888) (-785.879) (-789.042) [-785.273] * (-784.982) [-785.369] (-785.767) (-785.587) -- 0:00:29
      568000 -- (-789.362) (-785.418) (-787.316) [-786.469] * [-786.006] (-786.036) (-785.321) (-785.938) -- 0:00:30
      568500 -- (-790.480) [-786.005] (-787.558) (-783.828) * (-784.685) (-786.769) (-785.365) [-784.920] -- 0:00:30
      569000 -- (-788.949) (-786.211) [-789.457] (-783.684) * (-787.262) [-784.814] (-784.008) (-788.263) -- 0:00:30
      569500 -- (-785.888) (-785.205) (-786.447) [-783.524] * [-785.078] (-784.045) (-784.227) (-786.198) -- 0:00:30
      570000 -- (-785.209) [-787.992] (-786.221) (-783.522) * (-785.286) (-784.725) [-786.025] (-787.079) -- 0:00:30

      Average standard deviation of split frequencies: 0.006195

      570500 -- (-786.374) (-784.461) (-787.750) [-783.590] * (-785.438) (-784.539) [-786.976] (-785.608) -- 0:00:30
      571000 -- (-784.080) (-790.937) [-786.831] (-784.798) * (-784.203) [-784.032] (-787.757) (-788.064) -- 0:00:30
      571500 -- (-788.661) (-786.992) (-789.255) [-786.174] * (-785.066) (-787.470) [-786.956] (-786.715) -- 0:00:29
      572000 -- (-784.606) [-788.576] (-785.932) (-786.716) * [-786.391] (-787.569) (-786.591) (-784.338) -- 0:00:29
      572500 -- (-788.090) [-785.056] (-785.042) (-786.152) * (-784.000) (-785.540) (-787.115) [-783.691] -- 0:00:29
      573000 -- (-789.529) (-785.557) [-785.753] (-784.223) * [-784.254] (-793.011) (-785.681) (-784.429) -- 0:00:29
      573500 -- (-786.072) (-784.861) (-786.876) [-784.651] * (-785.627) [-786.008] (-789.514) (-787.502) -- 0:00:29
      574000 -- [-785.590] (-783.855) (-789.203) (-785.600) * (-784.646) [-783.905] (-788.871) (-786.536) -- 0:00:29
      574500 -- [-784.266] (-785.669) (-786.747) (-785.193) * [-784.734] (-784.510) (-786.975) (-786.951) -- 0:00:29
      575000 -- (-786.153) [-784.440] (-785.173) (-788.290) * (-787.425) [-784.603] (-785.346) (-784.822) -- 0:00:29

      Average standard deviation of split frequencies: 0.006394

      575500 -- [-785.587] (-784.392) (-785.179) (-784.676) * (-788.902) (-785.486) [-787.425] (-783.688) -- 0:00:29
      576000 -- (-784.605) (-787.621) [-784.408] (-786.141) * (-788.362) (-788.027) (-784.774) [-785.033] -- 0:00:29
      576500 -- (-784.217) [-785.714] (-784.936) (-784.895) * [-787.942] (-785.306) (-784.800) (-784.817) -- 0:00:29
      577000 -- (-789.028) (-785.018) (-784.852) [-788.481] * (-788.374) (-784.251) (-784.507) [-784.580] -- 0:00:29
      577500 -- (-788.154) (-786.948) (-787.128) [-783.982] * (-785.499) (-783.809) [-786.275] (-785.364) -- 0:00:29
      578000 -- [-787.737] (-785.365) (-787.898) (-786.916) * (-786.244) (-783.863) (-784.849) [-785.952] -- 0:00:29
      578500 -- (-788.278) [-792.305] (-784.258) (-786.414) * (-784.512) (-784.033) [-789.599] (-784.367) -- 0:00:29
      579000 -- (-786.116) (-788.200) (-787.656) [-787.699] * (-784.902) (-786.332) (-790.196) [-786.957] -- 0:00:29
      579500 -- (-785.510) (-785.445) (-787.115) [-785.338] * (-784.255) (-783.888) (-790.127) [-786.763] -- 0:00:29
      580000 -- (-783.836) [-784.766] (-786.763) (-785.135) * (-783.434) (-786.021) (-790.041) [-784.222] -- 0:00:28

      Average standard deviation of split frequencies: 0.006495

      580500 -- (-784.560) (-785.589) (-787.570) [-787.411] * (-788.280) [-786.685] (-786.180) (-784.894) -- 0:00:28
      581000 -- (-784.464) (-783.852) [-786.296] (-784.368) * (-785.490) (-783.983) [-786.656] (-786.198) -- 0:00:28
      581500 -- (-785.625) [-783.952] (-785.949) (-785.632) * (-783.804) [-784.520] (-785.506) (-785.700) -- 0:00:28
      582000 -- (-784.841) [-783.944] (-787.150) (-784.399) * (-787.287) (-791.415) (-789.570) [-784.381] -- 0:00:28
      582500 -- (-786.584) (-783.649) [-785.182] (-783.409) * (-785.543) [-789.562] (-790.276) (-785.874) -- 0:00:28
      583000 -- (-785.970) (-785.112) [-784.883] (-787.841) * (-784.820) (-787.535) (-784.492) [-784.309] -- 0:00:29
      583500 -- (-784.176) (-783.815) (-784.714) [-789.814] * [-783.744] (-787.817) (-784.936) (-786.160) -- 0:00:29
      584000 -- (-784.575) (-784.413) (-788.013) [-784.585] * [-784.156] (-785.620) (-785.835) (-785.780) -- 0:00:29
      584500 -- (-786.894) [-784.340] (-789.060) (-784.932) * (-784.590) (-785.419) [-784.405] (-787.359) -- 0:00:29
      585000 -- [-784.262] (-784.446) (-785.728) (-785.602) * (-784.799) (-785.222) [-784.685] (-787.507) -- 0:00:29

      Average standard deviation of split frequencies: 0.007666

      585500 -- (-787.702) (-784.362) (-784.908) [-784.986] * (-785.209) (-784.460) [-783.903] (-786.708) -- 0:00:29
      586000 -- (-786.198) [-784.739] (-785.695) (-787.479) * (-783.670) [-785.148] (-785.813) (-786.528) -- 0:00:28
      586500 -- (-785.937) (-785.282) [-783.763] (-784.638) * (-785.858) (-784.550) (-784.789) [-786.344] -- 0:00:28
      587000 -- [-784.468] (-786.120) (-786.703) (-788.797) * (-784.606) (-789.070) (-784.617) [-783.957] -- 0:00:28
      587500 -- (-785.000) (-786.923) (-787.318) [-784.942] * (-786.058) (-784.856) [-785.453] (-787.503) -- 0:00:28
      588000 -- (-786.647) (-786.081) (-791.511) [-784.216] * (-785.100) (-787.679) [-786.650] (-784.031) -- 0:00:28
      588500 -- (-786.202) (-788.059) [-784.801] (-784.410) * (-784.670) (-786.536) [-783.329] (-785.895) -- 0:00:28
      589000 -- (-784.788) (-785.034) (-784.597) [-786.947] * (-783.764) [-789.977] (-786.913) (-786.814) -- 0:00:28
      589500 -- (-785.366) [-783.767] (-783.499) (-784.639) * (-785.164) (-786.920) (-784.914) [-785.129] -- 0:00:28
      590000 -- (-783.973) (-786.232) [-783.383] (-783.883) * (-786.821) (-793.203) (-784.242) [-783.781] -- 0:00:28

      Average standard deviation of split frequencies: 0.007183

      590500 -- (-786.315) (-785.958) (-785.264) [-784.462] * (-785.137) (-784.491) [-786.535] (-785.733) -- 0:00:28
      591000 -- (-785.776) (-786.064) [-788.569] (-783.610) * (-787.348) [-785.711] (-787.029) (-787.847) -- 0:00:28
      591500 -- (-785.953) (-786.285) (-786.273) [-785.126] * (-787.574) (-785.180) [-786.539] (-784.859) -- 0:00:28
      592000 -- (-786.496) (-785.588) [-785.116] (-787.843) * [-784.726] (-785.589) (-785.315) (-784.306) -- 0:00:28
      592500 -- (-785.162) [-786.528] (-790.757) (-785.356) * (-784.403) (-790.723) [-786.127] (-785.534) -- 0:00:28
      593000 -- (-785.605) (-786.985) [-786.709] (-785.421) * (-787.779) (-785.353) (-785.890) [-786.830] -- 0:00:28
      593500 -- (-788.272) (-784.467) (-784.372) [-786.481] * [-785.335] (-786.913) (-785.320) (-786.686) -- 0:00:28
      594000 -- [-785.684] (-788.634) (-784.293) (-788.110) * [-786.243] (-787.660) (-789.796) (-785.224) -- 0:00:28
      594500 -- [-783.750] (-788.552) (-785.742) (-787.316) * (-784.810) [-787.449] (-786.454) (-785.326) -- 0:00:27
      595000 -- (-785.029) (-786.646) (-785.906) [-787.239] * [-783.882] (-785.301) (-787.386) (-791.289) -- 0:00:27

      Average standard deviation of split frequencies: 0.007956

      595500 -- [-784.030] (-784.251) (-785.891) (-784.321) * (-791.954) (-786.141) (-785.893) [-786.370] -- 0:00:27
      596000 -- (-786.704) [-785.406] (-787.948) (-783.294) * (-784.995) [-787.171] (-785.901) (-787.906) -- 0:00:27
      596500 -- (-785.291) [-786.835] (-785.509) (-783.907) * (-784.921) [-784.232] (-784.127) (-783.509) -- 0:00:27
      597000 -- (-792.690) (-786.969) [-784.382] (-784.177) * [-785.125] (-785.239) (-784.327) (-783.665) -- 0:00:27
      597500 -- (-784.504) (-786.123) (-786.763) [-784.366] * [-784.805] (-786.091) (-789.466) (-783.958) -- 0:00:27
      598000 -- [-783.560] (-786.248) (-785.300) (-787.777) * [-785.114] (-784.919) (-788.253) (-787.515) -- 0:00:28
      598500 -- (-784.206) [-784.071] (-784.735) (-784.651) * (-788.902) (-785.557) [-785.034] (-791.112) -- 0:00:28
      599000 -- [-785.228] (-785.751) (-784.558) (-789.681) * (-789.965) (-784.860) [-788.265] (-784.034) -- 0:00:28
      599500 -- (-784.044) (-787.695) [-786.024] (-785.406) * (-784.393) (-784.353) (-786.566) [-786.127] -- 0:00:28
      600000 -- (-784.179) (-788.387) (-788.097) [-789.480] * (-786.222) (-788.067) [-785.183] (-788.250) -- 0:00:27

      Average standard deviation of split frequencies: 0.007995

      600500 -- (-784.446) (-784.627) (-784.377) [-785.863] * (-786.042) [-788.016] (-787.910) (-784.670) -- 0:00:27
      601000 -- [-783.895] (-783.578) (-784.417) (-788.174) * (-783.728) (-790.775) [-786.682] (-785.065) -- 0:00:27
      601500 -- (-784.759) (-783.777) (-786.505) [-785.645] * (-787.534) (-785.451) [-784.650] (-787.886) -- 0:00:27
      602000 -- (-784.689) (-784.356) [-784.434] (-784.628) * (-789.539) (-785.558) [-785.228] (-786.632) -- 0:00:27
      602500 -- (-785.472) (-787.378) [-783.371] (-785.979) * [-784.163] (-785.711) (-784.738) (-789.542) -- 0:00:27
      603000 -- (-786.862) [-784.195] (-786.632) (-784.048) * (-786.284) (-785.780) (-785.432) [-787.799] -- 0:00:27
      603500 -- (-784.345) (-786.600) (-784.372) [-785.929] * (-784.569) (-785.065) (-786.995) [-785.758] -- 0:00:27
      604000 -- (-787.439) (-784.015) [-785.125] (-784.884) * [-784.009] (-784.297) (-785.192) (-784.276) -- 0:00:27
      604500 -- (-785.579) [-784.373] (-784.623) (-784.847) * (-789.637) (-785.911) [-787.482] (-784.662) -- 0:00:27
      605000 -- (-784.416) [-786.807] (-785.187) (-784.736) * (-784.983) [-785.716] (-787.439) (-784.637) -- 0:00:27

      Average standard deviation of split frequencies: 0.007973

      605500 -- [-785.398] (-785.999) (-784.444) (-785.743) * [-784.842] (-786.426) (-786.087) (-784.725) -- 0:00:27
      606000 -- [-784.576] (-785.157) (-784.870) (-786.586) * (-785.313) (-787.241) [-784.073] (-784.683) -- 0:00:27
      606500 -- (-785.764) (-785.998) (-784.567) [-784.593] * (-788.277) [-786.211] (-784.899) (-785.643) -- 0:00:27
      607000 -- (-784.902) (-785.451) (-788.525) [-783.595] * (-784.962) (-784.809) (-783.899) [-788.869] -- 0:00:27
      607500 -- (-786.988) (-789.371) (-788.096) [-784.257] * (-787.325) [-785.559] (-783.807) (-788.593) -- 0:00:27
      608000 -- (-786.982) (-785.124) [-786.422] (-786.574) * (-786.520) (-783.915) [-787.726] (-787.200) -- 0:00:27
      608500 -- (-791.992) (-785.100) [-784.383] (-785.529) * [-785.895] (-784.462) (-786.121) (-783.695) -- 0:00:27
      609000 -- [-785.612] (-784.196) (-787.648) (-788.292) * (-787.372) [-784.798] (-785.567) (-788.702) -- 0:00:26
      609500 -- (-787.248) [-786.684] (-789.332) (-784.924) * (-786.741) (-784.617) [-784.782] (-786.374) -- 0:00:26
      610000 -- [-784.948] (-785.458) (-786.451) (-785.809) * [-785.146] (-788.041) (-784.661) (-786.585) -- 0:00:26

      Average standard deviation of split frequencies: 0.008298

      610500 -- [-786.069] (-786.394) (-786.150) (-783.920) * (-786.684) (-785.057) [-786.196] (-786.323) -- 0:00:26
      611000 -- (-785.935) (-785.634) (-785.576) [-786.218] * (-784.097) [-784.430] (-785.142) (-784.037) -- 0:00:26
      611500 -- (-785.821) (-784.142) (-788.387) [-791.563] * [-784.843] (-786.038) (-787.034) (-785.407) -- 0:00:26
      612000 -- (-786.575) [-784.599] (-787.610) (-788.860) * (-785.035) [-784.669] (-787.612) (-788.737) -- 0:00:26
      612500 -- (-785.791) (-786.316) [-785.511] (-786.807) * (-785.655) [-783.930] (-785.544) (-786.845) -- 0:00:26
      613000 -- [-784.466] (-784.332) (-784.546) (-785.229) * (-788.067) (-786.765) (-784.720) [-786.372] -- 0:00:27
      613500 -- (-784.746) (-785.921) (-783.412) [-786.074] * (-783.575) [-787.064] (-784.472) (-789.333) -- 0:00:27
      614000 -- (-786.938) (-784.473) (-790.264) [-784.994] * (-783.750) (-787.771) [-783.329] (-788.756) -- 0:00:27
      614500 -- (-788.448) [-785.412] (-788.002) (-785.282) * (-783.763) (-787.416) [-785.037] (-785.462) -- 0:00:26
      615000 -- (-786.113) (-786.491) (-784.986) [-783.891] * (-786.963) (-785.103) [-785.282] (-783.746) -- 0:00:26

      Average standard deviation of split frequencies: 0.007940

      615500 -- (-786.747) (-784.909) (-786.124) [-787.026] * (-784.374) (-784.517) [-784.134] (-786.116) -- 0:00:26
      616000 -- (-785.245) (-788.119) [-787.934] (-787.559) * (-787.194) [-784.370] (-783.311) (-786.266) -- 0:00:26
      616500 -- (-784.084) (-785.679) (-789.344) [-784.265] * (-785.154) (-784.165) [-783.547] (-785.941) -- 0:00:26
      617000 -- (-785.573) (-789.067) [-784.178] (-784.654) * [-788.494] (-785.977) (-785.572) (-785.138) -- 0:00:26
      617500 -- (-789.616) (-789.092) (-783.588) [-783.700] * (-794.815) [-788.007] (-786.493) (-786.663) -- 0:00:26
      618000 -- (-790.818) (-784.283) (-785.758) [-783.700] * (-791.992) [-787.005] (-783.993) (-783.981) -- 0:00:26
      618500 -- (-786.382) [-786.205] (-790.709) (-785.793) * (-785.688) [-784.498] (-784.204) (-783.489) -- 0:00:26
      619000 -- (-784.361) [-787.914] (-790.522) (-784.313) * (-784.093) [-785.441] (-784.086) (-786.457) -- 0:00:26
      619500 -- [-788.359] (-788.446) (-789.827) (-784.650) * (-784.916) (-784.769) [-783.803] (-788.291) -- 0:00:26
      620000 -- (-785.612) [-784.086] (-784.297) (-784.816) * (-785.418) (-788.669) [-785.048] (-786.621) -- 0:00:26

      Average standard deviation of split frequencies: 0.008712

      620500 -- [-785.072] (-783.927) (-786.901) (-786.051) * [-784.714] (-785.613) (-787.694) (-787.605) -- 0:00:26
      621000 -- (-787.657) [-785.793] (-784.951) (-789.370) * (-784.299) [-788.094] (-785.604) (-786.682) -- 0:00:26
      621500 -- (-784.827) (-787.082) [-788.190] (-785.175) * (-785.019) [-786.048] (-787.033) (-784.363) -- 0:00:26
      622000 -- (-784.252) [-787.752] (-785.678) (-784.075) * (-785.726) (-783.673) (-784.907) [-784.676] -- 0:00:26
      622500 -- (-787.473) [-785.394] (-786.061) (-784.808) * [-785.504] (-785.369) (-784.596) (-788.446) -- 0:00:26
      623000 -- [-783.978] (-784.857) (-786.539) (-785.234) * (-787.122) (-789.034) [-784.564] (-786.650) -- 0:00:26
      623500 -- (-784.415) (-785.138) [-785.162] (-785.377) * [-786.572] (-787.286) (-788.895) (-788.821) -- 0:00:25
      624000 -- (-784.632) (-784.808) (-783.897) [-784.262] * (-785.635) [-785.617] (-785.485) (-784.771) -- 0:00:25
      624500 -- (-784.203) (-784.950) (-784.305) [-784.582] * (-787.043) (-792.171) (-786.184) [-785.304] -- 0:00:25
      625000 -- [-784.198] (-785.162) (-784.023) (-785.915) * (-785.228) [-786.019] (-785.815) (-785.628) -- 0:00:25

      Average standard deviation of split frequencies: 0.008372

      625500 -- [-791.524] (-784.391) (-786.458) (-787.544) * (-785.184) [-783.621] (-787.177) (-784.118) -- 0:00:25
      626000 -- (-784.859) [-784.297] (-791.953) (-783.683) * (-785.577) [-784.369] (-791.880) (-787.176) -- 0:00:25
      626500 -- [-784.551] (-783.907) (-791.323) (-784.507) * [-784.366] (-786.503) (-786.044) (-784.256) -- 0:00:25
      627000 -- (-785.846) (-784.362) (-788.368) [-784.168] * (-786.836) (-785.017) [-786.239] (-785.285) -- 0:00:25
      627500 -- (-787.919) [-785.699] (-787.575) (-783.660) * (-787.350) [-785.411] (-784.538) (-788.462) -- 0:00:25
      628000 -- [-783.683] (-786.354) (-783.738) (-786.215) * (-791.557) [-786.750] (-787.006) (-785.112) -- 0:00:26
      628500 -- (-785.108) (-786.946) (-783.223) [-785.158] * [-790.235] (-787.285) (-786.524) (-784.950) -- 0:00:26
      629000 -- (-787.332) (-787.678) [-784.572] (-789.401) * [-786.001] (-797.144) (-787.024) (-785.484) -- 0:00:25
      629500 -- (-790.068) (-786.784) [-785.084] (-786.801) * [-787.084] (-790.008) (-784.484) (-787.307) -- 0:00:25
      630000 -- [-784.313] (-785.116) (-784.145) (-790.262) * (-785.463) (-787.919) (-785.379) [-783.655] -- 0:00:25

      Average standard deviation of split frequencies: 0.008574

      630500 -- (-784.405) (-783.655) [-788.572] (-787.955) * (-786.452) (-786.988) [-784.437] (-786.312) -- 0:00:25
      631000 -- (-789.770) (-785.185) [-783.782] (-786.103) * (-786.356) (-785.381) (-786.044) [-787.383] -- 0:00:25
      631500 -- [-786.213] (-783.407) (-786.190) (-787.591) * [-786.205] (-784.589) (-784.152) (-785.467) -- 0:00:25
      632000 -- (-786.811) [-784.579] (-785.620) (-785.663) * (-783.663) [-784.567] (-784.262) (-786.072) -- 0:00:25
      632500 -- (-788.609) (-784.943) (-784.489) [-785.792] * (-785.921) (-785.002) (-784.873) [-784.595] -- 0:00:25
      633000 -- (-789.252) (-784.344) [-784.258] (-789.163) * (-786.635) (-785.353) (-784.957) [-785.056] -- 0:00:25
      633500 -- (-788.198) (-784.501) (-785.017) [-787.781] * (-784.246) (-785.203) [-784.140] (-783.925) -- 0:00:25
      634000 -- (-789.521) (-786.313) [-783.434] (-790.063) * (-785.066) (-787.730) (-784.140) [-783.996] -- 0:00:25
      634500 -- [-785.142] (-785.613) (-783.462) (-783.649) * (-785.185) [-785.782] (-786.252) (-784.919) -- 0:00:25
      635000 -- (-785.893) (-784.536) (-783.768) [-786.869] * (-784.368) [-785.578] (-787.408) (-785.468) -- 0:00:25

      Average standard deviation of split frequencies: 0.007783

      635500 -- (-788.409) (-785.253) (-785.345) [-786.513] * [-785.109] (-784.446) (-789.503) (-785.006) -- 0:00:25
      636000 -- (-784.919) (-785.152) [-785.027] (-783.427) * (-783.976) (-786.166) (-787.703) [-784.835] -- 0:00:25
      636500 -- (-787.768) [-787.158] (-785.570) (-784.243) * (-784.111) [-784.730] (-784.400) (-786.891) -- 0:00:25
      637000 -- (-785.119) (-784.320) [-785.224] (-785.703) * (-786.217) (-785.838) (-783.235) [-788.602] -- 0:00:25
      637500 -- (-785.504) [-788.378] (-786.553) (-786.529) * (-786.229) (-786.050) (-785.767) [-784.978] -- 0:00:25
      638000 -- (-785.597) [-785.206] (-784.484) (-783.971) * [-786.824] (-789.742) (-786.233) (-788.696) -- 0:00:24
      638500 -- (-784.646) (-786.991) [-784.153] (-783.794) * (-789.061) (-785.449) (-784.039) [-784.804] -- 0:00:24
      639000 -- (-784.144) (-785.616) [-784.345] (-790.155) * (-788.404) (-788.275) (-785.334) [-784.524] -- 0:00:24
      639500 -- (-789.078) (-786.952) [-784.414] (-784.665) * (-789.504) (-783.911) (-786.040) [-784.979] -- 0:00:24
      640000 -- (-786.360) (-784.593) [-784.904] (-784.009) * [-788.339] (-787.664) (-785.226) (-785.085) -- 0:00:24

      Average standard deviation of split frequencies: 0.008140

      640500 -- (-783.927) [-785.613] (-786.661) (-785.202) * [-785.289] (-788.970) (-786.125) (-784.994) -- 0:00:24
      641000 -- (-785.769) [-783.795] (-786.661) (-785.087) * [-785.886] (-787.752) (-787.271) (-784.784) -- 0:00:24
      641500 -- (-784.277) (-787.554) (-786.185) [-787.474] * (-784.302) (-790.161) [-790.360] (-789.453) -- 0:00:24
      642000 -- [-783.951] (-784.504) (-786.633) (-787.662) * (-784.765) (-787.883) [-784.891] (-787.883) -- 0:00:24
      642500 -- [-787.732] (-785.694) (-786.775) (-785.444) * [-784.050] (-790.552) (-785.010) (-786.702) -- 0:00:24
      643000 -- (-788.920) (-784.904) (-789.035) [-785.163] * (-784.547) (-784.916) (-785.282) [-788.347] -- 0:00:24
      643500 -- (-785.917) [-785.049] (-790.227) (-783.921) * [-783.640] (-786.518) (-785.782) (-788.299) -- 0:00:24
      644000 -- (-785.425) [-789.390] (-785.447) (-789.002) * [-784.108] (-786.446) (-786.232) (-785.143) -- 0:00:24
      644500 -- (-789.098) (-783.900) [-785.547] (-787.839) * (-785.031) (-785.482) [-784.192] (-787.452) -- 0:00:24
      645000 -- [-786.582] (-784.080) (-785.207) (-784.427) * (-786.613) [-784.654] (-784.026) (-783.915) -- 0:00:24

      Average standard deviation of split frequencies: 0.008848

      645500 -- (-785.842) (-784.180) (-787.165) [-785.466] * [-787.171] (-783.953) (-783.861) (-785.366) -- 0:00:24
      646000 -- (-785.110) (-789.663) (-792.038) [-784.816] * (-783.763) (-788.053) [-783.625] (-784.064) -- 0:00:24
      646500 -- (-788.095) (-784.799) (-791.465) [-785.333] * (-788.116) [-785.301] (-784.482) (-784.608) -- 0:00:24
      647000 -- (-785.792) (-788.725) [-784.405] (-785.118) * (-786.594) (-784.828) (-785.164) [-784.433] -- 0:00:24
      647500 -- (-786.221) (-791.955) [-785.304] (-785.803) * (-786.935) [-785.090] (-787.159) (-788.142) -- 0:00:24
      648000 -- (-787.235) (-785.618) [-785.445] (-785.032) * [-784.909] (-786.543) (-786.231) (-784.616) -- 0:00:24
      648500 -- (-788.020) [-784.628] (-789.146) (-785.182) * (-786.538) (-785.032) (-784.745) [-784.222] -- 0:00:24
      649000 -- (-785.115) (-785.859) [-785.469] (-787.118) * (-785.374) (-784.506) [-786.270] (-784.143) -- 0:00:24
      649500 -- [-784.804] (-790.893) (-785.640) (-785.523) * (-784.327) [-785.603] (-783.996) (-783.585) -- 0:00:24
      650000 -- [-789.296] (-791.856) (-785.180) (-786.090) * [-787.271] (-787.429) (-788.738) (-786.004) -- 0:00:24

      Average standard deviation of split frequencies: 0.008558

      650500 -- [-788.532] (-788.921) (-785.453) (-784.357) * (-784.354) (-785.333) (-784.187) [-788.638] -- 0:00:24
      651000 -- [-784.038] (-793.423) (-787.973) (-784.401) * (-785.282) (-784.784) (-786.887) [-786.328] -- 0:00:24
      651500 -- (-791.513) (-790.432) [-783.766] (-783.676) * (-784.638) [-790.381] (-786.063) (-784.017) -- 0:00:24
      652000 -- (-784.057) [-786.425] (-785.588) (-786.094) * (-784.646) (-786.586) [-786.893] (-783.886) -- 0:00:24
      652500 -- [-784.658] (-784.833) (-784.993) (-785.697) * (-785.347) [-787.191] (-785.771) (-791.429) -- 0:00:23
      653000 -- (-785.438) (-785.317) (-784.418) [-783.584] * (-786.035) (-789.860) (-788.191) [-784.895] -- 0:00:23
      653500 -- (-787.906) (-784.075) (-785.581) [-787.455] * (-788.338) (-784.217) [-783.417] (-786.796) -- 0:00:23
      654000 -- [-785.185] (-784.391) (-788.105) (-784.724) * (-786.152) [-788.119] (-785.058) (-785.579) -- 0:00:23
      654500 -- (-784.712) (-783.991) (-788.277) [-785.177] * [-785.479] (-786.192) (-784.437) (-784.261) -- 0:00:23
      655000 -- [-787.899] (-784.205) (-790.529) (-785.495) * (-785.889) (-785.505) [-784.430] (-785.577) -- 0:00:23

      Average standard deviation of split frequencies: 0.008713

      655500 -- [-785.269] (-784.209) (-785.893) (-786.991) * (-786.775) (-784.067) (-784.319) [-786.392] -- 0:00:23
      656000 -- [-784.402] (-785.593) (-786.142) (-789.073) * (-787.142) (-784.061) (-785.932) [-787.174] -- 0:00:23
      656500 -- (-784.446) (-785.689) (-787.548) [-790.151] * [-786.008] (-784.207) (-785.781) (-784.397) -- 0:00:23
      657000 -- (-784.505) [-783.556] (-783.654) (-786.793) * (-784.783) [-784.519] (-786.585) (-786.354) -- 0:00:23
      657500 -- (-785.004) (-783.488) (-784.240) [-786.444] * (-785.745) (-784.877) [-785.156] (-789.013) -- 0:00:23
      658000 -- (-785.161) (-785.091) (-784.834) [-787.792] * (-787.300) [-785.854] (-785.821) (-785.011) -- 0:00:23
      658500 -- (-784.880) (-783.840) (-785.117) [-786.604] * [-786.185] (-785.359) (-785.606) (-784.095) -- 0:00:23
      659000 -- (-784.692) (-785.500) [-784.690] (-786.828) * (-784.763) (-788.422) [-785.634] (-785.219) -- 0:00:23
      659500 -- (-785.540) (-787.425) [-786.509] (-785.542) * (-785.827) (-784.174) (-784.644) [-783.523] -- 0:00:23
      660000 -- (-785.559) (-783.853) (-785.930) [-784.565] * [-785.420] (-788.615) (-785.217) (-786.073) -- 0:00:23

      Average standard deviation of split frequencies: 0.009444

      660500 -- (-786.396) (-784.163) (-786.250) [-785.584] * [-785.340] (-788.556) (-784.843) (-785.946) -- 0:00:23
      661000 -- (-786.763) (-787.504) (-786.017) [-787.963] * [-785.517] (-784.417) (-785.666) (-787.425) -- 0:00:23
      661500 -- (-790.103) (-784.562) (-787.990) [-788.617] * (-790.517) (-785.697) [-783.826] (-785.247) -- 0:00:23
      662000 -- [-784.965] (-786.364) (-786.792) (-789.424) * [-789.116] (-784.979) (-785.262) (-786.783) -- 0:00:23
      662500 -- (-789.429) (-783.879) (-790.246) [-783.778] * (-787.348) [-785.518] (-787.993) (-789.825) -- 0:00:23
      663000 -- (-786.509) (-785.210) [-784.598] (-784.788) * [-786.325] (-784.776) (-788.434) (-786.974) -- 0:00:23
      663500 -- (-785.965) [-783.593] (-791.107) (-785.611) * (-784.476) (-788.907) (-791.358) [-787.067] -- 0:00:23
      664000 -- (-788.424) [-783.456] (-784.509) (-784.753) * [-784.193] (-785.773) (-787.253) (-785.124) -- 0:00:23
      664500 -- (-785.470) [-783.402] (-786.045) (-786.914) * (-788.020) [-785.567] (-786.028) (-785.630) -- 0:00:23
      665000 -- (-787.984) [-785.863] (-784.199) (-786.820) * (-785.027) (-784.398) [-785.218] (-784.750) -- 0:00:23

      Average standard deviation of split frequencies: 0.009535

      665500 -- (-787.347) [-784.645] (-786.047) (-785.416) * (-785.464) [-784.991] (-785.200) (-784.117) -- 0:00:23
      666000 -- [-784.563] (-785.703) (-785.070) (-787.011) * (-785.642) (-786.347) (-788.155) [-784.077] -- 0:00:23
      666500 -- (-786.147) (-787.087) [-784.492] (-790.289) * (-789.351) (-787.316) (-788.659) [-784.272] -- 0:00:23
      667000 -- (-783.490) (-789.249) [-783.692] (-784.100) * (-786.292) [-787.505] (-788.367) (-785.771) -- 0:00:22
      667500 -- (-784.487) [-789.711] (-783.898) (-786.290) * (-784.537) (-784.398) [-783.889] (-785.337) -- 0:00:22
      668000 -- (-785.707) (-784.875) (-785.278) [-784.392] * (-785.351) [-785.537] (-784.780) (-784.353) -- 0:00:22
      668500 -- [-787.985] (-786.086) (-787.261) (-785.411) * [-785.847] (-784.461) (-787.484) (-787.505) -- 0:00:22
      669000 -- (-788.979) (-788.009) (-786.902) [-784.959] * (-785.600) [-784.050] (-787.758) (-786.308) -- 0:00:22
      669500 -- (-787.049) [-787.447] (-789.555) (-783.535) * [-786.813] (-784.934) (-789.159) (-783.689) -- 0:00:22
      670000 -- [-783.668] (-788.667) (-784.657) (-783.718) * [-785.380] (-786.944) (-786.071) (-784.691) -- 0:00:22

      Average standard deviation of split frequencies: 0.008874

      670500 -- (-785.732) [-787.585] (-784.462) (-787.536) * [-784.866] (-784.583) (-785.108) (-786.034) -- 0:00:22
      671000 -- (-787.760) (-786.595) (-784.375) [-788.228] * (-786.411) (-785.218) (-789.330) [-784.483] -- 0:00:22
      671500 -- (-787.649) [-786.877] (-787.731) (-784.573) * [-784.013] (-785.980) (-789.737) (-784.720) -- 0:00:22
      672000 -- (-786.359) [-786.986] (-785.257) (-785.184) * (-784.377) (-791.838) [-784.830] (-784.993) -- 0:00:22
      672500 -- (-784.380) (-784.650) [-785.172] (-789.533) * (-784.341) [-790.752] (-792.839) (-788.636) -- 0:00:22
      673000 -- [-785.485] (-783.941) (-784.923) (-788.264) * [-787.967] (-786.212) (-790.485) (-785.684) -- 0:00:22
      673500 -- (-784.062) (-784.053) [-784.597] (-788.692) * (-786.020) [-787.929] (-790.633) (-785.275) -- 0:00:22
      674000 -- [-787.152] (-783.759) (-784.616) (-784.943) * (-790.831) [-787.023] (-789.438) (-784.519) -- 0:00:22
      674500 -- (-786.927) (-785.132) [-784.780] (-785.596) * (-785.479) (-783.968) [-788.195] (-789.082) -- 0:00:22
      675000 -- [-784.407] (-785.857) (-784.319) (-786.218) * [-786.649] (-784.272) (-784.336) (-784.507) -- 0:00:22

      Average standard deviation of split frequencies: 0.009545

      675500 -- (-786.055) [-783.830] (-787.281) (-786.062) * (-785.323) (-785.815) [-786.388] (-784.446) -- 0:00:22
      676000 -- [-786.741] (-785.471) (-784.965) (-784.458) * (-784.448) (-787.037) (-785.538) [-785.518] -- 0:00:22
      676500 -- (-786.507) (-784.174) [-785.431] (-784.183) * (-785.397) (-784.834) [-786.259] (-786.015) -- 0:00:22
      677000 -- (-790.313) [-784.489] (-783.525) (-784.379) * (-787.166) (-783.342) [-788.012] (-791.096) -- 0:00:22
      677500 -- (-787.266) (-790.975) [-784.125] (-785.437) * [-786.742] (-784.142) (-789.057) (-788.192) -- 0:00:22
      678000 -- (-788.882) (-787.657) (-784.391) [-784.069] * [-785.935] (-786.456) (-785.008) (-790.060) -- 0:00:22
      678500 -- (-785.834) (-784.579) [-785.115] (-783.930) * (-786.902) [-785.881] (-784.311) (-789.507) -- 0:00:22
      679000 -- (-785.129) (-786.428) [-785.354] (-784.180) * (-784.750) (-785.884) (-787.851) [-784.954] -- 0:00:22
      679500 -- [-786.535] (-787.298) (-786.568) (-787.666) * (-783.953) [-786.148] (-786.102) (-786.674) -- 0:00:22
      680000 -- (-785.076) [-790.769] (-787.145) (-784.950) * (-784.072) (-788.089) [-784.643] (-789.956) -- 0:00:22

      Average standard deviation of split frequencies: 0.009350

      680500 -- (-784.900) (-786.205) (-788.818) [-784.399] * [-785.291] (-787.096) (-785.139) (-784.394) -- 0:00:22
      681000 -- (-786.869) (-786.984) [-784.206] (-784.166) * (-786.447) (-784.958) (-786.414) [-783.351] -- 0:00:22
      681500 -- (-785.110) (-787.795) (-788.666) [-783.795] * (-786.479) (-786.962) [-784.329] (-786.915) -- 0:00:21
      682000 -- (-784.876) [-784.406] (-788.368) (-783.794) * (-784.056) (-785.220) [-786.693] (-789.895) -- 0:00:21
      682500 -- (-786.632) [-786.746] (-786.792) (-785.054) * (-784.392) (-786.460) (-785.102) [-785.873] -- 0:00:21
      683000 -- (-783.765) (-792.319) (-784.831) [-784.856] * (-786.127) (-785.448) (-788.323) [-786.387] -- 0:00:21
      683500 -- (-783.555) (-787.450) (-786.581) [-783.625] * [-787.248] (-785.185) (-786.327) (-788.612) -- 0:00:21
      684000 -- (-783.791) (-786.425) (-783.362) [-784.924] * [-784.091] (-787.001) (-784.485) (-783.762) -- 0:00:21
      684500 -- (-784.408) (-784.307) (-784.857) [-784.439] * (-785.614) (-789.584) (-785.675) [-786.817] -- 0:00:21
      685000 -- (-785.797) (-783.785) (-785.469) [-784.821] * [-788.565] (-784.848) (-787.433) (-786.202) -- 0:00:21

      Average standard deviation of split frequencies: 0.008976

      685500 -- (-788.875) (-783.581) (-785.267) [-783.709] * (-790.905) [-784.600] (-784.483) (-791.832) -- 0:00:21
      686000 -- (-783.491) (-785.814) (-785.236) [-784.699] * (-786.778) (-785.254) (-785.113) [-784.114] -- 0:00:21
      686500 -- (-783.949) [-785.538] (-784.964) (-785.305) * (-783.979) (-787.451) (-786.732) [-783.970] -- 0:00:21
      687000 -- (-784.550) [-786.377] (-785.015) (-784.905) * (-783.719) (-786.734) [-786.343] (-785.976) -- 0:00:21
      687500 -- (-785.283) (-787.246) (-785.398) [-785.715] * (-785.163) (-790.687) [-784.051] (-785.408) -- 0:00:21
      688000 -- (-784.480) (-784.528) [-785.828] (-784.268) * (-787.752) (-784.677) (-788.137) [-784.653] -- 0:00:21
      688500 -- (-784.463) (-784.625) [-785.642] (-789.756) * [-787.830] (-783.446) (-787.932) (-786.502) -- 0:00:21
      689000 -- [-785.304] (-783.288) (-783.919) (-786.589) * (-787.058) (-785.431) [-786.893] (-784.154) -- 0:00:21
      689500 -- (-785.996) (-784.124) [-784.289] (-789.609) * (-786.163) (-786.087) (-787.170) [-784.641] -- 0:00:21
      690000 -- (-792.806) [-786.558] (-784.473) (-791.032) * [-785.461] (-786.395) (-785.187) (-783.492) -- 0:00:21

      Average standard deviation of split frequencies: 0.008617

      690500 -- (-786.521) (-783.809) (-784.285) [-786.870] * (-785.188) (-786.794) [-786.395] (-790.060) -- 0:00:21
      691000 -- (-797.972) (-783.915) [-784.144] (-789.336) * (-785.604) (-784.554) [-787.865] (-788.974) -- 0:00:21
      691500 -- (-789.395) (-783.773) (-787.601) [-784.031] * (-787.724) (-789.461) (-785.401) [-785.070] -- 0:00:21
      692000 -- [-786.555] (-785.449) (-785.276) (-784.523) * (-783.905) (-787.822) (-783.611) [-786.333] -- 0:00:21
      692500 -- (-787.437) (-784.429) [-785.419] (-786.710) * (-785.607) (-784.420) [-784.130] (-787.958) -- 0:00:21
      693000 -- [-785.175] (-785.927) (-784.012) (-789.273) * (-786.617) (-785.269) (-783.618) [-785.005] -- 0:00:21
      693500 -- (-784.319) [-783.919] (-784.166) (-788.798) * (-785.239) (-784.849) (-784.762) [-784.149] -- 0:00:21
      694000 -- (-784.444) (-785.679) [-783.839] (-784.989) * [-787.782] (-785.600) (-787.467) (-785.469) -- 0:00:21
      694500 -- (-785.265) [-783.982] (-785.003) (-785.332) * (-785.217) (-786.516) (-786.731) [-788.037] -- 0:00:21
      695000 -- [-786.725] (-785.783) (-785.172) (-785.047) * (-784.800) (-784.875) [-785.405] (-786.178) -- 0:00:21

      Average standard deviation of split frequencies: 0.008551

      695500 -- (-786.350) [-784.075] (-784.056) (-786.011) * (-785.564) [-786.039] (-787.823) (-787.232) -- 0:00:21
      696000 -- (-788.202) (-783.538) [-784.544] (-784.116) * (-789.348) (-784.440) (-785.513) [-784.089] -- 0:00:20
      696500 -- (-786.749) [-784.800] (-789.425) (-787.413) * (-787.425) (-784.928) [-784.917] (-786.684) -- 0:00:20
      697000 -- [-785.431] (-784.576) (-786.681) (-784.918) * [-786.570] (-784.099) (-785.183) (-785.995) -- 0:00:20
      697500 -- (-786.998) [-786.036] (-784.388) (-784.344) * (-787.582) [-784.751] (-785.864) (-787.199) -- 0:00:20
      698000 -- (-787.130) [-787.496] (-789.854) (-784.956) * [-785.603] (-783.603) (-789.176) (-784.323) -- 0:00:20
      698500 -- [-787.811] (-786.721) (-785.756) (-786.166) * [-784.810] (-785.719) (-788.790) (-787.570) -- 0:00:20
      699000 -- (-787.505) (-788.091) (-785.512) [-786.255] * (-787.651) (-787.076) [-785.171] (-786.541) -- 0:00:20
      699500 -- (-786.371) (-786.461) (-783.890) [-784.067] * (-787.035) (-786.859) [-786.328] (-784.748) -- 0:00:20
      700000 -- (-787.284) (-788.048) [-783.735] (-784.791) * [-786.803] (-786.044) (-785.919) (-784.268) -- 0:00:20

      Average standard deviation of split frequencies: 0.008284

      700500 -- (-786.949) [-789.222] (-783.753) (-786.871) * (-785.176) (-789.630) (-784.811) [-786.377] -- 0:00:20
      701000 -- [-786.364] (-786.487) (-786.156) (-788.582) * [-787.549] (-788.591) (-787.382) (-788.346) -- 0:00:20
      701500 -- [-785.416] (-785.635) (-784.092) (-787.080) * (-784.673) [-784.557] (-788.423) (-786.870) -- 0:00:20
      702000 -- (-788.370) (-785.068) (-785.010) [-784.831] * [-786.278] (-783.507) (-786.181) (-789.173) -- 0:00:20
      702500 -- (-788.506) (-785.887) (-785.159) [-785.647] * [-786.869] (-783.505) (-786.140) (-787.048) -- 0:00:20
      703000 -- (-785.124) [-785.290] (-784.830) (-791.506) * (-787.011) (-784.078) (-785.112) [-785.744] -- 0:00:20
      703500 -- (-784.263) [-786.251] (-785.290) (-788.629) * [-784.278] (-786.662) (-785.787) (-786.634) -- 0:00:20
      704000 -- (-784.795) [-786.471] (-785.117) (-786.484) * [-784.420] (-784.413) (-784.794) (-785.293) -- 0:00:20
      704500 -- (-785.316) (-787.315) [-785.398] (-784.575) * (-785.633) [-786.503] (-786.386) (-783.820) -- 0:00:20
      705000 -- (-784.669) (-784.877) [-787.250] (-784.475) * (-791.448) [-784.053] (-784.496) (-792.165) -- 0:00:20

      Average standard deviation of split frequencies: 0.008639

      705500 -- (-789.710) (-784.262) [-785.338] (-787.647) * (-786.687) [-786.550] (-787.529) (-784.578) -- 0:00:20
      706000 -- [-785.311] (-787.469) (-785.538) (-784.587) * [-784.545] (-786.626) (-794.727) (-785.303) -- 0:00:20
      706500 -- (-785.474) (-787.394) [-788.691] (-784.845) * (-788.058) (-785.295) [-786.005] (-784.147) -- 0:00:20
      707000 -- [-787.841] (-786.821) (-785.454) (-785.914) * (-785.113) [-785.323] (-786.101) (-784.129) -- 0:00:20
      707500 -- (-787.907) (-783.831) (-786.220) [-786.074] * (-788.238) (-784.647) (-787.800) [-783.788] -- 0:00:20
      708000 -- (-790.240) (-785.990) [-787.051] (-786.479) * (-784.463) (-785.638) (-784.350) [-783.494] -- 0:00:20
      708500 -- (-784.540) [-784.051] (-783.833) (-784.940) * (-784.419) [-788.292] (-784.328) (-785.218) -- 0:00:20
      709000 -- (-787.972) (-785.994) (-786.504) [-784.290] * [-784.448] (-784.959) (-784.203) (-786.031) -- 0:00:20
      709500 -- [-783.936] (-785.863) (-790.574) (-783.844) * (-785.629) (-786.496) [-785.026] (-788.719) -- 0:00:20
      710000 -- (-787.192) (-789.835) (-788.385) [-785.888] * (-787.919) [-790.220] (-784.902) (-785.014) -- 0:00:20

      Average standard deviation of split frequencies: 0.008913

      710500 -- [-784.925] (-785.678) (-788.652) (-786.414) * (-785.850) [-784.140] (-788.905) (-786.969) -- 0:00:19
      711000 -- (-789.745) (-784.942) [-786.855] (-784.753) * (-784.462) (-784.947) (-790.362) [-786.692] -- 0:00:19
      711500 -- (-784.573) (-790.357) (-787.326) [-784.704] * [-787.538] (-784.734) (-785.962) (-784.769) -- 0:00:19
      712000 -- [-784.849] (-788.911) (-784.999) (-785.363) * (-786.908) (-785.304) [-785.919] (-784.540) -- 0:00:19
      712500 -- (-785.510) (-785.236) (-784.175) [-785.443] * (-784.280) [-786.714] (-786.211) (-785.483) -- 0:00:19
      713000 -- [-784.662] (-783.826) (-787.989) (-783.895) * [-785.043] (-791.259) (-784.182) (-784.489) -- 0:00:19
      713500 -- (-784.108) (-785.509) (-790.032) [-784.393] * (-783.801) [-786.162] (-789.013) (-788.688) -- 0:00:19
      714000 -- (-784.461) (-785.375) [-783.685] (-783.732) * [-787.952] (-785.086) (-786.704) (-789.952) -- 0:00:19
      714500 -- [-784.567] (-789.282) (-785.774) (-784.175) * (-791.444) (-784.367) (-783.350) [-784.114] -- 0:00:19
      715000 -- [-787.214] (-791.460) (-786.975) (-790.661) * (-787.484) (-786.952) (-786.354) [-784.752] -- 0:00:19

      Average standard deviation of split frequencies: 0.009012

      715500 -- (-786.339) (-785.120) (-785.203) [-785.250] * (-785.985) (-787.088) [-784.510] (-785.969) -- 0:00:19
      716000 -- (-784.340) (-788.170) [-784.611] (-785.364) * [-784.704] (-783.816) (-783.790) (-785.144) -- 0:00:19
      716500 -- (-786.019) (-786.141) [-787.118] (-789.902) * (-785.342) (-784.162) (-785.147) [-784.847] -- 0:00:19
      717000 -- [-786.974] (-786.089) (-786.135) (-784.828) * (-785.951) (-786.325) [-786.235] (-786.421) -- 0:00:19
      717500 -- (-786.067) (-786.384) (-785.811) [-785.674] * (-786.047) [-785.249] (-783.686) (-792.510) -- 0:00:19
      718000 -- (-786.083) (-784.860) (-786.042) [-786.261] * (-786.113) (-786.770) (-786.223) [-785.403] -- 0:00:19
      718500 -- (-784.680) (-784.600) (-784.988) [-785.258] * (-787.972) (-785.677) [-787.910] (-784.554) -- 0:00:19
      719000 -- (-786.299) (-784.678) (-784.318) [-786.622] * [-786.191] (-785.386) (-786.617) (-788.022) -- 0:00:19
      719500 -- (-784.515) (-784.625) [-784.655] (-785.011) * (-784.934) (-787.155) [-784.933] (-786.811) -- 0:00:19
      720000 -- (-784.154) [-784.880] (-784.937) (-790.252) * (-787.360) (-785.429) (-784.084) [-786.720] -- 0:00:19

      Average standard deviation of split frequencies: 0.008953

      720500 -- (-787.132) (-785.020) [-785.905] (-786.440) * (-784.896) [-787.872] (-783.872) (-786.983) -- 0:00:19
      721000 -- (-785.258) (-786.807) [-786.369] (-786.746) * (-785.318) (-784.240) [-785.138] (-784.184) -- 0:00:19
      721500 -- (-791.489) [-787.516] (-785.352) (-787.249) * [-784.568] (-784.937) (-786.631) (-785.734) -- 0:00:19
      722000 -- (-791.405) (-786.279) [-786.917] (-785.622) * (-787.839) (-788.391) (-784.603) [-785.585] -- 0:00:19
      722500 -- (-786.076) (-791.563) [-785.113] (-785.673) * [-787.253] (-787.991) (-784.813) (-786.064) -- 0:00:19
      723000 -- [-784.958] (-783.612) (-785.286) (-785.704) * [-785.298] (-783.504) (-786.402) (-787.181) -- 0:00:19
      723500 -- [-783.481] (-785.530) (-786.549) (-784.708) * (-785.784) [-785.859] (-787.862) (-787.692) -- 0:00:19
      724000 -- [-787.285] (-786.330) (-786.152) (-785.521) * (-785.599) (-785.335) (-787.217) [-792.328] -- 0:00:19
      724500 -- (-786.648) (-784.570) [-783.606] (-786.870) * (-784.536) (-788.408) [-786.530] (-786.871) -- 0:00:19
      725000 -- [-785.727] (-784.763) (-785.309) (-783.460) * (-785.022) [-789.107] (-786.584) (-784.517) -- 0:00:18

      Average standard deviation of split frequencies: 0.008441

      725500 -- (-783.872) (-786.178) (-786.387) [-785.795] * (-788.906) [-786.293] (-787.399) (-788.837) -- 0:00:18
      726000 -- (-785.226) (-786.459) (-784.711) [-788.979] * (-786.015) (-786.031) (-783.530) [-784.439] -- 0:00:18
      726500 -- (-788.009) [-785.155] (-785.638) (-791.435) * [-783.550] (-787.694) (-789.257) (-784.890) -- 0:00:18
      727000 -- (-784.605) [-786.771] (-785.028) (-787.688) * (-784.779) (-784.658) (-785.746) [-784.293] -- 0:00:18
      727500 -- [-784.821] (-785.727) (-784.316) (-783.630) * [-785.052] (-787.345) (-784.907) (-787.507) -- 0:00:18
      728000 -- [-784.242] (-784.659) (-789.076) (-783.942) * (-784.608) (-785.533) (-785.692) [-787.422] -- 0:00:18
      728500 -- (-785.552) [-783.363] (-785.484) (-784.678) * (-786.803) (-789.438) (-790.879) [-785.812] -- 0:00:18
      729000 -- (-785.801) (-784.742) (-783.844) [-784.501] * (-789.463) [-786.303] (-785.737) (-786.130) -- 0:00:18
      729500 -- [-790.712] (-787.834) (-790.856) (-790.737) * (-783.962) (-784.204) (-787.393) [-783.891] -- 0:00:18
      730000 -- (-784.782) (-784.488) (-789.193) [-786.330] * (-784.615) (-783.843) (-783.804) [-783.706] -- 0:00:18

      Average standard deviation of split frequencies: 0.007863

      730500 -- (-785.755) (-785.082) [-785.657] (-786.977) * [-787.293] (-783.719) (-785.090) (-784.244) -- 0:00:18
      731000 -- (-788.772) [-785.273] (-786.344) (-785.430) * [-786.549] (-788.455) (-784.408) (-789.999) -- 0:00:18
      731500 -- [-784.033] (-785.476) (-784.135) (-784.177) * (-787.474) (-788.508) [-784.087] (-789.876) -- 0:00:18
      732000 -- [-785.666] (-785.870) (-786.966) (-785.353) * (-786.196) (-785.960) [-785.437] (-790.233) -- 0:00:18
      732500 -- (-785.405) (-786.132) (-784.121) [-787.332] * (-787.329) [-784.989] (-788.021) (-791.219) -- 0:00:18
      733000 -- (-787.498) (-788.529) [-785.359] (-787.879) * [-786.012] (-787.336) (-786.834) (-785.708) -- 0:00:18
      733500 -- (-784.803) [-788.285] (-786.936) (-785.975) * (-786.772) [-787.367] (-783.494) (-784.496) -- 0:00:18
      734000 -- (-783.512) (-784.549) (-784.611) [-785.439] * (-790.629) (-785.408) [-783.496] (-787.223) -- 0:00:18
      734500 -- [-787.879] (-784.582) (-786.420) (-789.949) * (-785.924) (-787.448) [-786.043] (-795.641) -- 0:00:18
      735000 -- (-785.260) [-786.522] (-785.267) (-787.561) * (-786.811) (-786.728) [-784.581] (-788.419) -- 0:00:18

      Average standard deviation of split frequencies: 0.007406

      735500 -- (-784.057) (-786.928) (-784.478) [-784.564] * (-785.416) [-789.965] (-786.072) (-786.998) -- 0:00:18
      736000 -- (-785.996) (-789.278) (-784.527) [-784.456] * (-78