--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:27:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/tagA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -784.90 -788.00
2 -784.92 -787.61
--------------------------------------
TOTAL -784.91 -787.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893332 0.088201 0.346307 1.477585 0.865922 1501.00 1501.00 1.000
r(A<->C){all} 0.165368 0.020733 0.000016 0.469779 0.126843 205.59 256.57 1.004
r(A<->G){all} 0.174624 0.022625 0.000160 0.479510 0.129116 143.16 224.20 1.000
r(A<->T){all} 0.159640 0.018657 0.000127 0.432878 0.120647 223.87 266.81 1.004
r(C<->G){all} 0.156316 0.017701 0.000141 0.421860 0.121222 168.19 253.09 1.000
r(C<->T){all} 0.160873 0.020044 0.000003 0.443948 0.119338 229.78 250.90 1.000
r(G<->T){all} 0.183179 0.023372 0.000047 0.489102 0.141934 135.96 138.29 1.002
pi(A){all} 0.180886 0.000255 0.149445 0.211441 0.180416 1179.29 1257.50 1.000
pi(C){all} 0.274484 0.000332 0.240476 0.311083 0.274486 1460.36 1468.64 1.000
pi(G){all} 0.331206 0.000396 0.290908 0.368294 0.330769 1235.08 1323.14 1.000
pi(T){all} 0.213424 0.000293 0.178028 0.245671 0.213436 1453.12 1477.06 1.000
alpha{1,2} 0.429403 0.242445 0.000342 1.424146 0.263465 1407.63 1428.01 1.000
alpha{3} 0.462110 0.255652 0.000456 1.460591 0.299466 1393.83 1447.42 1.000
pinvar{all} 0.997275 0.000011 0.991429 0.999999 0.998261 1284.04 1296.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -769.263488
Model 2: PositiveSelection -769.263743
Model 0: one-ratio -769.263845
Model 7: beta -769.26341
Model 8: beta&w>1 -769.26341
Model 0 vs 1 7.13999999788939E-4
Model 2 vs 1 5.099999998492422E-4
Model 8 vs 7 0.0
>C1
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C2
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C3
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C4
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C5
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C6
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=192
C1 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C2 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C3 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C4 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C5 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C6 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
**************************************************
C1 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C2 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C3 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C4 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C5 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C6 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
**************************************************
C1 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C2 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C3 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C4 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C5 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C6 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
**************************************************
C1 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C2 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C3 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C4 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C5 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C6 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5760]--->[5760]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.718 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C2 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C3 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C4 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C5 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
C6 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
**************************************************
C1 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C2 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C3 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C4 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C5 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
C6 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
**************************************************
C1 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C2 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C3 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C4 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C5 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
C6 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
**************************************************
C1 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C2 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C3 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C4 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C5 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
C6 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C2 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C3 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C4 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C5 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
C6 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
**************************************************
C1 GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C2 GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C3 GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C4 GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C5 GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
C6 GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
**************************************************
C1 CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C2 CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C3 CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C4 CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C5 CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
C6 CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
**************************************************
C1 CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C2 CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C3 CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C4 CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C5 CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
C6 CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
**************************************************
C1 GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C2 GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C3 GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C4 GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C5 GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
C6 GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
**************************************************
C1 CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C2 CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C3 CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C4 CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C5 CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
C6 CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
**************************************************
C1 AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C2 AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C3 AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C4 AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C5 AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
C6 AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
**************************************************
C1 TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C2 TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C3 TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C4 TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C5 TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
C6 TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
**************************************************
C1 CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C2 CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C3 CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C4 CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C5 CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
C6 CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
**************************************************
C1 GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C2 GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C3 GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C4 GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C5 GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
C6 GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
**************************************************
C1 TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C2 TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C3 TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C4 TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C5 TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
C6 TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
**************************************************
C1 GTACTTGCTGGGTGCCTCCAACACGG
C2 GTACTTGCTGGGTGCCTCCAACACGG
C3 GTACTTGCTGGGTGCCTCCAACACGG
C4 GTACTTGCTGGGTGCCTCCAACACGG
C5 GTACTTGCTGGGTGCCTCCAACACGG
C6 GTACTTGCTGGGTGCCTCCAACACGG
**************************
>C1
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C2
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C3
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C4
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C5
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C6
GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG
GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC
CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT
CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG
GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG
CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC
AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC
TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT
CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG
GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC
TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT
GTACTTGCTGGGTGCCTCCAACACGG
>C1
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C2
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C3
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C4
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C5
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
>C6
VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 576 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789595
Setting output file names to "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 385013644
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0091221185
Seed = 480633468
Swapseed = 1579789595
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1289.115611 -- -24.965149
Chain 2 -- -1289.115536 -- -24.965149
Chain 3 -- -1289.115536 -- -24.965149
Chain 4 -- -1289.115611 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1289.115536 -- -24.965149
Chain 2 -- -1289.115415 -- -24.965149
Chain 3 -- -1289.115611 -- -24.965149
Chain 4 -- -1289.115536 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1289.116] (-1289.116) (-1289.116) (-1289.116) * [-1289.116] (-1289.115) (-1289.116) (-1289.116)
500 -- (-799.035) [-793.787] (-808.179) (-799.840) * (-808.214) (-802.940) [-794.037] (-801.019) -- 0:00:00
1000 -- (-797.178) [-793.614] (-798.268) (-790.485) * (-797.924) (-795.114) [-794.223] (-791.124) -- 0:00:00
1500 -- (-799.537) [-793.013] (-799.216) (-789.180) * [-793.887] (-797.426) (-794.525) (-798.980) -- 0:11:05
2000 -- (-794.776) [-794.808] (-794.795) (-800.067) * (-797.781) [-792.813] (-788.222) (-799.037) -- 0:08:19
2500 -- [-791.470] (-789.765) (-793.933) (-789.589) * (-800.253) [-796.234] (-796.019) (-793.991) -- 0:06:39
3000 -- (-797.179) [-790.162] (-788.827) (-792.262) * [-790.538] (-790.734) (-798.544) (-789.122) -- 0:05:32
3500 -- (-793.836) [-792.082] (-789.235) (-791.858) * [-798.218] (-796.040) (-797.511) (-797.219) -- 0:04:44
4000 -- [-797.149] (-793.685) (-801.829) (-792.796) * (-791.946) (-798.108) (-790.478) [-790.460] -- 0:04:09
4500 -- (-800.100) [-790.710] (-790.975) (-788.533) * (-800.029) (-792.820) [-791.545] (-801.564) -- 0:03:41
5000 -- (-796.468) (-789.652) (-803.157) [-792.347] * (-799.932) [-797.218] (-793.146) (-795.917) -- 0:03:19
Average standard deviation of split frequencies: 0.097274
5500 -- (-795.496) (-789.478) (-798.638) [-790.813] * [-792.062] (-799.280) (-801.342) (-795.189) -- 0:03:00
6000 -- (-797.864) [-789.343] (-791.017) (-805.098) * (-793.805) (-797.208) (-800.237) [-794.585] -- 0:02:45
6500 -- (-790.578) [-794.206] (-805.606) (-789.657) * (-792.531) [-789.665] (-805.758) (-806.148) -- 0:02:32
7000 -- (-793.234) [-792.681] (-800.118) (-790.716) * (-795.834) [-791.289] (-799.839) (-797.965) -- 0:02:21
7500 -- (-796.320) (-795.584) (-790.363) [-792.625] * (-791.980) [-790.045] (-793.273) (-811.384) -- 0:02:12
8000 -- (-791.682) [-794.782] (-801.895) (-794.651) * (-796.201) [-796.757] (-789.299) (-796.430) -- 0:02:04
8500 -- (-798.142) (-791.361) [-792.318] (-801.683) * (-798.398) (-796.711) (-797.015) [-790.675] -- 0:01:56
9000 -- (-796.687) (-796.937) [-792.643] (-805.445) * (-793.753) (-795.557) [-794.058] (-796.154) -- 0:01:50
9500 -- (-796.666) (-790.862) (-792.694) [-798.653] * (-795.963) (-800.635) (-799.731) [-795.550] -- 0:01:44
10000 -- (-796.796) [-789.567] (-794.003) (-795.993) * [-792.161] (-795.865) (-794.795) (-795.481) -- 0:01:39
Average standard deviation of split frequencies: 0.072106
10500 -- (-791.448) (-791.493) [-798.043] (-799.212) * (-795.011) (-792.645) (-801.301) [-799.139] -- 0:01:34
11000 -- [-794.460] (-793.957) (-792.265) (-800.229) * [-798.773] (-789.318) (-799.596) (-794.069) -- 0:01:29
11500 -- (-792.980) [-791.131] (-794.046) (-799.229) * (-789.184) (-792.682) (-794.428) [-790.487] -- 0:01:25
12000 -- (-795.055) (-801.132) [-797.839] (-792.595) * [-789.727] (-796.401) (-794.719) (-798.477) -- 0:01:22
12500 -- (-792.275) (-794.827) (-796.408) [-789.564] * [-789.610] (-792.796) (-799.500) (-794.902) -- 0:01:19
13000 -- [-794.019] (-797.502) (-790.559) (-797.892) * [-791.414] (-791.864) (-801.541) (-791.924) -- 0:01:15
13500 -- (-791.925) [-798.907] (-804.508) (-792.015) * (-796.330) [-794.386] (-793.981) (-793.194) -- 0:01:13
14000 -- [-790.789] (-795.877) (-793.226) (-797.477) * (-795.607) (-809.072) (-794.062) [-794.797] -- 0:01:10
14500 -- [-798.311] (-805.388) (-786.029) (-815.990) * (-791.549) (-786.715) (-796.859) [-798.570] -- 0:01:07
15000 -- (-812.358) [-797.992] (-786.032) (-793.287) * (-798.477) [-788.900] (-792.859) (-790.746) -- 0:01:05
Average standard deviation of split frequencies: 0.070383
15500 -- [-794.361] (-797.060) (-785.487) (-797.619) * (-799.161) (-784.609) (-790.629) [-793.002] -- 0:01:03
16000 -- (-800.228) (-795.444) (-784.372) [-789.947] * (-792.716) (-786.205) [-793.900] (-791.690) -- 0:01:01
16500 -- [-801.472] (-802.506) (-784.366) (-797.654) * (-798.894) (-784.491) (-791.373) [-790.122] -- 0:01:59
17000 -- (-793.648) [-794.965] (-784.372) (-792.623) * (-795.586) (-785.425) [-789.968] (-796.624) -- 0:01:55
17500 -- (-804.346) (-790.750) (-786.995) [-794.453] * [-793.974] (-787.186) (-791.448) (-791.642) -- 0:01:52
18000 -- (-793.026) [-793.580] (-788.099) (-796.242) * (-793.098) (-784.202) [-802.384] (-791.014) -- 0:01:49
18500 -- (-802.037) (-792.082) (-785.317) [-794.441] * (-798.171) (-787.719) (-794.694) [-788.101] -- 0:01:46
19000 -- [-791.053] (-796.815) (-785.413) (-791.255) * (-793.900) [-784.243] (-798.169) (-792.697) -- 0:01:43
19500 -- (-797.180) [-792.348] (-785.180) (-796.917) * (-806.997) (-784.059) (-810.314) [-790.187] -- 0:01:40
20000 -- (-792.270) (-796.753) [-783.527] (-794.973) * (-796.636) [-784.183] (-805.008) (-791.865) -- 0:01:38
Average standard deviation of split frequencies: 0.051622
20500 -- (-799.184) (-788.758) [-783.983] (-792.716) * (-802.110) (-788.093) (-797.628) [-797.467] -- 0:01:35
21000 -- [-799.505] (-794.344) (-783.612) (-795.732) * (-793.014) [-784.069] (-789.041) (-789.218) -- 0:01:33
21500 -- (-800.103) (-789.908) (-783.415) [-796.865] * (-798.845) (-784.064) (-789.347) [-794.266] -- 0:01:31
22000 -- (-791.971) (-794.673) (-787.581) [-800.914] * (-797.155) [-784.845] (-784.639) (-794.970) -- 0:01:28
22500 -- (-793.802) [-790.862] (-785.557) (-788.975) * (-789.186) [-784.311] (-784.961) (-797.267) -- 0:01:26
23000 -- (-795.200) [-793.284] (-785.691) (-797.429) * [-794.913] (-785.171) (-786.756) (-796.970) -- 0:01:24
23500 -- [-792.028] (-796.249) (-785.820) (-796.856) * (-792.786) (-786.371) [-783.607] (-790.857) -- 0:01:23
24000 -- [-790.839] (-796.896) (-786.049) (-796.009) * [-796.248] (-783.437) (-786.178) (-786.683) -- 0:01:21
24500 -- [-792.538] (-796.699) (-787.243) (-800.117) * (-791.651) (-784.022) [-788.033] (-786.871) -- 0:01:19
25000 -- (-792.378) [-792.426] (-785.729) (-807.608) * [-787.195] (-789.696) (-786.850) (-785.976) -- 0:01:18
Average standard deviation of split frequencies: 0.034685
25500 -- (-797.100) [-792.779] (-787.097) (-797.025) * (-792.182) (-787.675) (-792.534) [-787.454] -- 0:01:16
26000 -- (-796.365) [-792.699] (-786.285) (-795.813) * (-793.436) [-785.078] (-784.543) (-784.642) -- 0:01:14
26500 -- (-796.200) (-792.207) [-784.229] (-799.383) * [-793.079] (-786.025) (-783.792) (-784.212) -- 0:01:13
27000 -- [-793.324] (-793.427) (-784.489) (-794.939) * [-789.551] (-785.161) (-784.038) (-787.587) -- 0:01:12
27500 -- (-792.370) [-795.806] (-784.280) (-804.007) * (-793.095) (-784.650) [-784.279] (-787.312) -- 0:01:10
28000 -- (-797.822) (-791.445) (-786.217) [-789.897] * (-807.085) (-783.627) [-784.916] (-785.483) -- 0:01:09
28500 -- (-793.171) (-796.525) (-785.785) [-794.048] * (-799.606) (-785.826) (-786.056) [-788.005] -- 0:01:08
29000 -- (-794.630) [-795.593] (-784.132) (-797.805) * (-793.839) (-786.465) (-787.640) [-787.724] -- 0:01:06
29500 -- (-789.574) (-793.023) [-784.243] (-798.639) * (-797.527) (-786.426) [-787.282] (-785.714) -- 0:01:05
30000 -- [-790.313] (-805.019) (-783.484) (-797.064) * (-800.846) (-784.627) [-785.574] (-785.902) -- 0:01:04
Average standard deviation of split frequencies: 0.034404
30500 -- (-799.506) [-796.198] (-784.781) (-791.454) * [-800.264] (-785.391) (-785.419) (-788.556) -- 0:01:35
31000 -- (-799.438) (-802.091) [-786.104] (-796.383) * (-789.393) (-786.181) [-786.935] (-787.395) -- 0:01:33
31500 -- (-791.495) (-785.364) [-784.425] (-795.772) * (-790.788) (-784.564) (-784.674) [-785.829] -- 0:01:32
32000 -- (-791.622) (-784.743) [-785.665] (-791.866) * (-802.165) [-783.568] (-784.022) (-786.816) -- 0:01:30
32500 -- [-794.053] (-785.271) (-785.480) (-794.675) * [-798.147] (-785.245) (-788.805) (-784.696) -- 0:01:29
33000 -- (-795.803) (-787.647) (-784.932) [-791.348] * [-793.343] (-787.143) (-784.681) (-790.506) -- 0:01:27
33500 -- (-796.714) (-785.742) (-789.768) [-790.775] * (-797.457) [-784.458] (-785.403) (-785.655) -- 0:01:26
34000 -- (-792.758) (-785.623) [-786.204] (-802.705) * (-797.219) (-783.464) [-787.667] (-786.571) -- 0:01:25
34500 -- (-803.378) (-785.661) [-784.835] (-794.611) * (-798.529) (-786.296) [-784.408] (-788.053) -- 0:01:23
35000 -- (-796.018) (-786.115) (-785.063) [-796.229] * [-790.387] (-786.996) (-787.578) (-787.272) -- 0:01:22
Average standard deviation of split frequencies: 0.034295
35500 -- (-799.834) [-785.704] (-784.519) (-794.059) * (-798.120) [-791.004] (-783.870) (-788.011) -- 0:01:21
36000 -- (-794.473) [-788.181] (-787.226) (-792.553) * (-798.443) (-792.413) (-784.727) [-786.961] -- 0:01:20
36500 -- (-806.274) [-785.870] (-785.586) (-798.218) * (-796.624) (-790.392) (-786.315) [-787.258] -- 0:01:19
37000 -- (-789.558) [-785.933] (-783.434) (-792.982) * (-799.633) [-785.156] (-784.157) (-786.870) -- 0:01:18
37500 -- (-785.193) (-785.951) (-784.602) [-793.799] * (-798.980) [-785.912] (-786.957) (-785.281) -- 0:01:17
38000 -- (-787.977) (-788.280) (-784.280) [-794.620] * (-799.155) [-786.731] (-787.242) (-786.210) -- 0:01:15
38500 -- [-784.327] (-788.102) (-784.680) (-790.284) * (-804.371) (-785.227) [-784.410] (-786.396) -- 0:01:14
39000 -- (-785.677) (-786.745) (-786.065) [-803.186] * (-795.069) (-787.292) [-783.776] (-785.141) -- 0:01:13
39500 -- (-783.421) (-784.185) [-784.840] (-795.894) * (-799.958) (-787.577) [-785.658] (-785.820) -- 0:01:12
40000 -- (-783.873) (-784.078) (-785.984) [-792.397] * (-800.021) (-785.896) [-788.777] (-786.706) -- 0:01:12
Average standard deviation of split frequencies: 0.038640
40500 -- [-784.375] (-784.342) (-785.971) (-793.564) * [-795.666] (-786.735) (-793.938) (-786.857) -- 0:01:11
41000 -- (-786.882) (-787.536) [-786.714] (-791.812) * (-794.071) (-789.058) [-784.506] (-787.764) -- 0:01:10
41500 -- (-786.490) (-788.368) (-783.854) [-790.542] * (-792.302) (-784.911) [-785.027] (-785.963) -- 0:01:09
42000 -- (-784.528) (-786.029) (-784.236) [-790.318] * (-799.609) [-784.574] (-786.473) (-786.164) -- 0:01:08
42500 -- [-784.829] (-785.950) (-783.516) (-802.692) * (-790.880) [-784.864] (-787.300) (-787.060) -- 0:01:07
43000 -- (-784.155) [-786.369] (-786.780) (-792.831) * [-795.625] (-786.687) (-784.332) (-784.830) -- 0:01:06
43500 -- (-787.157) (-784.124) (-785.179) [-791.223] * (-799.430) [-787.719] (-783.365) (-785.423) -- 0:01:05
44000 -- (-793.931) (-783.679) [-787.134] (-794.512) * (-801.280) (-788.220) (-787.027) [-783.726] -- 0:01:05
44500 -- [-784.265] (-783.291) (-784.176) (-795.514) * (-794.198) (-787.945) [-784.598] (-785.750) -- 0:01:04
45000 -- (-787.040) (-784.762) (-783.853) [-796.063] * [-791.300] (-786.488) (-785.930) (-789.513) -- 0:01:24
Average standard deviation of split frequencies: 0.032901
45500 -- (-784.626) [-785.109] (-784.377) (-794.068) * (-798.250) [-785.130] (-786.404) (-788.349) -- 0:01:23
46000 -- (-785.150) (-787.756) [-783.992] (-792.636) * (-792.967) (-784.620) (-788.180) [-788.337] -- 0:01:22
46500 -- (-784.658) (-785.632) [-784.168] (-797.442) * (-792.912) [-784.908] (-788.004) (-788.755) -- 0:01:22
47000 -- (-785.543) [-786.595] (-785.070) (-796.357) * (-798.117) (-786.206) [-785.440] (-788.144) -- 0:01:21
47500 -- (-785.543) (-786.424) [-785.608] (-797.429) * [-792.007] (-786.550) (-787.318) (-786.681) -- 0:01:20
48000 -- (-786.903) (-786.797) [-783.735] (-799.767) * (-800.865) [-787.887] (-787.087) (-785.044) -- 0:01:19
48500 -- (-785.253) (-788.962) [-786.670] (-795.324) * (-805.401) (-788.363) (-786.035) [-786.089] -- 0:01:18
49000 -- (-784.560) [-787.811] (-784.566) (-792.412) * (-806.047) [-786.141] (-784.813) (-786.165) -- 0:01:17
49500 -- (-784.331) (-786.147) (-785.423) [-793.766] * (-792.195) (-786.521) (-785.111) [-786.262] -- 0:01:16
50000 -- (-784.527) (-785.064) [-783.862] (-790.899) * [-790.612] (-784.262) (-787.123) (-784.520) -- 0:01:16
Average standard deviation of split frequencies: 0.023015
50500 -- [-784.620] (-784.113) (-785.569) (-799.304) * [-795.360] (-784.392) (-788.026) (-784.589) -- 0:01:15
51000 -- (-785.881) (-787.710) (-784.269) [-793.401] * [-795.992] (-784.207) (-790.158) (-786.215) -- 0:01:14
51500 -- (-785.543) (-790.191) (-784.920) [-793.020] * (-802.227) (-788.341) [-784.312] (-785.646) -- 0:01:13
52000 -- (-786.451) (-785.180) [-787.030] (-790.501) * (-798.365) (-789.340) [-784.060] (-786.113) -- 0:01:12
52500 -- (-785.665) (-786.197) [-785.195] (-794.026) * (-795.523) (-785.494) (-787.167) [-784.964] -- 0:01:12
53000 -- (-786.285) [-784.592] (-786.672) (-794.060) * (-789.181) (-788.687) [-784.690] (-787.048) -- 0:01:11
53500 -- [-785.236] (-785.220) (-785.984) (-798.095) * [-795.013] (-788.410) (-784.994) (-785.445) -- 0:01:10
54000 -- (-784.280) [-784.395] (-785.757) (-802.826) * (-796.790) [-787.066] (-785.225) (-785.976) -- 0:01:10
54500 -- [-784.612] (-784.429) (-786.535) (-798.817) * (-793.565) [-786.501] (-788.076) (-787.492) -- 0:01:09
55000 -- (-783.544) [-783.714] (-784.648) (-794.852) * [-789.587] (-784.624) (-792.502) (-787.165) -- 0:01:08
Average standard deviation of split frequencies: 0.022152
55500 -- (-784.733) (-785.251) [-783.601] (-801.008) * [-794.992] (-784.897) (-789.292) (-784.719) -- 0:01:08
56000 -- (-785.553) [-785.598] (-785.332) (-796.739) * (-796.178) (-784.434) (-785.966) [-784.765] -- 0:01:07
56500 -- (-786.141) (-785.823) (-786.512) [-784.754] * [-792.191] (-784.370) (-788.332) (-784.007) -- 0:01:06
57000 -- (-787.212) (-784.120) (-784.806) [-786.825] * (-801.237) (-784.418) [-788.580] (-784.306) -- 0:01:06
57500 -- (-787.421) (-785.605) [-784.646] (-784.063) * (-799.094) [-786.131] (-785.500) (-784.568) -- 0:01:05
58000 -- (-788.391) (-787.250) (-783.776) [-785.295] * (-795.925) (-787.529) (-787.869) [-784.592] -- 0:01:04
58500 -- (-788.919) [-784.832] (-784.399) (-786.395) * (-798.313) [-786.525] (-786.054) (-785.803) -- 0:01:04
59000 -- (-786.799) (-788.330) (-785.345) [-785.314] * (-791.068) (-784.583) [-783.650] (-785.339) -- 0:01:19
59500 -- (-786.458) (-786.435) (-783.868) [-785.561] * (-791.824) (-785.490) (-785.671) [-788.188] -- 0:01:19
60000 -- (-785.498) [-785.454] (-786.703) (-787.401) * (-802.891) [-783.841] (-785.194) (-783.891) -- 0:01:18
Average standard deviation of split frequencies: 0.021153
60500 -- (-786.915) (-789.001) [-783.558] (-785.872) * [-790.747] (-786.166) (-783.812) (-784.985) -- 0:01:17
61000 -- (-786.344) (-787.375) [-784.630] (-786.723) * [-791.056] (-788.148) (-783.438) (-783.872) -- 0:01:16
61500 -- (-787.915) (-785.349) (-784.814) [-786.417] * (-790.079) (-787.590) [-783.890] (-787.538) -- 0:01:16
62000 -- (-789.060) [-785.700] (-784.289) (-785.110) * (-791.875) [-791.876] (-783.312) (-786.301) -- 0:01:15
62500 -- [-790.276] (-785.924) (-786.561) (-785.340) * (-798.697) (-787.536) [-783.311] (-788.251) -- 0:01:15
63000 -- (-789.019) (-783.917) (-785.971) [-785.795] * (-794.844) (-787.910) (-787.020) [-785.205] -- 0:01:14
63500 -- (-788.454) (-785.050) (-786.271) [-783.883] * (-794.246) (-787.478) (-786.866) [-785.498] -- 0:01:13
64000 -- (-787.817) (-783.901) [-784.480] (-786.916) * (-791.998) [-786.246] (-791.370) (-788.788) -- 0:01:13
64500 -- (-784.721) (-785.199) (-783.450) [-783.765] * [-791.466] (-793.591) (-783.532) (-787.382) -- 0:01:12
65000 -- (-785.777) [-785.778] (-785.856) (-783.836) * (-791.006) (-785.230) [-784.119] (-790.361) -- 0:01:11
Average standard deviation of split frequencies: 0.022179
65500 -- (-786.611) (-783.638) (-785.543) [-787.180] * [-792.413] (-786.461) (-786.597) (-785.582) -- 0:01:11
66000 -- (-790.114) (-786.268) (-786.236) [-785.582] * (-793.692) (-788.716) (-784.319) [-786.980] -- 0:01:10
66500 -- [-785.280] (-787.415) (-784.892) (-785.761) * (-799.856) (-785.581) [-784.396] (-784.401) -- 0:01:10
67000 -- (-792.747) [-786.888] (-784.796) (-784.049) * (-789.835) (-785.346) (-784.357) [-784.752] -- 0:01:09
67500 -- (-787.513) [-787.144] (-785.458) (-785.885) * (-789.684) (-785.320) [-785.578] (-785.055) -- 0:01:09
68000 -- [-787.691] (-785.662) (-784.763) (-785.599) * (-794.608) (-783.977) (-785.342) [-785.934] -- 0:01:08
68500 -- (-789.409) [-784.603] (-784.163) (-785.835) * [-788.313] (-783.966) (-787.315) (-785.921) -- 0:01:07
69000 -- (-787.302) [-784.860] (-784.977) (-783.876) * (-789.849) (-785.778) (-787.018) [-785.368] -- 0:01:07
69500 -- [-786.866] (-787.591) (-786.054) (-785.080) * (-793.722) (-785.496) [-786.402] (-786.220) -- 0:01:06
70000 -- (-784.423) (-786.154) [-784.355] (-788.460) * [-796.790] (-785.293) (-787.723) (-785.744) -- 0:01:06
Average standard deviation of split frequencies: 0.023523
70500 -- [-784.082] (-785.774) (-784.947) (-791.372) * (-792.722) [-784.192] (-789.232) (-788.960) -- 0:01:05
71000 -- (-787.705) (-784.434) [-784.019] (-789.640) * [-792.682] (-784.692) (-791.195) (-790.128) -- 0:01:05
71500 -- (-784.684) [-785.720] (-784.833) (-785.967) * [-794.795] (-784.282) (-784.579) (-787.154) -- 0:01:04
72000 -- (-783.826) [-786.486] (-786.793) (-783.932) * [-795.179] (-784.335) (-788.597) (-791.339) -- 0:01:04
72500 -- (-786.806) (-787.440) [-783.914] (-783.730) * (-797.405) (-784.278) (-786.154) [-785.598] -- 0:01:16
73000 -- [-790.786] (-791.950) (-783.992) (-784.308) * (-798.102) [-785.189] (-784.995) (-786.766) -- 0:01:16
73500 -- (-785.799) (-786.798) (-785.391) [-784.425] * (-796.551) (-785.904) (-784.397) [-786.162] -- 0:01:15
74000 -- (-786.267) (-785.721) [-785.660] (-787.383) * (-795.865) (-783.795) [-784.460] (-786.714) -- 0:01:15
74500 -- (-786.521) [-785.583] (-785.042) (-784.410) * (-799.527) [-783.991] (-787.211) (-787.325) -- 0:01:14
75000 -- (-784.529) (-783.900) (-784.949) [-784.215] * (-796.091) [-783.980] (-790.216) (-787.355) -- 0:01:14
Average standard deviation of split frequencies: 0.023505
75500 -- [-785.381] (-787.128) (-784.198) (-786.325) * (-794.371) [-783.933] (-789.331) (-785.450) -- 0:01:13
76000 -- (-784.677) (-786.383) (-785.474) [-785.643] * (-798.772) [-784.576] (-783.748) (-790.391) -- 0:01:12
76500 -- (-785.359) [-783.672] (-784.876) (-785.492) * (-795.777) (-784.079) (-787.126) [-789.029] -- 0:01:12
77000 -- (-788.147) (-784.320) (-783.169) [-785.653] * (-799.310) (-783.588) [-784.316] (-788.610) -- 0:01:11
77500 -- (-785.095) (-784.132) [-784.464] (-784.635) * [-792.490] (-784.196) (-786.502) (-789.649) -- 0:01:11
78000 -- (-786.856) [-785.699] (-785.078) (-786.421) * (-795.516) [-785.095] (-783.721) (-786.524) -- 0:01:10
78500 -- (-785.688) (-784.893) (-783.622) [-785.522] * [-794.447] (-785.074) (-790.078) (-785.823) -- 0:01:10
79000 -- (-783.820) [-783.772] (-787.008) (-787.003) * [-789.745] (-788.354) (-786.308) (-787.529) -- 0:01:09
79500 -- (-784.185) (-787.315) [-783.982] (-788.987) * [-791.958] (-784.922) (-786.748) (-789.087) -- 0:01:09
80000 -- [-786.192] (-786.153) (-787.781) (-789.885) * (-798.115) [-788.128] (-787.357) (-788.072) -- 0:01:09
Average standard deviation of split frequencies: 0.020454
80500 -- (-790.212) (-787.643) [-784.768] (-783.886) * (-799.050) (-789.008) (-787.444) [-784.880] -- 0:01:08
81000 -- [-786.203] (-785.762) (-784.699) (-787.812) * [-790.435] (-787.691) (-785.067) (-789.269) -- 0:01:08
81500 -- [-785.595] (-785.495) (-785.702) (-783.740) * (-796.370) [-785.564] (-785.435) (-788.213) -- 0:01:07
82000 -- (-784.971) [-786.134] (-786.573) (-784.490) * [-789.654] (-791.286) (-788.932) (-786.394) -- 0:01:07
82500 -- [-784.313] (-785.331) (-787.018) (-785.377) * [-798.456] (-792.750) (-787.495) (-784.152) -- 0:01:06
83000 -- (-786.781) (-786.075) (-788.372) [-787.561] * [-791.273] (-791.086) (-786.578) (-785.403) -- 0:01:06
83500 -- (-784.439) (-784.531) (-785.617) [-785.160] * (-798.692) (-785.371) (-788.246) [-786.310] -- 0:01:05
84000 -- (-784.719) (-784.912) (-786.363) [-784.286] * (-797.083) [-784.209] (-787.979) (-784.277) -- 0:01:05
84500 -- (-784.751) [-784.250] (-785.894) (-784.286) * (-792.721) (-784.518) (-785.235) [-784.292] -- 0:01:05
85000 -- (-784.694) (-784.632) (-784.652) [-784.083] * (-793.613) [-786.661] (-786.536) (-783.425) -- 0:01:04
Average standard deviation of split frequencies: 0.019041
85500 -- (-786.692) [-784.164] (-785.409) (-784.431) * (-797.760) (-785.879) [-784.226] (-786.266) -- 0:01:04
86000 -- (-784.481) (-784.666) [-784.795] (-785.585) * (-797.901) (-786.226) (-784.194) [-787.818] -- 0:01:03
86500 -- (-789.122) [-784.666] (-784.129) (-784.599) * (-791.569) [-788.604] (-784.517) (-784.864) -- 0:01:03
87000 -- (-784.854) (-784.160) [-785.237] (-785.230) * (-800.776) [-789.062] (-784.035) (-785.566) -- 0:01:02
87500 -- (-784.240) (-785.158) [-784.583] (-784.308) * (-791.269) (-783.443) [-784.076] (-784.365) -- 0:01:13
88000 -- [-786.025] (-783.893) (-784.414) (-787.311) * (-788.768) (-784.074) (-787.409) [-783.856] -- 0:01:12
88500 -- (-785.487) (-788.124) (-784.623) [-785.015] * (-795.872) (-784.281) [-785.990] (-788.028) -- 0:01:12
89000 -- (-785.444) [-784.946] (-783.988) (-786.332) * (-792.795) (-784.190) [-785.080] (-784.075) -- 0:01:11
89500 -- (-786.717) (-784.831) (-784.843) [-786.648] * (-805.192) (-788.956) [-783.970] (-783.814) -- 0:01:11
90000 -- (-788.867) (-784.535) [-784.513] (-786.141) * [-794.878] (-789.555) (-784.618) (-785.704) -- 0:01:10
Average standard deviation of split frequencies: 0.018061
90500 -- (-785.973) [-784.130] (-784.790) (-786.150) * (-791.627) [-789.081] (-785.163) (-784.095) -- 0:01:10
91000 -- (-788.800) (-784.238) (-786.355) [-790.484] * [-796.073] (-785.873) (-787.848) (-783.833) -- 0:01:09
91500 -- [-784.741] (-790.496) (-787.039) (-786.623) * (-789.139) (-789.222) [-783.929] (-785.633) -- 0:01:09
92000 -- [-784.671] (-786.998) (-785.293) (-787.293) * (-797.769) (-787.825) [-784.107] (-784.117) -- 0:01:09
92500 -- (-784.927) [-785.137] (-787.141) (-783.376) * [-799.922] (-785.308) (-786.939) (-787.668) -- 0:01:08
93000 -- (-785.060) (-789.319) [-785.609] (-785.080) * (-794.185) (-787.517) (-788.998) [-784.545] -- 0:01:08
93500 -- (-785.394) [-785.609] (-783.686) (-788.966) * [-796.038] (-785.288) (-785.031) (-785.288) -- 0:01:07
94000 -- (-784.280) (-786.966) (-784.239) [-787.108] * (-791.975) (-787.847) (-785.494) [-787.192] -- 0:01:07
94500 -- (-784.589) (-784.150) (-784.822) [-786.252] * (-793.338) (-788.674) (-787.375) [-786.461] -- 0:01:07
95000 -- (-784.025) [-785.440] (-785.860) (-786.181) * (-797.673) (-784.076) [-785.418] (-786.245) -- 0:01:06
Average standard deviation of split frequencies: 0.017833
95500 -- (-784.022) (-785.417) [-785.062] (-785.821) * (-798.344) (-784.186) (-786.926) [-784.734] -- 0:01:06
96000 -- [-784.246] (-789.108) (-785.256) (-785.348) * (-791.982) (-784.680) [-787.337] (-785.089) -- 0:01:05
96500 -- [-783.561] (-786.034) (-790.663) (-784.526) * (-793.029) [-784.456] (-786.737) (-785.999) -- 0:01:05
97000 -- (-783.870) [-783.907] (-790.765) (-789.946) * (-796.469) (-786.557) [-786.449] (-784.006) -- 0:01:05
97500 -- (-783.859) (-785.770) [-788.137] (-786.380) * (-794.051) [-785.648] (-785.334) (-783.480) -- 0:01:04
98000 -- (-785.990) (-784.804) (-787.951) [-784.925] * (-801.536) [-784.746] (-788.460) (-783.791) -- 0:01:04
98500 -- [-784.304] (-786.276) (-787.106) (-783.271) * [-789.255] (-787.911) (-787.559) (-786.867) -- 0:01:04
99000 -- (-785.738) (-786.704) (-788.970) [-787.596] * [-792.217] (-787.989) (-787.024) (-785.176) -- 0:01:03
99500 -- (-786.312) (-784.134) (-794.921) [-785.074] * (-793.408) (-785.043) (-788.854) [-785.144] -- 0:01:03
100000 -- (-786.176) (-784.501) [-787.027] (-787.238) * (-792.128) (-787.198) (-786.330) [-785.239] -- 0:01:02
Average standard deviation of split frequencies: 0.019252
100500 -- (-786.244) [-785.068] (-785.763) (-785.445) * (-809.232) (-787.320) [-788.734] (-785.524) -- 0:01:02
101000 -- [-786.930] (-789.287) (-790.070) (-788.940) * (-787.706) [-785.512] (-786.770) (-787.420) -- 0:01:11
101500 -- [-788.365] (-784.024) (-785.625) (-785.841) * (-785.227) [-784.093] (-789.369) (-784.550) -- 0:01:10
102000 -- (-787.453) [-783.629] (-785.052) (-785.873) * (-784.285) [-785.855] (-791.816) (-784.213) -- 0:01:10
102500 -- (-789.025) [-788.057] (-786.068) (-784.635) * (-785.300) [-786.552] (-786.036) (-783.824) -- 0:01:10
103000 -- (-789.483) [-785.640] (-784.526) (-783.992) * (-786.192) [-789.317] (-784.702) (-785.818) -- 0:01:09
103500 -- (-784.183) (-785.779) [-784.793] (-786.707) * (-786.987) (-791.208) (-785.136) [-786.732] -- 0:01:09
104000 -- [-787.402] (-784.160) (-786.017) (-789.658) * (-785.780) (-791.337) [-785.043] (-788.763) -- 0:01:08
104500 -- (-785.893) [-785.648] (-788.450) (-785.344) * (-783.866) [-784.568] (-786.331) (-792.126) -- 0:01:08
105000 -- (-787.185) (-787.811) (-789.551) [-784.673] * (-784.953) [-784.188] (-789.304) (-787.632) -- 0:01:08
Average standard deviation of split frequencies: 0.018283
105500 -- [-786.416] (-788.204) (-786.386) (-784.669) * [-787.858] (-786.850) (-787.977) (-785.633) -- 0:01:07
106000 -- (-788.265) (-787.527) (-785.536) [-786.643] * (-784.514) (-788.286) [-786.991] (-786.294) -- 0:01:07
106500 -- (-786.224) [-787.945] (-785.431) (-787.040) * (-784.463) (-785.851) [-785.628] (-786.967) -- 0:01:07
107000 -- (-785.893) (-786.836) [-784.953] (-786.842) * (-787.386) (-785.745) [-786.018] (-787.414) -- 0:01:06
107500 -- (-783.556) [-786.280] (-786.053) (-785.738) * (-785.091) [-784.318] (-788.911) (-785.944) -- 0:01:06
108000 -- [-784.532] (-788.925) (-785.963) (-785.432) * [-784.421] (-785.996) (-788.435) (-784.202) -- 0:01:06
108500 -- [-788.811] (-785.107) (-787.218) (-784.715) * (-785.833) [-786.624] (-788.065) (-783.961) -- 0:01:05
109000 -- (-786.156) (-787.791) [-788.052] (-785.030) * [-784.148] (-785.380) (-789.856) (-785.540) -- 0:01:05
109500 -- [-784.151] (-786.564) (-786.379) (-787.667) * (-783.848) (-783.853) (-787.902) [-784.455] -- 0:01:05
110000 -- (-784.378) [-784.065] (-785.670) (-787.443) * (-784.819) (-787.801) [-785.788] (-783.764) -- 0:01:04
Average standard deviation of split frequencies: 0.017512
110500 -- (-786.200) [-783.933] (-785.342) (-787.401) * [-784.207] (-788.265) (-784.808) (-784.212) -- 0:01:04
111000 -- (-785.067) [-784.633] (-786.044) (-791.901) * [-784.453] (-784.238) (-786.621) (-783.517) -- 0:01:04
111500 -- (-785.613) [-783.881] (-787.573) (-786.225) * (-784.642) (-784.613) (-786.042) [-785.076] -- 0:01:03
112000 -- (-784.958) (-784.853) (-784.512) [-784.367] * (-788.650) (-784.770) [-785.475] (-787.345) -- 0:01:03
112500 -- [-786.822] (-788.645) (-784.180) (-786.350) * (-787.196) (-784.920) [-785.412] (-785.402) -- 0:01:03
113000 -- (-784.765) (-790.853) [-784.636] (-783.703) * (-786.157) (-788.340) (-783.691) [-786.049] -- 0:01:02
113500 -- (-786.035) (-786.958) [-784.669] (-786.109) * (-783.992) [-785.159] (-786.311) (-785.056) -- 0:01:02
114000 -- (-787.522) (-787.276) [-784.832] (-789.686) * [-786.397] (-784.969) (-788.136) (-783.585) -- 0:01:02
114500 -- [-786.094] (-787.852) (-786.906) (-789.408) * [-786.602] (-784.363) (-786.290) (-784.156) -- 0:01:01
115000 -- (-784.517) (-784.924) [-783.442] (-789.324) * (-785.964) (-785.300) (-786.601) [-785.518] -- 0:01:09
Average standard deviation of split frequencies: 0.017384
115500 -- (-784.575) (-791.288) [-784.269] (-786.155) * [-786.472] (-790.312) (-784.189) (-784.546) -- 0:01:08
116000 -- [-787.095] (-785.460) (-784.489) (-784.633) * (-788.754) (-788.231) (-786.316) [-784.491] -- 0:01:08
116500 -- (-788.988) [-784.306] (-787.658) (-786.668) * (-790.455) (-785.687) (-785.819) [-784.183] -- 0:01:08
117000 -- (-785.771) (-785.512) [-785.643] (-786.061) * (-789.957) (-786.681) [-785.488] (-783.612) -- 0:01:07
117500 -- (-787.622) [-784.861] (-785.840) (-788.873) * (-787.687) (-784.393) (-786.360) [-785.067] -- 0:01:07
118000 -- (-785.144) (-786.059) [-784.158] (-788.766) * (-787.497) [-785.334] (-785.618) (-784.307) -- 0:01:07
118500 -- (-785.548) (-785.514) (-785.798) [-784.838] * (-784.639) [-784.146] (-786.168) (-784.864) -- 0:01:06
119000 -- (-788.810) [-786.691] (-786.529) (-784.054) * [-785.727] (-785.090) (-787.757) (-789.873) -- 0:01:06
119500 -- [-784.199] (-787.773) (-787.125) (-783.770) * (-784.287) (-787.989) [-787.202] (-788.469) -- 0:01:06
120000 -- (-786.188) (-786.177) [-784.917] (-783.566) * [-785.572] (-786.070) (-786.053) (-786.156) -- 0:01:06
Average standard deviation of split frequencies: 0.015193
120500 -- (-783.643) (-785.924) [-786.722] (-783.799) * (-788.009) [-784.549] (-787.643) (-786.549) -- 0:01:05
121000 -- [-785.069] (-784.828) (-784.520) (-785.702) * (-784.603) (-789.800) (-787.061) [-785.054] -- 0:01:05
121500 -- (-791.882) (-784.641) (-787.521) [-785.300] * [-785.241] (-794.852) (-786.722) (-787.862) -- 0:01:05
122000 -- (-786.096) (-784.187) [-786.726] (-783.823) * (-788.225) [-790.881] (-787.657) (-786.055) -- 0:01:04
122500 -- (-785.039) (-784.508) (-785.893) [-783.430] * (-791.852) [-786.449] (-792.695) (-785.699) -- 0:01:04
123000 -- (-785.840) (-785.211) (-786.162) [-787.802] * (-784.395) (-790.248) [-787.687] (-783.680) -- 0:01:04
123500 -- (-785.249) (-785.594) (-783.913) [-783.544] * (-785.189) (-791.082) (-787.619) [-784.909] -- 0:01:03
124000 -- [-785.403] (-786.529) (-783.591) (-783.525) * (-784.002) (-787.269) (-786.266) [-786.803] -- 0:01:03
124500 -- [-787.876] (-783.929) (-785.344) (-786.514) * (-786.238) (-786.597) (-785.144) [-784.612] -- 0:01:03
125000 -- [-785.769] (-784.705) (-786.478) (-784.854) * (-784.801) (-787.737) (-785.016) [-785.262] -- 0:01:03
Average standard deviation of split frequencies: 0.015162
125500 -- [-786.634] (-783.777) (-784.904) (-789.858) * (-787.302) (-785.628) [-784.430] (-787.530) -- 0:01:02
126000 -- (-786.589) [-784.504] (-790.018) (-785.460) * (-783.749) (-786.407) [-785.776] (-790.907) -- 0:01:02
126500 -- (-786.189) (-784.781) [-784.714] (-785.705) * [-783.210] (-791.201) (-784.181) (-787.890) -- 0:01:02
127000 -- [-785.964] (-785.986) (-784.735) (-788.694) * (-783.257) (-788.126) [-785.744] (-789.330) -- 0:01:01
127500 -- (-786.798) [-784.702] (-785.351) (-788.530) * (-783.932) (-783.607) (-785.689) [-787.653] -- 0:01:01
128000 -- (-789.939) [-785.244] (-786.086) (-785.628) * (-787.901) (-783.458) (-787.159) [-786.600] -- 0:01:01
128500 -- (-785.967) [-785.255] (-785.314) (-786.698) * [-787.325] (-784.857) (-787.405) (-785.613) -- 0:01:07
129000 -- (-785.051) (-784.592) [-783.888] (-786.418) * (-787.556) (-784.767) (-786.730) [-786.186] -- 0:01:07
129500 -- (-787.404) (-786.434) [-784.567] (-785.101) * (-784.778) (-784.982) (-785.641) [-784.220] -- 0:01:07
130000 -- (-783.750) (-783.993) (-784.285) [-783.893] * (-787.117) (-783.921) [-785.763] (-789.171) -- 0:01:06
Average standard deviation of split frequencies: 0.013709
130500 -- [-783.613] (-783.854) (-791.286) (-785.908) * (-786.927) (-785.981) [-785.371] (-787.865) -- 0:01:06
131000 -- (-785.060) [-784.808] (-786.759) (-788.383) * [-785.364] (-787.945) (-785.251) (-786.780) -- 0:01:06
131500 -- (-785.246) (-788.391) [-783.633] (-785.304) * (-786.418) (-787.706) (-786.644) [-788.912] -- 0:01:06
132000 -- [-784.137] (-789.847) (-788.867) (-785.637) * [-783.949] (-784.966) (-785.827) (-786.799) -- 0:01:05
132500 -- (-786.002) (-786.154) (-786.606) [-784.412] * (-786.147) (-785.124) (-785.125) [-786.140] -- 0:01:05
133000 -- (-790.346) [-784.926] (-786.123) (-788.944) * [-787.053] (-786.784) (-785.279) (-785.190) -- 0:01:05
133500 -- (-786.650) (-783.926) [-787.265] (-788.869) * (-784.876) (-784.501) [-784.664] (-786.059) -- 0:01:04
134000 -- (-784.544) (-788.239) [-784.770] (-787.283) * (-784.160) [-784.708] (-783.731) (-787.335) -- 0:01:04
134500 -- [-785.335] (-785.378) (-784.843) (-787.059) * [-784.789] (-789.967) (-786.557) (-785.315) -- 0:01:04
135000 -- (-785.543) [-784.668] (-784.461) (-784.823) * [-785.713] (-785.855) (-784.264) (-786.468) -- 0:01:04
Average standard deviation of split frequencies: 0.016638
135500 -- [-784.650] (-784.165) (-784.161) (-785.310) * (-785.124) (-786.878) (-783.600) [-785.540] -- 0:01:03
136000 -- (-784.047) (-785.349) (-786.669) [-783.404] * (-786.025) [-786.362] (-787.171) (-785.359) -- 0:01:03
136500 -- (-785.910) (-785.830) [-787.910] (-788.246) * (-789.495) [-784.104] (-789.600) (-786.095) -- 0:01:03
137000 -- (-785.110) [-785.023] (-788.649) (-788.131) * (-785.208) (-785.263) (-787.567) [-787.489] -- 0:01:02
137500 -- (-784.125) (-785.093) [-785.852] (-785.767) * (-785.239) (-788.622) [-785.529] (-787.418) -- 0:01:02
138000 -- [-783.842] (-786.009) (-791.857) (-787.501) * [-785.125] (-787.559) (-787.755) (-786.410) -- 0:01:02
138500 -- (-786.430) (-787.986) [-785.470] (-787.430) * [-786.058] (-786.617) (-784.505) (-788.138) -- 0:01:02
139000 -- (-785.293) (-787.523) [-785.308] (-787.209) * [-785.348] (-783.773) (-785.490) (-785.701) -- 0:01:01
139500 -- (-784.214) (-787.934) [-785.977] (-784.313) * (-790.172) [-783.716] (-791.472) (-786.332) -- 0:01:01
140000 -- (-784.579) (-790.438) [-783.345] (-784.698) * (-786.771) (-785.080) (-789.564) [-788.118] -- 0:01:01
Average standard deviation of split frequencies: 0.019102
140500 -- (-784.283) (-791.212) [-784.806] (-785.271) * (-788.701) [-785.172] (-787.630) (-786.932) -- 0:01:01
141000 -- (-784.061) (-788.688) [-784.586] (-785.385) * [-787.064] (-786.096) (-784.539) (-784.769) -- 0:01:00
141500 -- (-784.704) [-785.755] (-787.856) (-787.426) * (-785.005) (-784.362) [-784.400] (-784.767) -- 0:01:00
142000 -- (-783.428) [-785.474] (-785.166) (-785.651) * (-789.597) (-788.970) [-783.930] (-784.038) -- 0:01:06
142500 -- (-784.541) (-786.810) [-787.280] (-787.236) * (-783.176) (-789.040) (-784.017) [-783.739] -- 0:01:06
143000 -- [-784.056] (-789.687) (-786.511) (-783.824) * (-784.916) (-785.072) [-784.374] (-785.102) -- 0:01:05
143500 -- (-785.858) (-786.639) (-784.780) [-785.662] * (-785.656) [-784.045] (-787.304) (-785.232) -- 0:01:05
144000 -- (-795.707) (-783.759) [-784.598] (-787.297) * [-784.791] (-793.217) (-786.217) (-786.051) -- 0:01:05
144500 -- (-788.498) (-785.124) (-785.073) [-785.725] * (-784.690) [-784.245] (-788.168) (-787.646) -- 0:01:05
145000 -- (-790.407) (-784.640) [-783.226] (-784.013) * [-784.824] (-783.733) (-791.707) (-786.579) -- 0:01:04
Average standard deviation of split frequencies: 0.017436
145500 -- (-784.264) [-787.491] (-783.589) (-786.076) * (-784.468) [-783.625] (-792.057) (-784.464) -- 0:01:04
146000 -- (-784.571) (-784.953) (-786.824) [-787.257] * [-785.884] (-786.514) (-784.382) (-786.214) -- 0:01:04
146500 -- (-783.853) [-784.945] (-785.528) (-790.426) * (-786.143) (-788.366) (-784.972) [-786.468] -- 0:01:04
147000 -- [-784.804] (-784.073) (-786.272) (-786.981) * (-784.358) (-791.520) [-785.124] (-787.705) -- 0:01:03
147500 -- (-786.529) (-785.367) [-784.245] (-787.690) * [-785.935] (-783.894) (-787.422) (-787.108) -- 0:01:03
148000 -- (-785.765) [-786.328] (-784.015) (-784.346) * (-785.516) [-788.738] (-787.075) (-790.242) -- 0:01:03
148500 -- [-785.012] (-786.405) (-785.298) (-783.827) * (-788.141) [-783.482] (-787.358) (-785.772) -- 0:01:03
149000 -- (-785.406) (-787.593) (-783.951) [-784.444] * (-786.256) (-791.418) (-788.925) [-786.049] -- 0:01:02
149500 -- (-785.688) [-784.147] (-784.740) (-784.973) * (-786.301) [-785.011] (-785.559) (-784.677) -- 0:01:02
150000 -- (-784.429) [-784.869] (-784.683) (-783.847) * (-785.139) (-787.486) [-783.556] (-784.680) -- 0:01:02
Average standard deviation of split frequencies: 0.020963
150500 -- (-785.497) (-788.614) (-787.382) [-785.037] * (-786.823) (-785.971) (-785.840) [-784.874] -- 0:01:02
151000 -- (-789.969) (-790.316) (-783.575) [-785.645] * (-784.439) (-786.151) (-786.174) [-784.767] -- 0:01:01
151500 -- [-785.742] (-789.310) (-784.930) (-786.169) * (-786.520) (-787.593) (-787.394) [-784.731] -- 0:01:01
152000 -- (-783.731) [-784.187] (-789.510) (-784.586) * (-786.988) (-787.354) [-785.194] (-785.119) -- 0:01:01
152500 -- (-784.373) (-787.406) (-788.057) [-784.889] * [-786.445] (-785.147) (-785.141) (-785.783) -- 0:01:01
153000 -- (-783.423) (-784.744) (-787.418) [-785.701] * (-786.440) (-784.924) (-785.550) [-786.837] -- 0:01:00
153500 -- (-784.202) (-790.596) (-785.819) [-784.541] * (-785.568) (-786.694) [-786.150] (-785.209) -- 0:01:00
154000 -- [-785.283] (-786.271) (-784.276) (-784.914) * [-786.654] (-784.234) (-787.793) (-790.253) -- 0:01:00
154500 -- (-786.677) [-786.447] (-788.620) (-785.943) * (-787.243) [-784.752] (-786.021) (-788.299) -- 0:01:00
155000 -- (-790.944) [-785.044] (-790.045) (-784.166) * (-786.127) (-785.410) (-787.947) [-788.365] -- 0:00:59
Average standard deviation of split frequencies: 0.019880
155500 -- (-787.842) (-784.361) (-785.623) [-785.346] * (-784.645) [-785.143] (-784.868) (-787.088) -- 0:00:59
156000 -- (-788.363) (-789.624) (-788.521) [-785.470] * (-786.769) [-785.042] (-786.141) (-788.300) -- 0:01:04
156500 -- (-785.716) [-787.136] (-787.175) (-784.971) * [-785.206] (-785.098) (-785.555) (-785.794) -- 0:01:04
157000 -- [-785.029] (-786.651) (-786.167) (-786.328) * [-783.682] (-791.251) (-787.929) (-785.548) -- 0:01:04
157500 -- (-784.452) [-784.193] (-785.894) (-788.985) * (-787.858) (-786.450) [-785.561] (-786.941) -- 0:01:04
158000 -- [-786.856] (-784.371) (-788.973) (-785.454) * [-783.843] (-783.746) (-784.247) (-784.569) -- 0:01:03
158500 -- (-786.470) (-786.428) (-784.579) [-783.764] * [-785.201] (-784.636) (-785.766) (-783.948) -- 0:01:03
159000 -- (-787.010) (-787.783) [-785.681] (-785.629) * (-784.930) (-787.229) (-789.356) [-788.032] -- 0:01:03
159500 -- (-787.916) (-783.546) [-784.896] (-784.693) * [-784.595] (-788.510) (-788.428) (-784.633) -- 0:01:03
160000 -- [-785.963] (-784.976) (-785.276) (-784.914) * (-785.783) (-786.752) (-785.611) [-788.319] -- 0:01:02
Average standard deviation of split frequencies: 0.019952
160500 -- (-783.969) (-787.065) (-784.862) [-784.752] * (-788.555) (-786.840) (-785.419) [-784.526] -- 0:01:02
161000 -- (-783.998) (-785.247) [-791.152] (-784.998) * (-785.910) [-786.287] (-785.298) (-783.967) -- 0:01:02
161500 -- [-787.086] (-787.057) (-786.838) (-787.437) * (-785.305) (-791.425) [-785.725] (-785.628) -- 0:01:02
162000 -- (-786.466) (-788.040) (-786.091) [-786.032] * [-789.925] (-786.833) (-794.037) (-786.893) -- 0:01:02
162500 -- (-785.912) [-783.949] (-785.927) (-785.816) * (-791.436) (-788.038) [-784.242] (-784.302) -- 0:01:01
163000 -- (-787.354) [-785.242] (-786.105) (-783.488) * (-785.925) (-788.290) [-786.594] (-785.877) -- 0:01:01
163500 -- (-783.521) (-784.692) [-784.736] (-786.477) * (-785.133) [-783.668] (-785.802) (-790.256) -- 0:01:01
164000 -- (-784.603) [-786.159] (-784.726) (-787.234) * [-785.763] (-783.789) (-785.358) (-784.426) -- 0:01:01
164500 -- [-785.787] (-784.995) (-784.257) (-788.874) * (-784.036) (-784.485) (-787.733) [-785.706] -- 0:01:00
165000 -- [-784.641] (-784.226) (-786.147) (-790.772) * (-784.899) (-786.291) [-787.589] (-787.341) -- 0:01:00
Average standard deviation of split frequencies: 0.020588
165500 -- (-787.075) (-783.728) [-785.487] (-788.580) * (-786.102) (-784.159) [-786.385] (-783.889) -- 0:01:00
166000 -- (-784.314) (-788.335) (-786.274) [-786.124] * (-785.880) [-785.411] (-789.534) (-785.554) -- 0:01:00
166500 -- (-785.424) (-786.919) [-784.737] (-785.257) * (-784.126) (-784.686) [-785.898] (-784.688) -- 0:01:00
167000 -- (-783.519) (-784.451) [-788.511] (-784.156) * (-791.255) (-791.147) (-786.199) [-785.803] -- 0:00:59
167500 -- (-785.331) (-784.263) [-785.832] (-783.860) * (-790.291) [-785.254] (-784.921) (-784.759) -- 0:00:59
168000 -- (-784.210) (-786.243) (-787.121) [-783.742] * (-788.390) (-784.676) [-786.178] (-786.666) -- 0:00:59
168500 -- (-785.096) (-789.506) (-784.445) [-783.857] * (-789.859) (-784.720) (-784.163) [-784.144] -- 0:00:59
169000 -- (-789.199) (-784.776) (-785.278) [-789.984] * (-791.703) [-784.753] (-784.830) (-784.145) -- 0:00:59
169500 -- [-784.946] (-784.564) (-785.148) (-786.028) * [-785.006] (-784.409) (-786.328) (-783.323) -- 0:00:58
170000 -- [-784.129] (-784.225) (-787.089) (-786.871) * [-784.915] (-785.422) (-784.819) (-785.298) -- 0:00:58
Average standard deviation of split frequencies: 0.021225
170500 -- [-783.720] (-784.526) (-784.506) (-791.637) * [-787.398] (-784.702) (-784.925) (-785.506) -- 0:00:58
171000 -- (-786.712) [-784.932] (-785.731) (-791.044) * [-788.124] (-784.504) (-784.389) (-789.392) -- 0:01:03
171500 -- (-789.284) [-784.715] (-787.197) (-785.179) * (-785.737) [-785.780] (-784.956) (-787.950) -- 0:01:02
172000 -- (-788.877) (-785.413) [-785.783] (-785.327) * (-787.026) (-783.916) [-786.343] (-786.612) -- 0:01:02
172500 -- (-788.821) (-784.484) (-787.283) [-784.604] * [-784.597] (-785.803) (-788.999) (-785.008) -- 0:01:02
173000 -- (-784.869) (-785.460) [-784.658] (-783.620) * (-785.730) [-784.059] (-784.433) (-785.505) -- 0:01:02
173500 -- (-785.158) [-786.069] (-786.804) (-783.743) * (-784.602) (-786.804) (-784.366) [-786.733] -- 0:01:01
174000 -- (-786.213) [-783.991] (-784.298) (-784.440) * (-788.061) (-787.024) (-786.626) [-786.708] -- 0:01:01
174500 -- (-785.967) (-784.470) (-783.683) [-786.773] * [-785.212] (-786.370) (-787.400) (-786.927) -- 0:01:01
175000 -- (-784.472) [-783.993] (-788.618) (-784.977) * [-785.273] (-785.905) (-787.963) (-785.289) -- 0:01:01
Average standard deviation of split frequencies: 0.022469
175500 -- (-788.252) (-783.962) [-789.347] (-787.426) * (-786.860) (-785.905) [-786.438] (-789.196) -- 0:01:01
176000 -- (-784.155) (-792.164) [-786.638] (-786.085) * (-785.352) (-786.205) (-786.248) [-788.962] -- 0:01:00
176500 -- (-787.698) [-784.811] (-785.393) (-787.078) * (-788.351) (-784.395) (-783.538) [-787.877] -- 0:01:00
177000 -- (-791.699) [-784.938] (-783.937) (-783.573) * (-784.127) (-784.343) (-783.650) [-784.368] -- 0:01:00
177500 -- [-784.906] (-784.169) (-786.176) (-783.850) * (-785.438) (-785.500) [-785.132] (-785.686) -- 0:01:00
178000 -- (-786.374) (-785.180) (-783.378) [-784.036] * (-784.393) (-784.721) [-784.454] (-784.890) -- 0:01:00
178500 -- (-785.557) [-786.413] (-783.377) (-785.794) * (-787.669) (-786.786) (-784.678) [-785.417] -- 0:00:59
179000 -- [-785.058] (-787.018) (-784.825) (-788.012) * (-784.175) [-786.613] (-784.605) (-785.354) -- 0:00:59
179500 -- (-785.908) [-783.611] (-787.185) (-787.806) * [-786.127] (-785.007) (-783.888) (-786.146) -- 0:00:59
180000 -- (-785.053) (-785.212) [-784.221] (-785.550) * [-784.496] (-785.283) (-785.311) (-784.891) -- 0:00:59
Average standard deviation of split frequencies: 0.020737
180500 -- (-785.503) [-783.489] (-786.115) (-784.741) * (-788.645) (-789.402) [-785.365] (-785.931) -- 0:00:59
181000 -- (-785.001) (-787.053) (-784.452) [-784.295] * (-790.242) (-784.199) [-785.365] (-784.980) -- 0:00:58
181500 -- (-788.860) (-784.216) [-785.105] (-785.280) * [-787.154] (-787.284) (-786.102) (-783.995) -- 0:00:58
182000 -- (-786.000) (-784.345) (-785.625) [-786.170] * (-785.650) (-787.508) (-784.088) [-786.262] -- 0:00:58
182500 -- (-788.612) [-786.596] (-786.834) (-786.312) * (-789.517) (-787.027) [-785.115] (-788.499) -- 0:00:58
183000 -- (-790.690) [-784.583] (-783.205) (-786.297) * [-784.757] (-785.359) (-783.643) (-788.326) -- 0:00:58
183500 -- (-785.443) [-789.429] (-786.719) (-784.282) * (-785.886) (-785.488) [-785.508] (-784.804) -- 0:00:57
184000 -- (-785.318) (-786.866) (-785.042) [-783.877] * (-786.043) [-787.891] (-784.379) (-784.700) -- 0:00:57
184500 -- [-784.065] (-786.091) (-783.696) (-784.917) * (-786.041) (-793.390) [-784.635] (-784.161) -- 0:00:57
185000 -- (-786.955) (-784.381) (-784.118) [-786.541] * (-785.612) (-785.428) [-784.143] (-790.039) -- 0:00:57
Average standard deviation of split frequencies: 0.019075
185500 -- (-790.128) (-786.610) [-786.013] (-784.492) * [-786.394] (-794.504) (-786.327) (-787.478) -- 0:01:01
186000 -- (-785.037) [-785.715] (-783.818) (-784.335) * (-788.803) [-784.889] (-786.502) (-784.480) -- 0:01:01
186500 -- (-787.065) (-787.573) [-784.157] (-785.567) * [-784.725] (-784.590) (-785.855) (-786.053) -- 0:01:01
187000 -- [-787.024] (-784.329) (-785.416) (-786.181) * [-785.693] (-785.575) (-784.224) (-786.686) -- 0:01:00
187500 -- (-786.573) (-784.964) [-786.458] (-786.484) * [-785.874] (-790.557) (-785.754) (-786.080) -- 0:01:00
188000 -- (-785.025) (-784.254) (-790.365) [-784.467] * [-786.352] (-787.928) (-785.253) (-787.813) -- 0:01:00
188500 -- (-788.667) (-783.641) [-786.773] (-785.161) * (-785.887) (-784.053) [-784.293] (-786.457) -- 0:01:00
189000 -- (-787.644) (-783.341) (-785.031) [-784.867] * [-788.306] (-787.024) (-784.147) (-787.687) -- 0:01:00
189500 -- (-785.293) (-784.128) [-784.811] (-783.370) * (-791.733) (-789.361) [-785.076] (-784.980) -- 0:00:59
190000 -- (-790.390) [-784.040] (-784.628) (-784.178) * [-786.417] (-793.336) (-784.161) (-787.405) -- 0:00:59
Average standard deviation of split frequencies: 0.016266
190500 -- (-785.442) (-785.361) [-784.030] (-783.398) * (-785.869) (-785.672) (-788.551) [-784.462] -- 0:00:59
191000 -- (-787.961) (-787.865) [-785.078] (-784.971) * (-785.765) [-784.353] (-783.819) (-787.049) -- 0:00:59
191500 -- (-786.190) (-786.682) (-786.399) [-785.462] * [-785.641] (-783.290) (-783.732) (-789.174) -- 0:00:59
192000 -- (-784.697) (-785.636) [-785.091] (-785.063) * (-786.456) [-783.870] (-783.568) (-786.056) -- 0:00:58
192500 -- (-785.295) (-787.216) [-785.509] (-788.201) * (-785.168) (-785.300) [-791.127] (-784.273) -- 0:00:58
193000 -- (-785.740) (-786.647) [-784.531] (-790.660) * (-784.976) [-786.142] (-790.916) (-789.166) -- 0:00:58
193500 -- (-784.448) [-787.547] (-791.131) (-787.812) * (-784.434) (-783.245) (-784.624) [-784.567] -- 0:00:58
194000 -- (-785.300) (-784.701) (-784.626) [-787.317] * [-784.708] (-784.677) (-783.836) (-783.980) -- 0:00:58
194500 -- (-785.008) (-784.813) [-783.658] (-786.684) * [-784.710] (-783.256) (-786.592) (-788.838) -- 0:00:57
195000 -- (-786.155) (-784.185) (-785.206) [-787.591] * (-784.711) (-786.118) (-784.141) [-786.994] -- 0:00:57
Average standard deviation of split frequencies: 0.014431
195500 -- [-786.420] (-785.042) (-786.041) (-786.796) * [-783.654] (-783.506) (-784.853) (-786.915) -- 0:00:57
196000 -- (-784.468) (-784.992) (-790.657) [-787.411] * (-787.974) (-783.474) [-785.128] (-785.546) -- 0:00:57
196500 -- [-785.664] (-788.083) (-786.497) (-785.006) * (-786.025) [-783.222] (-785.936) (-789.258) -- 0:00:57
197000 -- (-783.508) (-787.872) [-784.991] (-786.430) * (-787.014) (-785.085) (-786.551) [-786.763] -- 0:00:57
197500 -- (-783.792) (-787.606) [-785.243] (-785.625) * (-787.017) [-785.476] (-786.783) (-785.016) -- 0:00:56
198000 -- [-784.243] (-784.027) (-784.817) (-789.928) * (-786.028) [-784.546] (-787.903) (-784.235) -- 0:00:56
198500 -- (-784.985) [-787.785] (-785.856) (-789.386) * [-784.445] (-784.898) (-790.266) (-784.559) -- 0:00:56
199000 -- [-784.622] (-785.769) (-784.188) (-788.244) * (-786.345) (-785.159) (-785.343) [-783.835] -- 0:00:56
199500 -- [-784.622] (-787.948) (-787.253) (-787.161) * [-788.389] (-788.233) (-784.301) (-784.407) -- 0:00:56
200000 -- (-783.557) [-785.039] (-787.211) (-785.843) * [-785.473] (-789.568) (-783.933) (-789.190) -- 0:00:59
Average standard deviation of split frequencies: 0.015009
200500 -- [-783.677] (-784.691) (-783.826) (-786.663) * [-783.760] (-786.289) (-784.757) (-789.644) -- 0:00:59
201000 -- [-784.037] (-785.166) (-785.462) (-785.088) * [-783.633] (-785.102) (-785.054) (-793.866) -- 0:00:59
201500 -- (-785.750) (-785.238) [-785.518] (-784.063) * [-784.705] (-785.382) (-784.725) (-789.409) -- 0:00:59
202000 -- [-785.104] (-786.630) (-791.990) (-787.439) * (-784.270) (-784.850) (-784.781) [-786.087] -- 0:00:59
202500 -- (-787.012) [-787.414] (-786.426) (-786.483) * [-787.323] (-786.448) (-788.354) (-785.555) -- 0:00:59
203000 -- [-785.181] (-790.461) (-791.102) (-786.282) * (-788.681) [-784.907] (-785.477) (-784.863) -- 0:00:58
203500 -- [-784.188] (-787.536) (-787.941) (-789.536) * [-786.986] (-783.387) (-787.187) (-785.994) -- 0:00:58
204000 -- (-785.716) (-788.020) (-784.487) [-791.443] * [-786.787] (-786.538) (-786.177) (-787.402) -- 0:00:58
204500 -- (-786.112) (-783.770) (-784.841) [-787.094] * (-784.901) (-789.144) (-786.461) [-784.501] -- 0:00:58
205000 -- (-784.049) (-786.879) (-784.870) [-783.760] * [-787.711] (-784.899) (-785.667) (-784.147) -- 0:00:58
Average standard deviation of split frequencies: 0.014366
205500 -- [-786.384] (-785.815) (-788.039) (-786.590) * (-786.750) (-784.814) [-784.056] (-784.448) -- 0:00:57
206000 -- (-786.196) (-785.016) [-787.011] (-788.815) * (-786.393) (-786.494) (-784.209) [-786.908] -- 0:00:57
206500 -- [-787.366] (-787.233) (-789.754) (-786.991) * [-787.625] (-785.946) (-786.792) (-785.256) -- 0:00:57
207000 -- (-788.915) (-786.393) [-786.847] (-785.053) * (-787.156) [-784.515] (-784.669) (-786.377) -- 0:00:57
207500 -- [-785.367] (-787.257) (-786.464) (-784.580) * [-785.828] (-784.157) (-783.920) (-787.311) -- 0:00:57
208000 -- (-786.444) [-783.406] (-787.029) (-785.061) * (-788.025) (-784.479) [-784.324] (-784.149) -- 0:00:57
208500 -- (-786.815) (-785.495) (-785.411) [-784.254] * (-786.299) (-786.607) (-785.674) [-785.505] -- 0:00:56
209000 -- (-786.671) [-784.060] (-785.094) (-788.213) * (-788.427) (-786.116) [-787.199] (-788.758) -- 0:00:56
209500 -- (-784.635) (-785.733) (-784.583) [-784.301] * (-788.329) [-783.780] (-785.003) (-788.788) -- 0:00:56
210000 -- (-787.400) (-784.730) [-786.843] (-793.464) * [-785.372] (-783.552) (-785.370) (-788.687) -- 0:00:56
Average standard deviation of split frequencies: 0.013550
210500 -- (-789.908) [-784.023] (-789.441) (-785.298) * (-785.092) [-785.804] (-786.716) (-784.955) -- 0:00:56
211000 -- (-786.998) [-786.541] (-789.879) (-784.383) * (-784.517) (-786.255) (-784.448) [-783.856] -- 0:00:56
211500 -- [-783.778] (-788.257) (-786.394) (-784.898) * [-784.367] (-788.125) (-784.675) (-783.455) -- 0:00:55
212000 -- (-785.017) [-784.002] (-788.059) (-785.979) * (-786.284) [-785.086] (-784.644) (-788.925) -- 0:00:55
212500 -- [-785.216] (-784.906) (-788.408) (-784.900) * [-786.564] (-787.128) (-785.256) (-784.475) -- 0:00:55
213000 -- [-784.193] (-790.343) (-789.939) (-783.989) * (-783.909) [-784.663] (-784.390) (-785.046) -- 0:00:55
213500 -- [-785.915] (-784.763) (-790.727) (-784.465) * (-785.139) [-786.196] (-784.173) (-787.208) -- 0:00:58
214000 -- (-784.464) [-790.714] (-787.742) (-785.014) * (-784.141) (-787.615) [-786.277] (-787.681) -- 0:00:58
214500 -- (-786.917) [-785.285] (-783.520) (-784.979) * (-783.929) [-787.021] (-786.069) (-784.312) -- 0:00:58
215000 -- (-784.968) (-786.265) [-784.714] (-789.339) * [-784.955] (-785.317) (-784.588) (-784.475) -- 0:00:58
Average standard deviation of split frequencies: 0.013943
215500 -- (-785.338) (-784.777) (-784.116) [-785.949] * [-783.833] (-787.162) (-784.258) (-784.516) -- 0:00:58
216000 -- (-786.333) (-786.550) (-784.569) [-785.831] * (-784.817) [-785.548] (-785.366) (-786.328) -- 0:00:58
216500 -- (-787.020) (-784.331) (-790.621) [-784.836] * (-783.379) [-785.008] (-785.612) (-788.479) -- 0:00:57
217000 -- (-785.622) (-787.473) [-785.737] (-787.188) * (-784.129) [-784.731] (-784.118) (-787.563) -- 0:00:57
217500 -- (-784.890) (-786.407) [-786.483] (-785.160) * (-788.565) [-785.216] (-787.838) (-783.782) -- 0:00:57
218000 -- [-785.253] (-786.965) (-784.883) (-784.902) * [-789.318] (-787.719) (-786.179) (-783.618) -- 0:00:57
218500 -- (-784.119) [-788.630] (-787.619) (-785.002) * [-791.191] (-785.862) (-787.446) (-787.462) -- 0:00:57
219000 -- (-785.429) (-787.867) (-783.911) [-783.756] * (-783.280) (-786.391) (-787.136) [-788.657] -- 0:00:57
219500 -- (-787.849) (-784.620) (-786.049) [-784.509] * (-784.071) (-787.715) (-786.396) [-785.108] -- 0:00:56
220000 -- [-785.655] (-784.350) (-785.800) (-785.183) * [-785.519] (-785.644) (-786.864) (-783.944) -- 0:00:56
Average standard deviation of split frequencies: 0.014326
220500 -- (-785.594) (-783.787) [-784.503] (-787.490) * (-786.078) (-786.722) (-789.793) [-785.316] -- 0:00:56
221000 -- (-785.999) (-785.808) (-783.605) [-784.248] * [-788.584] (-786.860) (-790.267) (-794.490) -- 0:00:56
221500 -- (-786.334) (-784.903) (-786.430) [-786.009] * (-789.641) (-785.298) (-789.930) [-789.920] -- 0:00:56
222000 -- (-785.733) (-787.168) [-784.335] (-784.763) * (-787.105) (-787.097) (-787.127) [-787.018] -- 0:00:56
222500 -- [-788.754] (-788.461) (-785.955) (-784.345) * (-785.314) (-788.356) [-784.999] (-787.847) -- 0:00:55
223000 -- [-785.334] (-786.388) (-783.885) (-784.985) * [-784.372] (-786.776) (-783.907) (-788.223) -- 0:00:55
223500 -- [-783.562] (-788.026) (-784.192) (-792.649) * [-784.853] (-786.798) (-783.819) (-785.108) -- 0:00:55
224000 -- [-784.709] (-786.966) (-784.247) (-786.608) * (-784.483) (-786.773) (-784.768) [-784.832] -- 0:00:55
224500 -- [-784.833] (-786.285) (-785.008) (-785.009) * (-785.317) (-786.420) [-784.954] (-786.225) -- 0:00:55
225000 -- [-784.842] (-791.650) (-783.566) (-786.738) * [-785.461] (-787.025) (-784.567) (-785.709) -- 0:00:55
Average standard deviation of split frequencies: 0.013095
225500 -- (-786.570) (-786.763) [-783.659] (-785.646) * [-784.203] (-786.862) (-785.224) (-788.237) -- 0:00:54
226000 -- (-789.777) [-787.688] (-784.830) (-783.930) * (-786.758) (-785.728) (-788.964) [-790.178] -- 0:00:54
226500 -- (-784.198) (-788.798) (-785.208) [-784.609] * [-785.601] (-784.754) (-787.679) (-786.423) -- 0:00:54
227000 -- (-785.358) (-786.911) (-790.298) [-788.484] * [-785.098] (-784.136) (-783.634) (-785.371) -- 0:00:54
227500 -- (-786.125) [-784.995] (-784.234) (-785.106) * (-790.063) [-786.468] (-783.718) (-789.023) -- 0:00:57
228000 -- (-785.263) (-786.534) (-784.233) [-786.994] * (-786.022) (-785.165) [-785.051] (-787.088) -- 0:00:57
228500 -- (-783.870) (-786.728) (-784.233) [-787.238] * (-784.781) (-786.974) [-783.529] (-789.596) -- 0:00:57
229000 -- (-788.442) [-790.641] (-784.821) (-783.749) * (-785.720) [-785.009] (-783.938) (-787.986) -- 0:00:57
229500 -- [-787.227] (-787.445) (-784.703) (-784.196) * (-786.031) [-785.779] (-787.691) (-784.774) -- 0:00:57
230000 -- (-790.632) (-788.356) [-783.806] (-786.062) * [-783.688] (-783.674) (-786.767) (-787.711) -- 0:00:56
Average standard deviation of split frequencies: 0.012743
230500 -- (-789.114) [-786.964] (-783.684) (-784.893) * (-783.745) (-784.913) [-786.892] (-789.604) -- 0:00:56
231000 -- (-788.086) (-786.053) [-787.173] (-790.483) * [-784.127] (-785.083) (-789.391) (-792.376) -- 0:00:56
231500 -- [-785.723] (-786.319) (-786.939) (-784.615) * (-784.158) (-786.497) [-786.214] (-784.891) -- 0:00:56
232000 -- [-786.773] (-790.583) (-786.129) (-785.713) * (-785.225) (-785.467) (-784.734) [-785.908] -- 0:00:56
232500 -- [-784.486] (-787.251) (-786.786) (-783.548) * (-783.987) (-784.024) [-785.622] (-788.056) -- 0:00:56
233000 -- (-784.361) [-785.421] (-784.607) (-784.195) * (-787.560) (-784.001) [-787.208] (-787.783) -- 0:00:55
233500 -- [-783.801] (-785.306) (-788.423) (-788.184) * (-786.798) [-786.049] (-786.423) (-788.591) -- 0:00:55
234000 -- [-786.726] (-785.867) (-786.768) (-791.941) * (-786.942) (-789.240) [-786.678] (-787.580) -- 0:00:55
234500 -- (-786.469) (-783.532) (-790.847) [-785.860] * (-789.867) (-786.988) (-785.181) [-785.111] -- 0:00:55
235000 -- (-784.244) (-784.670) (-787.676) [-787.723] * (-785.291) [-784.656] (-784.580) (-785.627) -- 0:00:55
Average standard deviation of split frequencies: 0.011652
235500 -- (-785.530) [-784.289] (-791.579) (-785.518) * (-790.055) (-786.465) [-783.946] (-784.564) -- 0:00:55
236000 -- (-785.553) [-787.542] (-786.062) (-788.953) * (-785.625) (-786.457) [-785.170] (-785.296) -- 0:00:55
236500 -- (-786.002) [-789.724] (-785.044) (-788.014) * (-787.213) (-785.915) (-784.539) [-784.310] -- 0:00:54
237000 -- (-784.779) [-784.817] (-784.202) (-786.538) * [-784.719] (-788.675) (-784.663) (-784.156) -- 0:00:54
237500 -- (-787.722) (-786.850) [-784.055] (-784.236) * (-787.218) [-783.375] (-784.176) (-783.561) -- 0:00:54
238000 -- (-791.169) [-784.740] (-785.271) (-785.043) * (-786.020) [-784.957] (-786.345) (-785.653) -- 0:00:54
238500 -- (-787.465) (-784.013) [-786.251] (-784.663) * [-784.059] (-784.159) (-786.095) (-783.854) -- 0:00:54
239000 -- (-787.274) [-785.517] (-784.269) (-785.398) * (-788.315) [-784.003] (-785.509) (-785.356) -- 0:00:54
239500 -- (-789.392) (-786.838) (-783.705) [-786.890] * (-785.853) (-784.412) (-785.860) [-785.588] -- 0:00:53
240000 -- [-787.450] (-790.803) (-784.437) (-786.324) * (-784.352) (-784.209) (-786.614) [-786.201] -- 0:00:53
Average standard deviation of split frequencies: 0.011861
240500 -- (-785.312) [-783.950] (-783.556) (-787.394) * (-784.647) (-783.820) (-786.277) [-785.732] -- 0:00:53
241000 -- (-788.084) (-784.871) [-785.013] (-784.944) * (-784.545) [-784.330] (-785.673) (-786.378) -- 0:00:53
241500 -- (-790.561) [-784.487] (-786.163) (-784.179) * (-784.630) (-785.439) [-787.408] (-784.707) -- 0:00:53
242000 -- (-788.046) (-784.527) (-784.746) [-784.323] * (-787.525) (-788.694) (-788.244) [-788.443] -- 0:00:53
242500 -- (-789.564) (-785.054) (-789.500) [-784.921] * (-786.127) (-786.143) [-786.688] (-786.330) -- 0:00:53
243000 -- (-786.321) [-784.829] (-785.884) (-785.320) * (-787.523) [-786.706] (-786.346) (-787.342) -- 0:00:56
243500 -- (-787.877) [-785.135] (-785.644) (-784.429) * [-787.949] (-786.978) (-788.240) (-785.694) -- 0:00:55
244000 -- (-784.182) (-784.429) (-784.083) [-785.372] * (-791.165) (-787.783) [-783.485] (-784.117) -- 0:00:55
244500 -- (-785.421) (-788.269) [-785.372] (-785.282) * (-785.627) (-792.719) (-786.400) [-786.974] -- 0:00:55
245000 -- (-786.515) (-785.971) (-784.783) [-784.553] * (-787.678) (-787.680) (-787.201) [-787.931] -- 0:00:55
Average standard deviation of split frequencies: 0.012103
245500 -- (-784.657) [-784.856] (-784.422) (-784.163) * (-785.109) (-788.423) [-792.173] (-785.909) -- 0:00:55
246000 -- [-789.368] (-787.249) (-786.249) (-786.266) * [-784.154] (-786.792) (-788.849) (-785.643) -- 0:00:55
246500 -- (-787.488) (-783.659) [-786.890] (-788.325) * (-785.127) (-784.260) [-783.950] (-784.053) -- 0:00:55
247000 -- (-784.447) (-784.938) [-784.823] (-784.113) * (-785.158) (-785.512) [-784.267] (-787.848) -- 0:00:54
247500 -- (-784.294) (-786.537) (-788.085) [-783.641] * (-786.006) (-798.649) [-785.191] (-786.903) -- 0:00:54
248000 -- [-783.937] (-784.624) (-787.445) (-784.810) * (-785.726) (-792.737) [-784.312] (-789.069) -- 0:00:54
248500 -- [-784.498] (-785.259) (-788.622) (-786.132) * [-784.177] (-783.547) (-786.195) (-784.227) -- 0:00:54
249000 -- [-784.957] (-784.773) (-787.745) (-787.962) * (-783.766) (-783.414) (-785.877) [-783.849] -- 0:00:54
249500 -- (-786.630) (-783.783) (-787.221) [-785.414] * (-784.525) [-783.560] (-786.229) (-783.748) -- 0:00:54
250000 -- (-786.885) [-784.672] (-783.434) (-783.686) * (-786.814) (-784.199) [-785.929] (-785.866) -- 0:00:54
Average standard deviation of split frequencies: 0.012867
250500 -- (-788.880) (-785.173) [-784.196] (-785.437) * (-786.944) [-783.534] (-785.645) (-784.780) -- 0:00:53
251000 -- (-784.927) [-786.224] (-795.991) (-787.353) * (-786.763) [-784.096] (-787.169) (-784.075) -- 0:00:53
251500 -- (-784.123) (-790.198) (-790.482) [-784.530] * (-785.058) [-784.892] (-788.307) (-783.997) -- 0:00:53
252000 -- (-785.486) [-786.434] (-784.013) (-783.881) * (-784.569) (-783.272) (-784.912) [-784.100] -- 0:00:53
252500 -- (-789.178) [-784.334] (-785.831) (-784.097) * [-784.313] (-784.285) (-785.309) (-785.663) -- 0:00:53
253000 -- (-788.991) (-784.732) (-784.974) [-784.673] * (-784.994) (-785.640) [-784.789] (-785.472) -- 0:00:53
253500 -- (-784.411) (-790.594) [-784.548] (-786.035) * (-785.257) (-788.203) (-784.840) [-783.836] -- 0:00:53
254000 -- (-784.091) [-784.639] (-785.394) (-784.845) * (-783.918) [-789.140] (-785.589) (-785.005) -- 0:00:52
254500 -- (-784.466) (-783.455) (-786.346) [-784.287] * (-785.820) [-784.761] (-786.085) (-784.043) -- 0:00:52
255000 -- [-787.035] (-783.625) (-784.767) (-784.353) * (-784.539) [-786.505] (-784.334) (-786.026) -- 0:00:52
Average standard deviation of split frequencies: 0.012072
255500 -- (-786.166) (-783.615) [-786.673] (-784.504) * (-785.167) (-791.215) [-785.362] (-786.539) -- 0:00:52
256000 -- (-786.454) [-784.319] (-787.835) (-784.826) * (-785.605) (-785.490) [-786.346] (-795.844) -- 0:00:52
256500 -- [-787.320] (-785.830) (-789.474) (-785.220) * (-784.221) (-785.895) (-784.290) [-785.179] -- 0:00:52
257000 -- (-786.559) (-784.379) (-790.428) [-784.895] * (-785.042) (-785.715) (-785.880) [-787.114] -- 0:00:52
257500 -- [-788.896] (-784.380) (-784.675) (-791.000) * (-784.206) [-786.956] (-787.281) (-784.888) -- 0:00:54
258000 -- (-788.154) [-784.971] (-784.021) (-784.745) * (-789.039) (-786.276) [-785.668] (-785.937) -- 0:00:54
258500 -- (-786.399) [-785.315] (-787.660) (-784.801) * (-783.728) (-787.008) [-784.968] (-786.244) -- 0:00:54
259000 -- [-783.477] (-785.876) (-793.561) (-784.635) * [-784.631] (-784.850) (-785.259) (-785.284) -- 0:00:54
259500 -- (-783.938) (-784.388) [-787.887] (-785.972) * [-784.631] (-787.338) (-785.093) (-788.927) -- 0:00:54
260000 -- (-783.644) (-789.594) [-788.641] (-783.870) * (-783.654) (-786.982) [-786.800] (-785.356) -- 0:00:54
Average standard deviation of split frequencies: 0.011353
260500 -- (-786.988) (-787.238) [-785.125] (-784.477) * [-783.485] (-788.371) (-789.230) (-784.513) -- 0:00:53
261000 -- (-784.854) [-786.549] (-783.757) (-784.331) * (-787.323) (-790.837) (-785.601) [-785.247] -- 0:00:53
261500 -- (-783.507) (-789.366) [-783.886] (-783.844) * (-785.145) (-789.274) [-785.371] (-785.023) -- 0:00:53
262000 -- [-785.045] (-784.837) (-785.675) (-786.506) * (-785.602) (-787.375) [-783.886] (-787.612) -- 0:00:53
262500 -- [-784.279] (-786.541) (-785.871) (-784.867) * [-787.566] (-786.858) (-787.226) (-792.062) -- 0:00:53
263000 -- (-785.828) (-785.305) (-786.245) [-787.948] * (-790.922) (-785.932) [-787.808] (-784.639) -- 0:00:53
263500 -- (-787.789) (-786.547) [-786.105] (-787.891) * (-785.724) (-785.451) [-786.992] (-784.390) -- 0:00:53
264000 -- (-789.098) (-785.111) (-789.449) [-785.120] * [-785.562] (-786.482) (-789.865) (-785.371) -- 0:00:52
264500 -- (-785.272) [-783.373] (-784.438) (-787.391) * (-785.742) (-787.943) [-784.126] (-785.054) -- 0:00:52
265000 -- (-785.140) (-786.277) (-786.886) [-785.566] * (-785.981) (-788.107) (-786.758) [-786.237] -- 0:00:52
Average standard deviation of split frequencies: 0.011379
265500 -- [-784.391] (-787.737) (-787.584) (-788.706) * (-785.568) (-788.645) [-785.505] (-784.031) -- 0:00:52
266000 -- (-784.027) [-786.606] (-784.200) (-784.893) * [-785.926] (-788.543) (-783.493) (-785.271) -- 0:00:52
266500 -- (-784.553) (-787.932) (-785.227) [-786.642] * (-784.835) (-788.608) [-789.162] (-785.394) -- 0:00:52
267000 -- (-787.135) (-785.284) [-784.592] (-787.051) * (-785.174) (-788.032) (-788.205) [-785.536] -- 0:00:52
267500 -- (-786.970) (-784.738) [-785.999] (-787.071) * (-783.784) (-786.048) [-785.650] (-786.511) -- 0:00:52
268000 -- (-786.935) [-786.658] (-786.922) (-787.641) * [-783.586] (-783.942) (-785.628) (-784.738) -- 0:00:51
268500 -- (-787.847) [-786.709] (-786.213) (-786.543) * [-787.432] (-784.069) (-787.176) (-785.472) -- 0:00:51
269000 -- (-785.848) (-788.376) [-786.093] (-783.777) * (-783.522) (-785.290) (-787.020) [-784.247] -- 0:00:51
269500 -- (-783.588) [-788.315] (-784.587) (-786.708) * [-788.110] (-786.098) (-786.466) (-784.412) -- 0:00:51
270000 -- (-783.555) (-784.108) (-783.460) [-785.231] * (-787.507) [-787.337] (-786.380) (-786.813) -- 0:00:51
Average standard deviation of split frequencies: 0.010740
270500 -- [-784.060] (-785.303) (-783.805) (-786.920) * (-786.532) [-784.167] (-786.205) (-787.895) -- 0:00:51
271000 -- (-783.870) (-785.960) [-784.877] (-784.484) * (-784.197) [-784.123] (-786.352) (-784.623) -- 0:00:51
271500 -- (-787.745) (-784.955) (-786.303) [-784.797] * (-785.968) (-787.366) [-784.930] (-783.987) -- 0:00:50
272000 -- (-785.672) (-788.572) [-784.225] (-784.304) * (-790.760) (-787.745) (-784.826) [-785.521] -- 0:00:53
272500 -- (-791.746) (-788.488) [-785.612] (-786.508) * (-790.906) (-784.164) (-785.131) [-785.509] -- 0:00:53
273000 -- (-794.089) [-783.954] (-786.534) (-784.779) * (-787.980) [-784.511] (-785.154) (-783.596) -- 0:00:53
273500 -- [-785.516] (-785.895) (-785.124) (-786.087) * (-785.851) (-784.666) [-788.035] (-783.618) -- 0:00:53
274000 -- (-787.926) [-785.426] (-783.477) (-786.192) * (-783.919) [-785.346] (-785.310) (-785.722) -- 0:00:52
274500 -- [-787.559] (-785.087) (-784.157) (-784.336) * (-785.795) (-787.060) (-785.376) [-784.843] -- 0:00:52
275000 -- (-792.624) (-785.115) [-788.474] (-785.454) * (-784.747) (-786.880) (-783.805) [-784.635] -- 0:00:52
Average standard deviation of split frequencies: 0.011766
275500 -- (-787.279) (-789.457) (-784.138) [-784.526] * (-784.216) (-785.106) [-788.671] (-786.836) -- 0:00:52
276000 -- (-786.912) (-784.353) [-784.481] (-786.033) * (-784.620) (-785.397) [-784.901] (-786.138) -- 0:00:52
276500 -- (-787.117) [-785.419] (-785.935) (-784.884) * (-784.391) (-790.440) [-786.336] (-787.356) -- 0:00:52
277000 -- [-785.492] (-783.992) (-784.618) (-786.958) * [-784.341] (-787.278) (-790.299) (-785.659) -- 0:00:52
277500 -- (-786.892) (-784.601) [-785.088] (-785.023) * [-785.267] (-787.963) (-785.943) (-785.254) -- 0:00:52
278000 -- (-784.040) (-786.214) (-784.060) [-783.546] * (-788.409) [-785.825] (-786.166) (-786.940) -- 0:00:51
278500 -- (-786.952) (-786.739) [-784.536] (-783.923) * (-789.111) (-784.198) [-784.619] (-787.432) -- 0:00:51
279000 -- (-784.792) (-786.455) [-784.256] (-787.317) * (-789.839) (-786.904) (-785.305) [-785.958] -- 0:00:51
279500 -- (-784.606) (-791.207) (-784.883) [-783.353] * (-787.526) [-787.458] (-784.520) (-784.153) -- 0:00:51
280000 -- (-785.411) [-786.427] (-787.392) (-785.511) * (-787.871) [-783.535] (-784.495) (-785.754) -- 0:00:51
Average standard deviation of split frequencies: 0.010824
280500 -- (-786.781) (-787.193) (-785.612) [-785.161] * (-785.790) (-783.949) (-788.266) [-785.138] -- 0:00:51
281000 -- [-784.007] (-787.618) (-787.902) (-784.764) * [-786.276] (-784.428) (-783.922) (-786.814) -- 0:00:51
281500 -- (-788.898) (-786.877) [-785.626] (-785.068) * [-785.173] (-783.726) (-788.551) (-788.984) -- 0:00:51
282000 -- [-790.631] (-784.794) (-784.790) (-784.020) * [-785.065] (-785.148) (-786.662) (-784.462) -- 0:00:50
282500 -- [-785.604] (-783.528) (-784.876) (-783.686) * (-784.480) [-783.674] (-784.517) (-785.087) -- 0:00:50
283000 -- (-785.900) (-784.122) (-786.655) [-784.453] * (-783.730) [-784.079] (-784.373) (-784.281) -- 0:00:50
283500 -- (-789.404) (-783.985) (-783.628) [-783.913] * (-783.949) (-784.530) [-786.420] (-785.516) -- 0:00:50
284000 -- (-787.540) (-783.532) [-785.493] (-785.666) * (-786.396) [-787.325] (-787.376) (-785.385) -- 0:00:50
284500 -- (-784.007) (-787.392) (-785.206) [-785.517] * [-786.313] (-789.978) (-784.234) (-784.696) -- 0:00:50
285000 -- (-783.528) (-785.521) (-784.154) [-785.507] * (-783.812) [-784.382] (-786.500) (-785.777) -- 0:00:50
Average standard deviation of split frequencies: 0.011829
285500 -- [-785.502] (-785.575) (-784.125) (-788.809) * (-787.514) (-785.427) [-784.660] (-785.137) -- 0:00:50
286000 -- (-785.370) (-785.039) [-785.348] (-787.088) * (-789.930) (-784.559) (-789.021) [-787.700] -- 0:00:49
286500 -- [-787.566] (-784.759) (-785.141) (-784.592) * (-786.937) [-785.369] (-785.006) (-794.464) -- 0:00:49
287000 -- (-784.800) (-785.038) (-787.198) [-784.025] * [-786.287] (-785.500) (-784.742) (-786.866) -- 0:00:52
287500 -- [-783.587] (-785.944) (-787.765) (-786.121) * [-786.806] (-788.573) (-783.253) (-784.745) -- 0:00:52
288000 -- [-784.279] (-784.398) (-787.758) (-786.120) * [-785.151] (-786.388) (-786.433) (-787.340) -- 0:00:51
288500 -- (-784.007) (-783.680) (-789.454) [-788.126] * (-785.001) (-786.476) [-785.439] (-788.973) -- 0:00:51
289000 -- [-784.531] (-786.127) (-785.138) (-787.288) * (-784.101) [-786.529] (-786.463) (-785.065) -- 0:00:51
289500 -- (-785.523) (-788.394) (-783.891) [-789.032] * (-785.354) (-785.304) [-785.395] (-786.800) -- 0:00:51
290000 -- [-784.204] (-787.630) (-784.501) (-783.612) * [-785.373] (-785.644) (-786.298) (-787.550) -- 0:00:51
Average standard deviation of split frequencies: 0.012593
290500 -- (-789.110) (-785.352) [-785.434] (-785.954) * (-787.857) [-788.626] (-788.325) (-785.860) -- 0:00:51
291000 -- (-789.073) [-784.174] (-783.937) (-784.290) * [-785.328] (-785.930) (-789.872) (-784.239) -- 0:00:51
291500 -- [-789.700] (-785.876) (-784.398) (-784.834) * (-785.028) (-785.325) (-791.189) [-784.909] -- 0:00:51
292000 -- (-786.376) (-785.166) (-785.189) [-786.486] * [-783.828] (-785.188) (-786.811) (-784.647) -- 0:00:50
292500 -- (-784.848) (-786.238) (-785.257) [-785.089] * (-786.779) (-784.877) [-786.171] (-786.516) -- 0:00:50
293000 -- (-787.671) (-783.485) [-786.079] (-789.595) * (-786.084) (-784.756) [-787.227] (-787.523) -- 0:00:50
293500 -- (-784.078) (-792.372) [-784.671] (-789.900) * [-786.631] (-785.968) (-792.625) (-787.214) -- 0:00:50
294000 -- (-784.342) [-785.633] (-786.297) (-787.524) * (-785.831) (-785.559) (-787.170) [-785.035] -- 0:00:50
294500 -- (-787.242) (-786.454) (-787.756) [-789.585] * (-789.902) (-784.959) (-789.084) [-783.975] -- 0:00:50
295000 -- (-786.197) (-784.457) [-785.811] (-788.766) * (-787.770) (-786.146) [-785.654] (-785.079) -- 0:00:50
Average standard deviation of split frequencies: 0.012179
295500 -- (-785.330) (-783.587) [-787.411] (-788.326) * (-784.964) [-790.073] (-785.025) (-786.121) -- 0:00:50
296000 -- (-784.696) [-785.125] (-786.968) (-787.071) * (-783.391) [-783.762] (-785.386) (-785.349) -- 0:00:49
296500 -- (-786.437) (-785.748) (-785.437) [-784.127] * [-784.524] (-787.459) (-791.943) (-785.004) -- 0:00:49
297000 -- (-785.739) [-784.080] (-786.365) (-793.778) * [-784.110] (-786.253) (-783.716) (-784.145) -- 0:00:49
297500 -- [-784.099] (-787.099) (-787.110) (-787.014) * [-784.885] (-790.143) (-787.008) (-790.121) -- 0:00:49
298000 -- (-786.549) [-785.291] (-793.358) (-783.872) * [-787.724] (-784.854) (-784.388) (-786.768) -- 0:00:49
298500 -- (-785.871) (-785.736) [-785.053] (-784.935) * (-787.444) (-783.711) (-783.748) [-784.645] -- 0:00:49
299000 -- (-785.182) (-785.838) [-785.228] (-785.822) * (-787.762) (-786.719) (-788.551) [-784.621] -- 0:00:49
299500 -- (-786.193) (-786.690) [-785.305] (-786.214) * (-787.631) (-784.448) [-785.763] (-785.163) -- 0:00:49
300000 -- (-784.407) (-786.402) (-785.085) [-787.085] * (-786.417) [-784.109] (-784.924) (-784.937) -- 0:00:48
Average standard deviation of split frequencies: 0.012194
300500 -- (-784.870) (-787.522) (-787.207) [-785.654] * (-786.224) (-788.349) (-783.389) [-786.370] -- 0:00:48
301000 -- (-788.924) (-790.338) (-786.666) [-786.980] * (-785.867) (-785.196) (-783.900) [-788.019] -- 0:00:48
301500 -- (-789.143) [-788.163] (-785.553) (-785.038) * [-785.116] (-785.695) (-785.080) (-786.235) -- 0:00:50
302000 -- (-786.965) [-789.072] (-787.083) (-785.718) * (-790.190) (-785.855) (-786.193) [-783.853] -- 0:00:50
302500 -- (-785.029) (-786.043) (-784.656) [-786.714] * (-788.845) [-784.212] (-784.752) (-786.161) -- 0:00:50
303000 -- [-785.118] (-787.968) (-784.545) (-786.923) * (-784.619) (-783.569) [-785.232] (-785.536) -- 0:00:50
303500 -- (-783.859) (-784.563) (-784.086) [-790.521] * (-785.541) (-784.537) (-784.320) [-785.837] -- 0:00:50
304000 -- [-786.820] (-789.714) (-786.134) (-786.146) * (-785.661) [-785.792] (-786.350) (-785.453) -- 0:00:50
304500 -- (-786.454) (-786.935) [-786.876] (-787.778) * (-784.220) (-786.198) [-785.678] (-785.085) -- 0:00:50
305000 -- (-787.346) [-784.072] (-786.161) (-784.769) * (-785.126) (-786.638) (-787.118) [-785.920] -- 0:00:50
Average standard deviation of split frequencies: 0.012892
305500 -- [-785.595] (-785.816) (-789.222) (-790.031) * [-788.417] (-783.568) (-785.370) (-785.927) -- 0:00:50
306000 -- (-791.033) (-784.211) (-786.591) [-784.679] * (-786.643) (-785.912) [-785.972] (-789.370) -- 0:00:49
306500 -- [-787.381] (-787.312) (-786.328) (-787.582) * (-784.766) (-785.211) (-787.693) [-785.529] -- 0:00:49
307000 -- (-785.227) [-786.251] (-786.293) (-785.801) * (-785.170) (-785.941) [-786.013] (-786.838) -- 0:00:49
307500 -- (-785.873) (-784.800) (-788.622) [-785.678] * (-786.534) [-784.860] (-784.394) (-784.631) -- 0:00:49
308000 -- [-784.859] (-787.659) (-785.353) (-784.852) * (-787.350) [-785.689] (-785.645) (-787.457) -- 0:00:49
308500 -- (-784.493) [-784.142] (-789.738) (-786.833) * (-784.137) (-785.129) (-787.450) [-785.697] -- 0:00:49
309000 -- [-784.924] (-785.861) (-786.970) (-789.762) * [-784.600] (-785.027) (-785.105) (-787.220) -- 0:00:49
309500 -- (-785.530) (-783.913) [-784.725] (-787.271) * (-784.605) (-785.821) (-788.881) [-786.652] -- 0:00:49
310000 -- (-786.070) [-787.622] (-788.109) (-788.607) * (-787.504) (-784.671) [-784.037] (-786.262) -- 0:00:48
Average standard deviation of split frequencies: 0.013657
310500 -- [-791.149] (-787.972) (-786.562) (-787.104) * [-787.140] (-784.039) (-788.388) (-788.244) -- 0:00:48
311000 -- (-786.451) (-789.991) [-785.149] (-784.662) * (-787.059) [-786.038] (-783.854) (-788.408) -- 0:00:48
311500 -- (-785.803) [-784.728] (-786.266) (-786.975) * (-788.403) (-790.884) [-784.088] (-787.837) -- 0:00:48
312000 -- (-786.194) (-784.065) (-785.460) [-785.646] * (-784.805) (-786.017) [-785.039] (-787.531) -- 0:00:48
312500 -- (-785.189) (-784.101) [-787.586] (-784.516) * [-784.028] (-786.373) (-784.804) (-786.775) -- 0:00:48
313000 -- (-787.944) (-786.751) [-786.787] (-785.009) * (-786.019) [-786.636] (-786.001) (-786.403) -- 0:00:48
313500 -- [-789.372] (-787.820) (-787.191) (-786.565) * (-788.286) (-785.949) [-787.110] (-786.836) -- 0:00:48
314000 -- (-784.965) (-786.738) [-785.330] (-784.041) * [-788.561] (-785.806) (-785.847) (-791.087) -- 0:00:48
314500 -- (-783.677) (-785.725) (-787.013) [-785.675] * (-787.257) [-785.914] (-784.589) (-783.845) -- 0:00:47
315000 -- (-786.031) [-785.423] (-785.178) (-785.875) * (-788.828) [-784.099] (-784.528) (-784.349) -- 0:00:47
Average standard deviation of split frequencies: 0.012987
315500 -- [-786.091] (-785.071) (-784.378) (-785.322) * (-784.543) [-785.759] (-785.193) (-787.926) -- 0:00:47
316000 -- [-786.031] (-788.659) (-784.927) (-783.672) * (-787.585) (-785.499) (-784.002) [-788.104] -- 0:00:47
316500 -- (-787.334) (-784.839) [-784.580] (-788.643) * (-783.467) [-785.766] (-785.779) (-786.808) -- 0:00:49
317000 -- (-785.157) [-783.821] (-784.051) (-783.649) * [-783.352] (-786.903) (-787.922) (-785.265) -- 0:00:49
317500 -- (-785.353) (-786.218) [-786.419] (-788.341) * (-783.755) [-785.035] (-786.750) (-787.868) -- 0:00:49
318000 -- (-786.331) [-786.018] (-788.638) (-789.571) * (-783.464) [-789.533] (-786.949) (-783.576) -- 0:00:49
318500 -- (-785.180) (-785.233) [-787.971] (-792.203) * [-785.473] (-785.361) (-787.890) (-783.959) -- 0:00:49
319000 -- (-784.975) [-785.444] (-787.388) (-787.319) * (-787.110) (-786.650) (-785.559) [-786.162] -- 0:00:49
319500 -- (-783.356) (-785.909) (-785.992) [-786.154] * [-783.911] (-787.720) (-789.001) (-785.159) -- 0:00:48
320000 -- [-785.864] (-784.220) (-785.913) (-786.282) * [-785.013] (-784.881) (-784.366) (-784.695) -- 0:00:48
Average standard deviation of split frequencies: 0.013802
320500 -- [-784.169] (-784.328) (-785.821) (-784.595) * [-784.292] (-784.348) (-783.643) (-784.435) -- 0:00:48
321000 -- (-786.675) [-785.947] (-784.878) (-786.374) * [-785.911] (-785.804) (-784.852) (-792.921) -- 0:00:48
321500 -- (-786.520) (-783.700) (-787.928) [-785.526] * [-785.751] (-785.732) (-786.042) (-788.054) -- 0:00:48
322000 -- (-787.608) (-786.656) [-784.828] (-785.991) * (-785.608) [-784.784] (-786.176) (-789.041) -- 0:00:48
322500 -- (-785.441) [-787.006] (-783.474) (-788.746) * (-785.122) (-787.954) [-786.015] (-786.466) -- 0:00:48
323000 -- (-785.513) (-785.203) (-786.331) [-786.038] * (-785.295) (-788.988) [-786.341] (-785.782) -- 0:00:48
323500 -- (-786.728) (-785.723) (-788.060) [-785.060] * [-783.788] (-785.468) (-785.576) (-787.810) -- 0:00:48
324000 -- (-784.748) (-784.732) [-789.935] (-786.081) * [-786.350] (-785.145) (-784.190) (-786.090) -- 0:00:47
324500 -- [-783.364] (-784.963) (-788.134) (-786.004) * [-788.825] (-784.901) (-786.281) (-784.399) -- 0:00:47
325000 -- (-783.887) (-787.174) [-786.148] (-788.268) * [-787.541] (-784.059) (-783.861) (-790.050) -- 0:00:47
Average standard deviation of split frequencies: 0.014460
325500 -- [-784.486] (-786.807) (-783.919) (-788.019) * (-785.969) (-785.198) [-785.371] (-787.805) -- 0:00:47
326000 -- [-783.460] (-788.565) (-785.183) (-786.956) * [-785.691] (-784.110) (-784.375) (-789.773) -- 0:00:47
326500 -- (-789.355) [-786.901] (-784.027) (-787.125) * (-786.586) [-784.089] (-785.378) (-785.705) -- 0:00:47
327000 -- (-785.016) [-787.577] (-784.552) (-783.962) * (-789.346) (-785.615) [-784.570] (-789.749) -- 0:00:47
327500 -- [-784.078] (-786.180) (-784.252) (-784.241) * (-784.531) (-784.673) [-784.380] (-787.686) -- 0:00:47
328000 -- [-785.206] (-785.963) (-784.783) (-786.587) * [-786.314] (-787.279) (-785.037) (-787.774) -- 0:00:47
328500 -- (-786.150) [-789.847] (-787.219) (-785.094) * (-789.622) (-786.873) (-786.019) [-787.285] -- 0:00:47
329000 -- [-784.936] (-789.544) (-788.490) (-784.670) * (-787.125) (-787.027) (-785.869) [-786.542] -- 0:00:46
329500 -- [-785.579] (-789.944) (-784.735) (-788.414) * (-787.034) [-786.298] (-787.835) (-785.255) -- 0:00:46
330000 -- (-783.559) (-789.212) (-786.518) [-784.091] * (-786.479) [-784.945] (-790.349) (-784.059) -- 0:00:46
Average standard deviation of split frequencies: 0.014177
330500 -- (-786.936) (-785.344) (-785.772) [-785.389] * (-786.584) (-787.201) [-785.283] (-785.692) -- 0:00:46
331000 -- (-784.337) (-787.077) (-785.578) [-784.879] * (-787.024) (-787.682) [-788.237] (-784.023) -- 0:00:46
331500 -- (-786.446) (-787.461) [-787.187] (-786.897) * (-783.954) [-785.378] (-785.093) (-784.089) -- 0:00:48
332000 -- (-785.374) [-785.805] (-786.156) (-785.294) * (-785.450) (-789.438) [-791.234] (-788.505) -- 0:00:48
332500 -- [-786.129] (-786.653) (-784.561) (-786.060) * (-784.331) (-788.107) (-798.737) [-789.755] -- 0:00:48
333000 -- [-785.215] (-785.448) (-785.988) (-783.498) * (-787.858) (-786.730) [-785.430] (-787.099) -- 0:00:48
333500 -- [-785.879] (-785.775) (-784.336) (-783.419) * (-787.530) (-783.734) [-785.486] (-785.751) -- 0:00:47
334000 -- (-785.697) [-786.135] (-784.007) (-786.472) * (-790.651) (-784.997) (-785.584) [-785.898] -- 0:00:47
334500 -- (-789.149) (-784.176) (-788.177) [-783.256] * (-787.307) (-784.349) [-783.970] (-784.156) -- 0:00:47
335000 -- (-784.030) [-784.121] (-784.686) (-785.091) * (-785.712) [-786.171] (-784.884) (-784.549) -- 0:00:47
Average standard deviation of split frequencies: 0.013173
335500 -- [-784.653] (-787.362) (-784.826) (-785.091) * (-785.711) [-786.083] (-784.404) (-787.666) -- 0:00:47
336000 -- (-785.173) [-787.311] (-789.097) (-784.975) * (-784.710) (-788.232) [-785.210] (-785.820) -- 0:00:47
336500 -- (-784.491) [-785.103] (-787.275) (-784.050) * (-785.552) (-786.267) (-784.265) [-786.488] -- 0:00:47
337000 -- (-784.202) (-787.343) [-784.192] (-785.426) * (-786.103) (-783.621) [-786.063] (-786.541) -- 0:00:47
337500 -- (-784.957) [-784.858] (-790.963) (-790.268) * (-786.125) [-784.786] (-787.866) (-785.716) -- 0:00:47
338000 -- (-788.461) [-787.166] (-786.460) (-787.898) * (-787.985) (-784.206) [-786.103] (-785.022) -- 0:00:47
338500 -- (-787.412) (-783.818) (-791.255) [-786.690] * [-785.935] (-786.252) (-785.321) (-786.859) -- 0:00:46
339000 -- (-785.162) [-784.147] (-788.760) (-784.919) * (-785.737) (-785.089) (-784.274) [-785.269] -- 0:00:46
339500 -- (-785.365) (-784.177) (-788.696) [-783.714] * (-786.005) [-785.011] (-785.094) (-785.199) -- 0:00:46
340000 -- [-784.710] (-785.714) (-783.748) (-784.124) * [-785.927] (-784.973) (-787.625) (-785.273) -- 0:00:46
Average standard deviation of split frequencies: 0.013349
340500 -- (-785.074) (-791.273) [-784.281] (-784.089) * (-787.470) (-784.631) (-786.582) [-786.556] -- 0:00:46
341000 -- (-785.518) (-784.166) [-788.365] (-784.602) * [-785.339] (-784.257) (-789.491) (-790.047) -- 0:00:46
341500 -- [-783.995] (-785.557) (-785.019) (-785.250) * (-791.175) (-788.384) [-785.085] (-785.874) -- 0:00:46
342000 -- (-785.452) (-785.205) (-786.250) [-784.432] * (-783.730) (-785.652) (-783.884) [-786.139] -- 0:00:46
342500 -- (-787.017) (-787.020) (-786.704) [-784.728] * (-785.294) (-784.944) [-783.409] (-786.233) -- 0:00:46
343000 -- (-788.048) (-788.347) (-786.439) [-789.740] * (-783.857) [-786.552] (-783.772) (-786.330) -- 0:00:45
343500 -- (-789.221) (-783.509) (-786.038) [-785.735] * (-787.931) [-785.720] (-787.850) (-787.056) -- 0:00:45
344000 -- (-783.328) (-785.147) (-786.577) [-784.462] * (-784.426) (-786.053) [-783.572] (-785.734) -- 0:00:45
344500 -- (-786.385) [-786.677] (-784.985) (-785.716) * [-783.650] (-784.110) (-784.293) (-786.231) -- 0:00:45
345000 -- (-784.660) [-785.071] (-785.594) (-785.412) * (-784.698) [-787.346] (-785.145) (-785.734) -- 0:00:45
Average standard deviation of split frequencies: 0.013624
345500 -- (-787.104) (-785.551) (-784.217) [-789.328] * (-785.511) (-786.867) (-785.464) [-784.091] -- 0:00:45
346000 -- (-785.275) [-785.202] (-784.119) (-788.551) * (-785.753) [-787.280] (-784.683) (-783.953) -- 0:00:45
346500 -- [-787.801] (-785.106) (-783.772) (-784.997) * (-784.936) (-786.557) (-784.300) [-784.286] -- 0:00:45
347000 -- (-786.351) (-785.543) [-785.549] (-790.911) * (-786.055) (-785.166) (-784.293) [-784.077] -- 0:00:47
347500 -- (-786.133) [-788.682] (-785.730) (-788.038) * (-788.409) [-787.445] (-784.455) (-785.003) -- 0:00:46
348000 -- [-790.129] (-785.380) (-783.893) (-783.719) * [-787.059] (-785.741) (-784.717) (-786.859) -- 0:00:46
348500 -- (-788.454) [-784.117] (-788.609) (-784.870) * (-786.139) (-787.741) (-784.604) [-785.536] -- 0:00:46
349000 -- (-787.866) (-783.436) [-784.130] (-783.774) * (-789.130) [-785.333] (-786.551) (-786.897) -- 0:00:46
349500 -- (-785.642) (-783.413) (-793.730) [-789.112] * (-786.709) (-785.726) (-787.831) [-784.657] -- 0:00:46
350000 -- [-784.493] (-788.446) (-784.668) (-786.900) * [-784.000] (-785.725) (-785.569) (-784.426) -- 0:00:46
Average standard deviation of split frequencies: 0.012995
350500 -- (-787.179) (-785.521) (-784.345) [-784.452] * (-784.343) (-783.697) (-785.499) [-785.172] -- 0:00:46
351000 -- (-788.729) (-784.808) (-783.634) [-788.069] * [-785.809] (-791.024) (-785.463) (-784.559) -- 0:00:46
351500 -- [-788.688] (-787.382) (-783.665) (-787.035) * (-784.228) (-789.234) [-786.892] (-785.951) -- 0:00:46
352000 -- [-785.168] (-786.984) (-785.559) (-784.933) * (-785.610) (-784.542) (-785.576) [-788.072] -- 0:00:46
352500 -- (-784.787) (-785.489) (-783.854) [-784.523] * [-786.290] (-783.983) (-786.040) (-784.353) -- 0:00:45
353000 -- [-784.455] (-783.815) (-783.650) (-786.525) * [-787.051] (-784.141) (-785.888) (-784.640) -- 0:00:45
353500 -- (-783.800) [-783.542] (-783.345) (-784.853) * (-787.475) [-785.423] (-785.007) (-784.235) -- 0:00:45
354000 -- (-786.240) (-784.539) (-784.216) [-785.237] * [-784.805] (-785.047) (-783.842) (-787.119) -- 0:00:45
354500 -- (-785.289) [-784.250] (-784.235) (-787.567) * (-783.749) (-784.657) (-785.030) [-787.085] -- 0:00:45
355000 -- (-787.395) (-784.518) [-784.154] (-788.053) * (-784.338) (-784.872) (-784.339) [-785.787] -- 0:00:45
Average standard deviation of split frequencies: 0.012580
355500 -- (-785.095) (-787.003) [-787.516] (-786.636) * (-784.526) [-785.421] (-785.894) (-785.193) -- 0:00:45
356000 -- (-787.588) [-783.550] (-788.028) (-785.512) * (-784.668) (-787.004) [-785.156] (-791.233) -- 0:00:45
356500 -- (-788.339) (-784.058) (-785.925) [-786.527] * [-784.593] (-785.481) (-784.919) (-784.965) -- 0:00:45
357000 -- (-785.193) (-784.310) (-788.726) [-785.674] * (-784.911) [-786.195] (-785.156) (-785.355) -- 0:00:45
357500 -- (-786.163) (-784.265) (-790.165) [-787.388] * (-785.273) (-788.094) (-789.904) [-784.445] -- 0:00:44
358000 -- (-784.561) [-788.269] (-783.788) (-786.993) * (-788.081) (-786.407) [-785.172] (-785.700) -- 0:00:44
358500 -- (-785.320) [-786.136] (-785.928) (-787.072) * (-788.677) (-786.870) [-784.399] (-786.370) -- 0:00:44
359000 -- [-783.582] (-785.171) (-786.938) (-783.413) * (-785.548) [-785.451] (-787.280) (-788.138) -- 0:00:44
359500 -- (-789.942) [-785.075] (-785.425) (-786.307) * (-783.666) [-785.122] (-787.922) (-787.066) -- 0:00:44
360000 -- (-784.297) [-784.508] (-783.750) (-788.972) * [-784.269] (-788.104) (-785.676) (-786.036) -- 0:00:44
Average standard deviation of split frequencies: 0.011302
360500 -- (-784.385) (-784.641) (-785.721) [-786.933] * (-783.613) (-790.245) (-783.605) [-784.537] -- 0:00:44
361000 -- (-784.583) [-784.429] (-786.395) (-785.294) * (-784.011) [-786.748] (-785.332) (-784.942) -- 0:00:44
361500 -- (-786.192) (-784.176) [-785.431] (-785.974) * (-784.912) (-789.522) (-785.864) [-785.265] -- 0:00:44
362000 -- (-786.537) (-785.773) [-785.481] (-786.998) * [-785.276] (-784.208) (-783.711) (-785.338) -- 0:00:45
362500 -- (-784.743) (-786.413) [-785.368] (-787.693) * (-785.056) [-784.751] (-785.323) (-786.664) -- 0:00:45
363000 -- [-787.537] (-786.384) (-784.257) (-786.734) * [-785.810] (-786.790) (-787.490) (-788.562) -- 0:00:45
363500 -- (-786.040) (-784.876) [-786.747] (-785.886) * (-784.469) (-786.236) [-786.660] (-787.214) -- 0:00:45
364000 -- [-784.798] (-785.950) (-787.900) (-784.943) * (-784.174) (-786.432) [-785.639] (-784.724) -- 0:00:45
364500 -- (-786.030) [-784.217] (-786.878) (-783.702) * (-786.529) [-783.666] (-785.311) (-784.485) -- 0:00:45
365000 -- [-784.708] (-785.720) (-787.871) (-786.833) * (-785.634) [-785.003] (-783.752) (-785.732) -- 0:00:45
Average standard deviation of split frequencies: 0.011321
365500 -- (-791.341) (-789.314) [-790.564] (-787.246) * (-785.336) [-786.140] (-784.272) (-786.949) -- 0:00:45
366000 -- (-787.105) (-787.041) [-787.175] (-785.325) * (-785.067) [-784.553] (-784.662) (-785.976) -- 0:00:45
366500 -- (-784.076) (-789.336) [-787.448] (-786.321) * [-783.826] (-785.771) (-785.355) (-788.701) -- 0:00:44
367000 -- (-783.871) (-784.818) [-785.677] (-786.613) * (-791.974) (-785.597) (-785.719) [-783.802] -- 0:00:44
367500 -- (-784.494) (-784.012) [-785.487] (-789.120) * (-787.344) (-784.571) (-785.064) [-785.789] -- 0:00:44
368000 -- [-784.617] (-784.200) (-785.349) (-788.356) * (-783.457) [-783.855] (-786.171) (-786.539) -- 0:00:44
368500 -- (-786.062) (-785.119) (-787.106) [-786.171] * (-784.111) [-784.649] (-785.037) (-786.335) -- 0:00:44
369000 -- [-785.111] (-787.898) (-783.772) (-785.752) * [-784.904] (-784.534) (-786.309) (-783.797) -- 0:00:44
369500 -- (-784.450) (-784.695) (-787.490) [-783.996] * [-784.862] (-783.690) (-788.248) (-791.753) -- 0:00:44
370000 -- (-786.243) [-785.418] (-786.804) (-785.007) * (-785.630) [-787.398] (-787.810) (-785.538) -- 0:00:44
Average standard deviation of split frequencies: 0.010643
370500 -- (-785.728) (-785.440) [-787.009] (-784.822) * (-786.745) [-786.658] (-788.470) (-784.574) -- 0:00:44
371000 -- [-788.222] (-784.143) (-787.435) (-787.772) * (-786.716) [-785.189] (-786.294) (-787.038) -- 0:00:44
371500 -- (-789.328) (-786.498) (-787.644) [-784.237] * (-784.185) (-788.693) (-784.857) [-787.253] -- 0:00:43
372000 -- (-784.464) (-786.768) (-787.382) [-785.877] * (-784.333) (-785.013) (-784.092) [-786.192] -- 0:00:43
372500 -- (-784.221) (-783.715) [-784.409] (-785.750) * (-787.150) (-792.478) [-784.960] (-784.500) -- 0:00:43
373000 -- (-783.643) [-786.094] (-786.561) (-783.762) * (-784.263) (-789.032) (-786.490) [-785.102] -- 0:00:43
373500 -- (-784.630) (-784.388) (-785.715) [-784.280] * (-787.598) [-789.806] (-786.350) (-789.059) -- 0:00:43
374000 -- (-784.834) (-784.756) (-787.725) [-784.674] * (-787.999) (-785.082) (-789.524) [-789.206] -- 0:00:43
374500 -- (-790.291) (-784.738) [-786.579] (-785.192) * (-786.920) [-784.534] (-786.051) (-785.748) -- 0:00:43
375000 -- (-788.751) (-786.007) (-786.367) [-786.040] * (-795.627) [-783.930] (-784.128) (-787.793) -- 0:00:43
Average standard deviation of split frequencies: 0.010726
375500 -- [-784.869] (-786.298) (-784.321) (-784.979) * (-786.348) [-784.205] (-784.046) (-787.419) -- 0:00:43
376000 -- (-784.654) (-785.680) (-784.521) [-784.222] * (-785.716) [-785.065] (-784.583) (-787.478) -- 0:00:43
376500 -- (-784.952) (-785.000) [-784.632] (-784.827) * (-785.875) (-785.210) [-784.125] (-785.242) -- 0:00:43
377000 -- [-786.815] (-787.371) (-784.095) (-786.022) * (-786.566) (-787.729) (-784.090) [-785.040] -- 0:00:44
377500 -- (-784.689) [-784.226] (-786.514) (-785.170) * (-786.811) [-788.231] (-786.332) (-790.447) -- 0:00:44
378000 -- (-784.679) [-785.220] (-789.928) (-784.740) * [-783.948] (-785.329) (-783.577) (-784.996) -- 0:00:44
378500 -- (-784.730) (-785.848) [-789.055] (-783.984) * (-784.826) (-784.395) (-784.052) [-784.356] -- 0:00:44
379000 -- (-783.879) (-787.026) [-791.696] (-788.747) * (-786.042) (-786.423) [-784.397] (-786.953) -- 0:00:44
379500 -- (-783.839) (-784.132) [-789.261] (-786.515) * (-786.741) (-785.445) [-784.900] (-785.493) -- 0:00:44
380000 -- [-786.058] (-783.243) (-793.418) (-784.127) * (-785.771) [-785.380] (-786.320) (-785.663) -- 0:00:44
Average standard deviation of split frequencies: 0.010198
380500 -- (-788.368) (-788.532) [-785.866] (-789.385) * (-785.527) (-788.302) (-784.663) [-784.900] -- 0:00:43
381000 -- (-786.154) (-783.876) (-783.472) [-787.107] * (-786.685) [-785.966] (-785.899) (-789.082) -- 0:00:43
381500 -- (-784.543) (-785.622) (-783.555) [-784.451] * (-786.302) [-787.448] (-785.083) (-791.696) -- 0:00:43
382000 -- (-784.549) (-783.456) [-788.830] (-790.174) * [-783.937] (-787.201) (-787.205) (-785.810) -- 0:00:43
382500 -- (-787.428) (-783.752) [-788.642] (-784.946) * [-785.685] (-785.342) (-788.835) (-784.235) -- 0:00:43
383000 -- (-786.984) [-785.147] (-788.211) (-792.270) * (-784.166) [-785.007] (-785.432) (-786.410) -- 0:00:43
383500 -- (-785.492) [-785.468] (-786.485) (-788.279) * [-785.017] (-785.815) (-785.653) (-787.406) -- 0:00:43
384000 -- (-785.844) (-788.981) (-785.962) [-783.919] * (-785.068) [-788.467] (-786.112) (-784.463) -- 0:00:43
384500 -- (-785.551) [-788.065] (-785.329) (-786.032) * [-786.095] (-787.866) (-787.525) (-785.072) -- 0:00:43
385000 -- (-786.505) (-785.868) [-783.822] (-785.962) * [-785.934] (-783.454) (-785.420) (-784.558) -- 0:00:43
Average standard deviation of split frequencies: 0.010313
385500 -- (-783.661) (-787.292) [-786.068] (-787.310) * (-783.714) (-785.744) [-784.121] (-787.798) -- 0:00:43
386000 -- (-784.376) (-790.920) (-789.676) [-783.915] * [-788.656] (-787.341) (-785.442) (-788.203) -- 0:00:42
386500 -- (-784.595) [-788.129] (-785.917) (-785.039) * (-784.337) (-788.914) [-784.913] (-787.626) -- 0:00:42
387000 -- (-784.548) (-790.562) (-788.447) [-786.354] * [-787.136] (-785.405) (-785.460) (-785.181) -- 0:00:42
387500 -- (-787.472) (-785.117) (-788.292) [-787.266] * (-784.261) (-784.214) [-785.415] (-785.065) -- 0:00:42
388000 -- (-785.921) (-785.411) [-785.315] (-787.471) * (-789.524) (-784.567) [-784.128] (-788.630) -- 0:00:42
388500 -- (-789.259) (-784.070) (-784.588) [-788.004] * (-787.236) (-784.545) (-785.940) [-783.269] -- 0:00:42
389000 -- (-783.882) (-785.040) (-784.140) [-785.475] * [-783.878] (-784.785) (-784.274) (-785.850) -- 0:00:42
389500 -- (-784.488) (-784.888) [-783.568] (-788.824) * [-784.409] (-783.519) (-784.274) (-783.475) -- 0:00:42
390000 -- (-783.974) [-785.874] (-784.150) (-785.931) * (-784.265) [-784.662] (-788.142) (-784.089) -- 0:00:42
Average standard deviation of split frequencies: 0.010525
390500 -- [-784.462] (-790.095) (-786.540) (-784.691) * (-786.585) (-784.094) (-784.319) [-786.006] -- 0:00:42
391000 -- (-785.458) (-786.941) (-785.562) [-785.087] * (-786.233) (-784.808) (-783.517) [-787.138] -- 0:00:42
391500 -- [-784.169] (-788.844) (-785.724) (-786.622) * (-784.943) (-785.393) [-784.663] (-786.593) -- 0:00:43
392000 -- (-785.482) [-787.338] (-784.046) (-795.261) * (-786.539) (-785.387) (-784.154) [-785.213] -- 0:00:43
392500 -- (-785.397) (-786.116) (-784.451) [-790.777] * [-785.961] (-788.963) (-784.119) (-784.336) -- 0:00:43
393000 -- (-787.445) (-783.716) [-784.714] (-784.808) * (-785.227) (-784.711) (-784.944) [-786.103] -- 0:00:43
393500 -- [-785.530] (-784.408) (-786.004) (-785.261) * (-786.340) (-784.088) (-786.270) [-790.532] -- 0:00:43
394000 -- (-790.826) (-784.993) [-785.217] (-783.263) * (-787.628) (-786.252) [-786.108] (-792.041) -- 0:00:43
394500 -- (-785.988) (-786.045) (-784.755) [-783.486] * (-783.393) (-787.707) (-786.619) [-785.679] -- 0:00:42
395000 -- [-786.113] (-784.909) (-786.203) (-783.717) * (-784.167) (-787.431) [-786.431] (-785.497) -- 0:00:42
Average standard deviation of split frequencies: 0.010515
395500 -- (-784.815) (-784.633) (-784.498) [-784.937] * [-786.894] (-785.726) (-786.723) (-785.379) -- 0:00:42
396000 -- (-784.278) (-786.972) [-787.619] (-787.002) * [-786.687] (-786.035) (-791.134) (-785.552) -- 0:00:42
396500 -- [-784.926] (-785.365) (-786.108) (-786.946) * (-784.915) (-785.434) [-786.979] (-784.254) -- 0:00:42
397000 -- (-787.150) [-787.842] (-786.737) (-789.115) * (-788.374) (-788.566) (-785.397) [-784.317] -- 0:00:42
397500 -- [-785.516] (-784.951) (-784.955) (-786.754) * (-788.622) (-785.903) (-783.523) [-785.281] -- 0:00:42
398000 -- (-787.234) [-788.444] (-784.828) (-784.598) * (-788.116) (-784.706) [-786.532] (-784.412) -- 0:00:42
398500 -- (-790.783) [-785.786] (-785.067) (-784.949) * (-788.494) [-786.562] (-785.974) (-785.585) -- 0:00:42
399000 -- (-785.019) (-785.537) (-786.249) [-785.577] * (-784.384) (-786.341) [-785.014] (-786.674) -- 0:00:42
399500 -- [-785.370] (-786.544) (-786.284) (-788.067) * [-784.472] (-786.603) (-787.976) (-788.314) -- 0:00:42
400000 -- (-783.519) (-787.445) [-784.103] (-784.111) * (-786.665) (-787.963) (-786.048) [-786.385] -- 0:00:41
Average standard deviation of split frequencies: 0.009274
400500 -- (-783.337) [-785.838] (-786.785) (-784.665) * (-784.612) (-789.018) [-785.041] (-786.991) -- 0:00:41
401000 -- (-784.419) [-785.014] (-785.629) (-784.441) * (-786.273) [-786.459] (-785.829) (-786.019) -- 0:00:41
401500 -- (-784.663) (-783.733) [-785.704] (-784.386) * (-785.712) [-783.467] (-786.814) (-787.069) -- 0:00:41
402000 -- (-787.652) [-784.088] (-787.030) (-785.343) * [-784.649] (-784.118) (-786.884) (-785.855) -- 0:00:41
402500 -- (-785.050) (-784.968) [-785.185] (-783.871) * [-786.486] (-785.693) (-788.326) (-783.445) -- 0:00:41
403000 -- (-786.747) [-784.618] (-787.821) (-788.210) * (-787.148) (-786.068) [-786.495] (-784.595) -- 0:00:41
403500 -- (-785.061) [-785.568] (-785.350) (-783.979) * (-785.381) (-785.074) [-788.310] (-788.138) -- 0:00:41
404000 -- (-785.189) [-784.264] (-785.293) (-787.728) * (-785.701) (-789.041) (-786.357) [-784.258] -- 0:00:41
404500 -- (-785.328) (-789.879) (-786.501) [-790.809] * (-786.598) (-784.439) [-785.436] (-783.991) -- 0:00:41
405000 -- (-784.418) (-790.880) [-785.004] (-788.315) * (-783.608) (-786.722) (-785.487) [-785.790] -- 0:00:41
Average standard deviation of split frequencies: 0.008837
405500 -- (-785.708) (-786.836) (-788.466) [-786.989] * (-784.596) (-785.846) [-785.309] (-787.292) -- 0:00:42
406000 -- (-787.103) (-786.740) [-785.454] (-788.818) * (-787.648) [-785.560] (-783.905) (-785.739) -- 0:00:42
406500 -- [-784.561] (-784.952) (-784.479) (-785.207) * [-788.791] (-787.566) (-784.979) (-787.611) -- 0:00:42
407000 -- [-784.883] (-784.686) (-786.477) (-785.336) * [-787.806] (-784.805) (-786.680) (-787.171) -- 0:00:42
407500 -- (-783.837) (-785.564) (-791.357) [-784.147] * (-786.567) (-784.360) [-788.142] (-785.740) -- 0:00:42
408000 -- [-785.197] (-794.116) (-784.977) (-784.606) * (-785.478) (-788.647) (-787.354) [-786.797] -- 0:00:42
408500 -- [-786.783] (-789.223) (-786.251) (-788.244) * (-784.940) (-788.296) [-788.558] (-784.119) -- 0:00:41
409000 -- (-785.860) (-785.594) (-787.058) [-788.994] * (-784.629) [-785.032] (-784.347) (-787.490) -- 0:00:41
409500 -- (-789.637) (-788.233) [-785.468] (-785.355) * (-784.628) [-786.048] (-785.190) (-788.174) -- 0:00:41
410000 -- (-784.659) (-787.377) (-785.246) [-786.125] * (-784.545) (-790.571) [-783.983] (-785.290) -- 0:00:41
Average standard deviation of split frequencies: 0.008992
410500 -- [-786.569] (-787.754) (-787.293) (-783.764) * (-784.929) [-788.054] (-785.694) (-785.673) -- 0:00:41
411000 -- (-783.432) (-787.462) (-785.508) [-785.145] * [-786.541] (-787.461) (-786.399) (-786.576) -- 0:00:41
411500 -- (-785.202) (-784.625) [-785.069] (-785.529) * (-789.933) (-789.709) [-784.734] (-786.327) -- 0:00:41
412000 -- (-786.587) (-784.212) [-785.658] (-788.613) * (-788.391) [-786.132] (-786.021) (-784.556) -- 0:00:41
412500 -- (-786.138) [-786.805] (-784.215) (-788.217) * [-787.835] (-784.886) (-791.124) (-788.259) -- 0:00:41
413000 -- [-790.994] (-788.750) (-790.901) (-784.841) * (-789.020) [-785.550] (-785.811) (-785.929) -- 0:00:41
413500 -- (-787.252) (-786.521) [-789.690] (-787.308) * (-788.573) (-784.900) (-789.855) [-785.493] -- 0:00:41
414000 -- (-785.073) (-786.361) [-788.188] (-786.525) * (-789.321) (-785.733) (-785.455) [-784.810] -- 0:00:41
414500 -- (-785.792) [-788.116] (-786.912) (-785.471) * (-785.942) (-784.370) [-783.783] (-784.380) -- 0:00:40
415000 -- (-784.969) (-785.232) (-784.528) [-784.645] * [-786.635] (-783.809) (-786.318) (-783.700) -- 0:00:40
Average standard deviation of split frequencies: 0.008877
415500 -- [-785.394] (-785.494) (-785.552) (-789.910) * [-787.877] (-786.643) (-785.601) (-785.726) -- 0:00:40
416000 -- [-785.723] (-785.579) (-784.623) (-788.348) * [-785.613] (-783.551) (-786.180) (-785.726) -- 0:00:40
416500 -- (-786.322) (-787.769) (-785.071) [-785.137] * (-785.494) [-785.413] (-785.409) (-788.363) -- 0:00:40
417000 -- (-788.916) (-787.656) [-783.943] (-784.847) * (-785.478) [-783.876] (-785.771) (-786.630) -- 0:00:40
417500 -- [-790.009] (-786.278) (-786.726) (-786.630) * (-788.557) (-784.639) (-786.769) [-787.566] -- 0:00:40
418000 -- (-786.354) [-784.254] (-793.790) (-784.374) * (-786.980) (-786.687) (-788.490) [-785.884] -- 0:00:40
418500 -- (-785.494) (-784.260) (-788.491) [-784.957] * (-786.416) [-784.812] (-786.039) (-789.179) -- 0:00:40
419000 -- (-784.955) (-784.356) [-787.395] (-788.641) * (-788.720) [-785.024] (-784.721) (-790.824) -- 0:00:40
419500 -- (-786.954) [-783.726] (-784.108) (-786.930) * (-789.498) [-784.751] (-785.712) (-789.863) -- 0:00:40
420000 -- (-786.186) (-786.112) (-787.917) [-785.537] * (-784.233) [-786.319] (-784.971) (-787.204) -- 0:00:40
Average standard deviation of split frequencies: 0.009294
420500 -- (-786.670) (-785.286) (-785.010) [-786.887] * (-787.043) (-784.136) (-785.941) [-784.029] -- 0:00:41
421000 -- (-785.024) (-783.634) (-784.531) [-785.303] * (-787.466) (-786.725) (-788.344) [-784.726] -- 0:00:41
421500 -- (-787.443) [-784.632] (-787.097) (-784.131) * [-784.712] (-788.692) (-787.346) (-786.074) -- 0:00:41
422000 -- (-786.717) (-786.782) [-784.642] (-784.998) * [-784.094] (-788.730) (-784.238) (-786.773) -- 0:00:41
422500 -- (-786.246) (-786.746) [-783.823] (-789.024) * [-783.828] (-784.035) (-787.532) (-787.252) -- 0:00:41
423000 -- (-786.525) (-784.063) [-783.493] (-786.249) * (-785.692) [-790.059] (-791.019) (-786.727) -- 0:00:40
423500 -- (-788.086) (-784.814) [-783.401] (-784.578) * (-788.132) [-786.332] (-785.888) (-784.389) -- 0:00:40
424000 -- [-786.557] (-788.760) (-784.180) (-786.706) * (-785.169) (-785.841) (-785.111) [-785.090] -- 0:00:40
424500 -- (-786.890) [-784.840] (-784.525) (-787.130) * [-783.920] (-785.566) (-785.223) (-783.880) -- 0:00:40
425000 -- (-787.144) (-786.243) [-785.725] (-784.262) * [-784.875] (-784.087) (-787.736) (-784.104) -- 0:00:40
Average standard deviation of split frequencies: 0.009529
425500 -- (-785.761) [-785.492] (-785.513) (-785.142) * (-785.083) [-784.128] (-786.204) (-786.132) -- 0:00:40
426000 -- (-785.048) (-788.306) [-785.451] (-784.265) * [-786.607] (-785.991) (-783.902) (-786.148) -- 0:00:40
426500 -- (-784.195) (-789.171) (-784.127) [-784.591] * (-788.561) (-788.028) [-784.276] (-786.691) -- 0:00:40
427000 -- (-784.853) [-786.031] (-784.343) (-786.365) * (-788.938) [-787.563] (-786.849) (-786.948) -- 0:00:40
427500 -- [-783.723] (-788.656) (-786.021) (-784.869) * (-787.877) (-785.819) (-785.182) [-785.660] -- 0:00:40
428000 -- (-784.610) (-791.594) [-784.100] (-786.692) * (-797.601) [-786.912] (-784.540) (-790.343) -- 0:00:40
428500 -- (-787.982) (-792.424) (-790.912) [-785.725] * (-797.782) [-786.110] (-785.133) (-787.734) -- 0:00:40
429000 -- [-786.324] (-785.752) (-785.573) (-785.489) * (-785.938) [-788.787] (-784.877) (-786.220) -- 0:00:39
429500 -- (-787.339) (-787.638) (-786.517) [-784.769] * (-784.694) (-785.980) [-785.044] (-784.769) -- 0:00:39
430000 -- (-784.953) (-785.799) (-789.907) [-786.188] * [-783.804] (-784.860) (-785.099) (-784.136) -- 0:00:39
Average standard deviation of split frequencies: 0.009426
430500 -- [-785.824] (-786.087) (-794.131) (-787.592) * (-785.118) (-788.553) [-783.908] (-784.907) -- 0:00:39
431000 -- (-787.031) [-785.810] (-791.291) (-784.847) * (-787.394) (-784.468) (-787.391) [-783.991] -- 0:00:39
431500 -- (-783.816) (-785.648) [-785.689] (-786.718) * (-785.432) (-787.728) [-788.146] (-784.294) -- 0:00:39
432000 -- (-785.247) [-785.515] (-784.007) (-785.739) * (-786.110) (-785.577) (-784.500) [-783.912] -- 0:00:39
432500 -- (-783.792) (-783.791) (-784.275) [-783.792] * (-783.394) [-784.858] (-785.183) (-783.682) -- 0:00:39
433000 -- (-786.522) (-783.378) (-784.523) [-790.959] * (-784.116) (-787.313) (-784.935) [-786.352] -- 0:00:39
433500 -- (-783.518) [-783.471] (-786.601) (-783.786) * (-785.605) (-788.790) [-784.539] (-787.955) -- 0:00:39
434000 -- (-785.611) (-788.008) (-787.193) [-787.461] * (-788.361) [-785.112] (-786.254) (-786.089) -- 0:00:39
434500 -- (-788.972) (-787.672) (-786.079) [-785.912] * (-786.500) (-786.213) [-785.911] (-784.401) -- 0:00:39
435000 -- (-789.521) [-785.003] (-785.380) (-786.657) * (-784.522) (-784.118) [-785.550] (-785.965) -- 0:00:40
Average standard deviation of split frequencies: 0.009190
435500 -- (-785.208) [-784.079] (-788.168) (-785.914) * [-784.555] (-787.124) (-786.461) (-784.686) -- 0:00:40
436000 -- (-788.754) (-786.445) [-790.336] (-786.343) * (-784.331) [-786.718] (-786.063) (-785.636) -- 0:00:40
436500 -- (-783.932) (-785.920) (-784.084) [-787.316] * (-785.253) (-785.460) [-785.912] (-785.581) -- 0:00:40
437000 -- (-784.847) (-787.145) (-785.296) [-783.594] * (-785.078) [-784.291] (-785.224) (-786.163) -- 0:00:39
437500 -- (-785.690) [-785.679] (-784.813) (-785.717) * (-785.632) [-784.745] (-785.752) (-785.556) -- 0:00:39
438000 -- (-785.138) [-785.462] (-784.377) (-784.063) * [-784.254] (-784.768) (-787.547) (-783.702) -- 0:00:39
438500 -- [-784.856] (-785.751) (-783.742) (-784.159) * [-785.097] (-784.475) (-785.185) (-784.235) -- 0:00:39
439000 -- (-783.757) (-784.082) [-785.285] (-785.740) * [-784.200] (-785.033) (-783.864) (-784.636) -- 0:00:39
439500 -- [-787.322] (-785.316) (-784.136) (-786.767) * [-784.067] (-785.331) (-783.602) (-784.021) -- 0:00:39
440000 -- (-784.568) [-784.852] (-783.666) (-783.931) * (-783.718) [-785.209] (-785.884) (-784.447) -- 0:00:39
Average standard deviation of split frequencies: 0.009568
440500 -- (-785.422) [-785.132] (-784.074) (-784.657) * (-784.631) (-785.446) (-786.171) [-783.876] -- 0:00:39
441000 -- (-785.154) (-785.578) (-784.074) [-786.687] * (-784.888) [-783.579] (-789.121) (-784.095) -- 0:00:39
441500 -- [-786.142] (-785.732) (-783.573) (-785.000) * (-783.461) (-784.140) [-787.991] (-784.438) -- 0:00:39
442000 -- (-785.248) [-783.278] (-784.545) (-786.879) * (-784.644) (-787.377) [-784.446] (-790.953) -- 0:00:39
442500 -- (-786.527) [-785.554] (-786.321) (-784.450) * [-785.403] (-786.696) (-785.430) (-785.954) -- 0:00:39
443000 -- (-783.776) [-792.831] (-785.647) (-784.822) * (-788.247) (-788.397) (-784.578) [-789.040] -- 0:00:38
443500 -- (-784.102) (-784.649) (-783.993) [-785.283] * (-785.436) (-787.294) [-786.707] (-784.312) -- 0:00:38
444000 -- (-788.608) (-785.624) [-786.349] (-785.860) * [-784.602] (-791.701) (-786.251) (-784.759) -- 0:00:38
444500 -- (-785.700) (-785.412) (-786.196) [-784.842] * (-784.347) [-785.476] (-787.381) (-785.461) -- 0:00:38
445000 -- (-783.488) (-784.988) (-785.438) [-784.104] * (-785.772) (-787.323) [-786.026] (-788.481) -- 0:00:38
Average standard deviation of split frequencies: 0.009982
445500 -- (-787.505) (-784.382) (-784.826) [-783.290] * [-786.196] (-787.692) (-786.212) (-786.753) -- 0:00:38
446000 -- (-785.727) [-786.695] (-787.373) (-783.903) * (-784.340) [-787.922] (-785.843) (-787.090) -- 0:00:38
446500 -- (-789.448) (-788.097) [-787.917] (-785.218) * (-785.955) [-784.226] (-783.749) (-784.131) -- 0:00:38
447000 -- [-786.932] (-784.706) (-785.110) (-786.405) * (-788.053) (-784.559) (-786.379) [-785.638] -- 0:00:38
447500 -- (-789.726) (-785.419) (-785.526) [-785.761] * (-783.365) (-788.491) (-784.944) [-786.497] -- 0:00:38
448000 -- (-788.002) (-784.380) [-785.387] (-785.328) * (-785.541) (-786.702) [-789.779] (-788.249) -- 0:00:38
448500 -- [-786.973] (-789.702) (-786.661) (-785.699) * (-785.710) [-787.165] (-788.650) (-785.794) -- 0:00:38
449000 -- [-785.828] (-787.194) (-784.546) (-786.345) * (-786.956) (-796.815) [-785.597] (-785.176) -- 0:00:39
449500 -- (-784.997) (-791.890) [-787.677] (-784.921) * [-784.634] (-797.063) (-786.521) (-786.370) -- 0:00:39
450000 -- (-786.516) (-785.437) (-785.888) [-786.616] * (-784.463) (-793.530) [-785.545] (-789.451) -- 0:00:39
Average standard deviation of split frequencies: 0.009705
450500 -- (-787.155) (-787.170) [-784.636] (-786.304) * (-785.797) (-785.433) (-785.720) [-786.392] -- 0:00:39
451000 -- (-786.253) (-788.020) [-787.965] (-785.855) * [-784.239] (-785.701) (-786.972) (-785.576) -- 0:00:38
451500 -- (-786.162) (-786.857) (-788.534) [-787.322] * (-783.471) (-786.231) [-784.830] (-783.883) -- 0:00:38
452000 -- (-786.128) (-787.503) (-786.792) [-784.065] * (-788.101) (-784.810) (-785.829) [-786.425] -- 0:00:38
452500 -- [-785.751] (-784.591) (-784.115) (-784.609) * [-784.591] (-786.318) (-790.121) (-784.358) -- 0:00:38
453000 -- (-786.525) (-786.923) [-785.988] (-784.230) * (-787.383) (-785.002) (-791.462) [-784.353] -- 0:00:38
453500 -- [-786.503] (-784.596) (-785.269) (-784.308) * (-787.326) (-785.326) [-788.484] (-786.801) -- 0:00:38
454000 -- (-788.825) (-784.464) [-784.577] (-783.769) * (-786.859) (-784.625) (-785.089) [-784.100] -- 0:00:38
454500 -- [-789.285] (-787.251) (-786.577) (-787.833) * (-787.305) [-785.706] (-785.828) (-783.958) -- 0:00:38
455000 -- (-789.101) (-792.711) [-789.551] (-788.992) * (-787.245) [-786.470] (-786.668) (-784.932) -- 0:00:38
Average standard deviation of split frequencies: 0.010051
455500 -- (-785.984) (-784.844) [-787.072] (-787.140) * (-784.909) [-785.127] (-789.255) (-785.394) -- 0:00:38
456000 -- (-787.533) [-785.463] (-784.162) (-785.727) * (-785.714) (-783.315) [-784.280] (-784.464) -- 0:00:38
456500 -- (-784.739) (-785.734) (-783.893) [-784.256] * (-785.936) (-789.737) (-784.284) [-784.863] -- 0:00:38
457000 -- (-787.199) (-787.533) [-785.448] (-785.840) * (-786.634) [-787.566] (-786.104) (-785.534) -- 0:00:38
457500 -- (-786.029) (-784.964) (-786.683) [-786.689] * (-785.092) (-786.478) (-788.564) [-789.122] -- 0:00:37
458000 -- [-783.735] (-783.771) (-786.253) (-791.476) * [-788.541] (-787.918) (-787.127) (-788.372) -- 0:00:37
458500 -- (-784.557) (-784.900) [-785.635] (-786.374) * [-784.052] (-785.661) (-789.200) (-786.979) -- 0:00:37
459000 -- (-785.750) (-784.792) [-786.902] (-788.688) * (-783.704) (-785.613) (-784.515) [-784.481] -- 0:00:37
459500 -- [-784.791] (-784.356) (-784.849) (-786.182) * (-785.256) (-785.476) (-788.609) [-783.628] -- 0:00:37
460000 -- (-785.580) (-786.715) (-791.389) [-784.129] * (-788.997) (-785.163) (-786.476) [-783.802] -- 0:00:37
Average standard deviation of split frequencies: 0.009892
460500 -- (-788.137) (-783.908) (-784.877) [-783.315] * (-790.917) (-786.884) [-786.105] (-787.650) -- 0:00:37
461000 -- (-788.895) (-784.351) [-786.243] (-785.682) * (-786.263) (-784.969) (-786.373) [-787.064] -- 0:00:37
461500 -- (-785.601) [-786.838] (-784.066) (-787.851) * (-786.263) (-787.199) [-790.352] (-785.054) -- 0:00:37
462000 -- (-785.218) [-785.689] (-784.639) (-786.757) * [-785.256] (-784.300) (-785.658) (-783.659) -- 0:00:37
462500 -- (-784.514) (-788.328) (-786.368) [-784.239] * [-783.654] (-785.960) (-785.942) (-787.085) -- 0:00:37
463000 -- [-786.087] (-794.984) (-787.927) (-784.238) * [-783.727] (-784.515) (-788.390) (-785.340) -- 0:00:37
463500 -- (-783.825) (-790.801) [-788.159] (-787.992) * (-784.090) (-785.734) [-783.880] (-791.020) -- 0:00:37
464000 -- (-785.914) (-784.903) (-785.682) [-785.956] * (-786.923) [-786.974] (-784.663) (-788.854) -- 0:00:38
464500 -- (-783.614) [-784.361] (-783.432) (-788.203) * (-788.878) (-783.947) [-784.223] (-784.806) -- 0:00:38
465000 -- [-785.736] (-785.155) (-784.000) (-787.970) * (-787.115) (-784.392) (-785.882) [-788.319] -- 0:00:37
Average standard deviation of split frequencies: 0.009891
465500 -- [-784.355] (-786.064) (-784.731) (-783.616) * (-787.839) [-785.540] (-785.285) (-788.061) -- 0:00:37
466000 -- (-787.241) (-786.448) (-786.788) [-784.273] * [-786.824] (-788.048) (-788.475) (-784.324) -- 0:00:37
466500 -- (-784.930) (-785.061) (-784.906) [-787.127] * (-789.205) (-787.171) [-784.274] (-785.411) -- 0:00:37
467000 -- (-787.287) [-785.481] (-789.713) (-786.196) * (-788.602) [-784.472] (-784.189) (-784.434) -- 0:00:37
467500 -- (-785.823) (-789.390) [-787.227] (-785.738) * [-787.674] (-788.105) (-783.535) (-785.488) -- 0:00:37
468000 -- (-786.373) [-788.257] (-784.314) (-783.850) * (-785.129) (-786.098) (-785.698) [-784.401] -- 0:00:37
468500 -- (-786.755) (-788.861) (-784.170) [-783.998] * [-783.799] (-785.157) (-788.627) (-784.551) -- 0:00:37
469000 -- (-790.502) (-784.605) (-794.200) [-784.499] * (-785.540) (-787.003) (-788.839) [-786.633] -- 0:00:37
469500 -- (-789.173) (-785.095) (-786.902) [-784.237] * (-787.146) (-785.586) [-786.248] (-787.321) -- 0:00:37
470000 -- (-787.934) [-784.013] (-785.647) (-789.266) * [-785.173] (-787.747) (-789.765) (-785.357) -- 0:00:37
Average standard deviation of split frequencies: 0.009070
470500 -- (-789.242) [-784.291] (-783.802) (-786.601) * [-785.394] (-785.140) (-784.861) (-788.648) -- 0:00:37
471000 -- (-790.891) (-784.751) [-789.983] (-786.437) * (-786.617) (-786.564) (-786.949) [-783.873] -- 0:00:37
471500 -- (-788.567) (-784.799) (-787.118) [-784.054] * (-786.750) [-784.491] (-785.857) (-787.096) -- 0:00:36
472000 -- (-785.148) [-787.353] (-787.637) (-784.044) * [-784.395] (-785.169) (-783.853) (-785.421) -- 0:00:36
472500 -- (-788.414) (-785.876) (-783.831) [-788.986] * (-786.161) [-786.048] (-784.938) (-787.991) -- 0:00:36
473000 -- (-786.575) [-785.771] (-784.562) (-785.644) * [-785.405] (-790.569) (-787.634) (-784.600) -- 0:00:36
473500 -- [-784.137] (-784.375) (-787.065) (-784.133) * (-788.684) (-787.589) (-786.987) [-787.209] -- 0:00:36
474000 -- (-785.431) (-792.660) [-786.284] (-784.061) * [-786.199] (-785.353) (-787.011) (-788.139) -- 0:00:36
474500 -- (-786.654) (-790.144) (-784.602) [-785.471] * (-787.565) [-785.420] (-784.991) (-785.762) -- 0:00:36
475000 -- [-786.563] (-785.542) (-783.875) (-786.136) * (-783.761) (-787.134) (-788.426) [-785.299] -- 0:00:36
Average standard deviation of split frequencies: 0.009188
475500 -- [-784.721] (-787.848) (-788.400) (-790.874) * (-784.686) (-787.089) (-786.550) [-785.155] -- 0:00:36
476000 -- (-786.292) (-791.487) [-784.286] (-787.531) * (-784.688) (-787.096) (-785.378) [-785.724] -- 0:00:36
476500 -- [-787.519] (-786.445) (-786.517) (-786.318) * (-784.996) (-789.386) [-783.730] (-793.239) -- 0:00:36
477000 -- (-784.574) [-783.977] (-794.091) (-788.211) * (-785.076) (-784.967) [-786.618] (-786.950) -- 0:00:36
477500 -- (-785.642) (-784.862) (-786.601) [-788.985] * (-785.608) (-786.277) (-784.348) [-787.083] -- 0:00:36
478000 -- (-789.998) (-784.747) [-786.040] (-785.660) * [-786.269] (-787.489) (-784.514) (-786.554) -- 0:00:36
478500 -- (-786.948) [-784.314] (-784.626) (-788.254) * (-784.152) (-786.561) [-784.392] (-791.822) -- 0:00:37
479000 -- [-785.482] (-784.229) (-785.349) (-790.687) * [-783.271] (-785.482) (-785.422) (-783.339) -- 0:00:36
479500 -- (-785.567) [-785.221] (-785.713) (-788.264) * (-785.391) [-786.094] (-789.692) (-785.972) -- 0:00:36
480000 -- (-785.799) (-784.552) [-784.628] (-783.775) * [-784.963] (-787.427) (-784.958) (-784.434) -- 0:00:36
Average standard deviation of split frequencies: 0.009461
480500 -- [-788.850] (-786.761) (-784.742) (-785.720) * (-786.143) [-785.119] (-784.157) (-784.350) -- 0:00:36
481000 -- (-786.679) (-786.035) (-785.558) [-784.553] * (-786.233) (-783.872) [-783.636] (-785.376) -- 0:00:36
481500 -- [-787.287] (-788.926) (-784.935) (-785.697) * (-786.700) (-784.020) [-784.659] (-784.813) -- 0:00:36
482000 -- (-785.794) [-788.272] (-783.795) (-785.584) * (-784.068) (-784.560) [-784.444] (-787.166) -- 0:00:36
482500 -- [-785.192] (-784.147) (-783.926) (-785.843) * [-788.375] (-783.918) (-784.619) (-790.226) -- 0:00:36
483000 -- (-785.345) (-788.703) [-784.834] (-785.551) * (-785.190) (-783.858) (-785.530) [-788.483] -- 0:00:36
483500 -- (-784.394) (-783.757) (-784.764) [-785.204] * (-786.553) (-784.736) [-785.653] (-786.580) -- 0:00:36
484000 -- (-784.247) [-784.148] (-786.543) (-785.515) * (-785.792) (-786.557) [-784.972] (-785.785) -- 0:00:36
484500 -- (-783.735) (-785.384) [-787.336] (-784.430) * [-784.156] (-787.689) (-786.882) (-784.179) -- 0:00:36
485000 -- (-784.382) (-785.034) (-788.552) [-785.906] * [-784.694] (-787.117) (-785.944) (-784.704) -- 0:00:36
Average standard deviation of split frequencies: 0.009072
485500 -- (-784.750) (-787.896) [-787.728] (-785.294) * (-783.403) [-784.399] (-785.803) (-787.825) -- 0:00:36
486000 -- [-783.962] (-786.535) (-784.655) (-784.516) * (-783.714) (-786.788) (-790.116) [-785.406] -- 0:00:35
486500 -- (-784.612) (-786.785) (-783.568) [-785.643] * [-783.605] (-789.543) (-784.557) (-787.069) -- 0:00:35
487000 -- (-785.079) (-784.908) [-784.439] (-783.991) * (-783.572) (-785.049) (-786.321) [-786.322] -- 0:00:35
487500 -- (-784.444) (-783.993) [-787.763] (-785.543) * (-785.589) [-783.997] (-788.511) (-790.282) -- 0:00:35
488000 -- [-786.217] (-786.554) (-786.467) (-785.872) * [-785.330] (-784.042) (-784.307) (-788.782) -- 0:00:35
488500 -- (-783.751) (-792.752) (-784.976) [-785.646] * (-789.916) (-784.498) [-785.640] (-788.241) -- 0:00:35
489000 -- (-788.449) (-786.392) [-784.893] (-785.506) * [-788.487] (-787.859) (-786.923) (-786.844) -- 0:00:35
489500 -- [-785.349] (-789.666) (-786.049) (-787.743) * (-785.666) (-785.170) [-783.697] (-790.599) -- 0:00:35
490000 -- (-786.604) [-785.774] (-785.634) (-785.504) * (-788.159) (-786.577) [-783.392] (-788.560) -- 0:00:35
Average standard deviation of split frequencies: 0.008590
490500 -- (-786.369) [-788.001] (-785.186) (-785.604) * (-783.702) [-784.505] (-784.353) (-784.750) -- 0:00:35
491000 -- (-786.903) (-789.021) [-784.026] (-783.753) * (-786.129) [-785.699] (-787.189) (-783.635) -- 0:00:35
491500 -- (-784.970) (-784.002) (-784.832) [-785.847] * (-785.880) (-786.433) (-785.165) [-784.789] -- 0:00:35
492000 -- (-792.737) [-784.644] (-785.028) (-785.258) * (-786.000) (-784.671) (-785.341) [-785.827] -- 0:00:35
492500 -- (-790.215) [-784.043] (-788.791) (-784.871) * (-789.244) (-787.626) (-785.304) [-786.404] -- 0:00:35
493000 -- (-784.608) (-785.197) (-786.510) [-784.764] * (-787.511) (-786.308) (-783.693) [-785.906] -- 0:00:34
493500 -- (-786.090) (-784.546) (-785.654) [-784.164] * (-783.779) (-783.665) [-784.782] (-784.622) -- 0:00:35
494000 -- (-790.520) (-785.683) [-786.492] (-784.165) * (-788.787) (-785.785) (-785.556) [-784.797] -- 0:00:35
494500 -- (-785.437) (-789.504) [-783.633] (-783.276) * (-784.629) (-786.164) (-783.830) [-785.541] -- 0:00:35
495000 -- (-791.785) (-791.224) (-785.506) [-783.417] * (-786.788) (-783.854) [-784.856] (-787.739) -- 0:00:35
Average standard deviation of split frequencies: 0.007827
495500 -- [-784.617] (-787.333) (-785.675) (-784.368) * (-783.726) [-784.442] (-784.568) (-785.363) -- 0:00:35
496000 -- (-787.746) (-784.529) [-787.190] (-783.774) * [-785.343] (-786.980) (-784.208) (-786.605) -- 0:00:35
496500 -- [-783.667] (-786.419) (-789.221) (-786.818) * [-785.940] (-785.646) (-784.226) (-785.320) -- 0:00:35
497000 -- [-785.458] (-784.255) (-783.763) (-787.498) * (-783.598) (-784.746) (-783.446) [-785.389] -- 0:00:35
497500 -- (-785.158) (-786.004) (-783.846) [-790.731] * (-784.812) (-785.088) [-783.980] (-783.785) -- 0:00:35
498000 -- [-785.569] (-784.110) (-791.020) (-784.533) * (-783.436) (-794.070) (-794.298) [-784.027] -- 0:00:35
498500 -- [-784.614] (-785.987) (-784.513) (-784.458) * (-785.724) [-787.774] (-785.105) (-787.466) -- 0:00:35
499000 -- (-785.788) [-784.732] (-786.107) (-786.853) * (-785.049) (-783.789) [-789.189] (-786.232) -- 0:00:35
499500 -- (-785.033) [-784.805] (-786.676) (-789.628) * (-785.554) [-783.818] (-784.902) (-788.506) -- 0:00:35
500000 -- (-783.842) [-785.578] (-786.562) (-787.938) * [-785.979] (-784.048) (-785.271) (-786.698) -- 0:00:35
Average standard deviation of split frequencies: 0.008356
500500 -- (-784.784) [-786.392] (-784.049) (-787.341) * (-784.734) (-788.775) [-784.101] (-787.213) -- 0:00:34
501000 -- (-784.553) [-784.616] (-786.583) (-786.012) * (-788.830) [-787.001] (-786.915) (-785.218) -- 0:00:34
501500 -- (-785.930) (-783.746) [-785.089] (-786.111) * (-788.561) [-785.283] (-790.245) (-784.048) -- 0:00:34
502000 -- (-789.101) [-786.411] (-788.245) (-789.180) * (-786.979) (-786.594) [-783.762] (-787.027) -- 0:00:34
502500 -- [-788.088] (-785.616) (-784.706) (-785.705) * (-784.274) (-784.483) (-785.391) [-783.631] -- 0:00:34
503000 -- (-788.774) (-785.495) [-785.087] (-785.278) * [-784.368] (-787.260) (-785.614) (-785.549) -- 0:00:34
503500 -- [-791.275] (-785.855) (-789.244) (-785.374) * (-786.562) (-784.867) [-783.338] (-785.161) -- 0:00:34
504000 -- [-787.394] (-792.272) (-786.012) (-785.383) * [-784.388] (-784.875) (-786.798) (-786.142) -- 0:00:34
504500 -- (-785.084) [-783.767] (-784.927) (-786.267) * (-784.053) (-785.015) (-790.055) [-785.119] -- 0:00:34
505000 -- (-783.785) (-787.743) (-791.246) [-786.970] * (-786.855) (-783.616) (-787.053) [-784.317] -- 0:00:34
Average standard deviation of split frequencies: 0.008385
505500 -- (-784.828) [-784.106] (-785.467) (-784.328) * (-790.366) [-784.778] (-784.928) (-785.167) -- 0:00:34
506000 -- (-783.803) (-785.176) (-792.301) [-787.949] * [-787.413] (-787.453) (-788.202) (-784.078) -- 0:00:34
506500 -- (-787.859) (-787.759) (-785.282) [-786.388] * (-784.685) (-785.070) [-787.599] (-785.050) -- 0:00:34
507000 -- (-786.221) (-784.057) [-785.438] (-790.446) * [-784.956] (-784.090) (-788.867) (-788.020) -- 0:00:34
507500 -- [-785.878] (-786.393) (-785.427) (-787.136) * (-785.513) [-786.232] (-784.386) (-788.607) -- 0:00:33
508000 -- (-786.046) (-787.156) [-785.756] (-788.425) * (-785.790) (-785.627) (-789.258) [-786.824] -- 0:00:33
508500 -- (-785.187) (-787.084) [-787.178] (-784.272) * (-784.898) (-784.764) (-791.646) [-787.041] -- 0:00:34
509000 -- [-787.448] (-786.727) (-785.342) (-785.741) * (-789.081) [-789.028] (-787.033) (-785.691) -- 0:00:34
509500 -- (-784.520) (-785.025) [-784.435] (-788.742) * (-786.732) (-785.851) (-786.667) [-786.168] -- 0:00:34
510000 -- (-785.984) [-784.996] (-786.406) (-784.941) * (-787.557) [-784.715] (-788.879) (-790.182) -- 0:00:34
Average standard deviation of split frequencies: 0.008077
510500 -- (-787.657) [-783.813] (-786.907) (-785.727) * (-783.783) (-785.838) (-789.244) [-789.300] -- 0:00:34
511000 -- (-785.634) [-784.759] (-787.821) (-787.624) * (-786.286) [-784.508] (-785.270) (-785.357) -- 0:00:34
511500 -- (-786.633) (-785.529) [-787.911] (-786.173) * (-787.025) (-784.426) (-785.491) [-785.892] -- 0:00:34
512000 -- (-786.747) (-788.516) (-786.308) [-783.877] * [-784.828] (-785.530) (-784.646) (-783.839) -- 0:00:34
512500 -- (-786.951) (-785.844) (-785.015) [-784.296] * (-786.017) (-787.589) (-784.464) [-786.608] -- 0:00:34
513000 -- (-791.710) (-784.128) [-785.406] (-784.165) * [-785.399] (-786.585) (-787.318) (-790.528) -- 0:00:34
513500 -- (-785.094) (-785.915) (-786.084) [-784.003] * (-785.767) [-784.146] (-784.541) (-784.128) -- 0:00:34
514000 -- (-787.068) (-785.985) [-785.859] (-787.370) * [-784.317] (-784.798) (-784.196) (-784.103) -- 0:00:34
514500 -- [-783.636] (-784.302) (-787.696) (-789.835) * (-784.001) [-784.720] (-787.542) (-789.151) -- 0:00:33
515000 -- (-785.406) [-786.600] (-785.688) (-787.039) * [-787.171] (-784.936) (-785.379) (-784.591) -- 0:00:33
Average standard deviation of split frequencies: 0.007594
515500 -- [-784.726] (-788.993) (-783.688) (-785.345) * (-790.140) (-784.435) (-787.317) [-783.756] -- 0:00:33
516000 -- [-785.264] (-785.976) (-788.903) (-785.070) * [-786.616] (-786.665) (-784.904) (-789.051) -- 0:00:33
516500 -- (-784.724) (-785.604) (-788.852) [-783.637] * (-785.027) [-784.566] (-785.359) (-790.038) -- 0:00:33
517000 -- (-786.795) (-788.532) (-790.765) [-786.350] * [-785.458] (-785.832) (-788.808) (-788.191) -- 0:00:33
517500 -- (-787.085) (-789.326) [-787.790] (-784.488) * (-785.430) [-784.753] (-785.566) (-786.149) -- 0:00:33
518000 -- (-784.777) [-786.160] (-784.480) (-786.654) * (-785.349) [-792.098] (-788.329) (-787.738) -- 0:00:33
518500 -- (-786.833) (-786.761) (-784.241) [-787.791] * [-784.562] (-786.629) (-785.382) (-784.760) -- 0:00:33
519000 -- (-788.942) (-787.007) (-784.118) [-787.109] * (-785.346) (-784.928) (-788.235) [-784.614] -- 0:00:33
519500 -- (-787.087) (-785.064) [-787.341] (-784.868) * (-785.665) (-786.119) [-784.276] (-786.598) -- 0:00:33
520000 -- [-786.879] (-787.509) (-786.894) (-786.854) * (-785.727) [-784.006] (-783.867) (-785.807) -- 0:00:33
Average standard deviation of split frequencies: 0.007243
520500 -- (-786.192) [-786.786] (-786.308) (-786.475) * (-784.854) [-785.570] (-787.846) (-784.779) -- 0:00:33
521000 -- [-790.973] (-785.074) (-787.221) (-786.925) * (-784.363) (-788.286) (-786.575) [-784.783] -- 0:00:33
521500 -- [-788.598] (-786.523) (-787.237) (-785.768) * (-784.883) (-785.951) [-787.024] (-783.796) -- 0:00:33
522000 -- (-788.659) (-786.337) [-785.630] (-787.212) * (-788.968) (-787.961) (-788.472) [-784.638] -- 0:00:32
522500 -- (-784.159) [-784.950] (-784.270) (-787.476) * (-787.965) (-783.390) [-784.353] (-784.909) -- 0:00:32
523000 -- (-795.932) [-786.486] (-786.801) (-786.613) * (-784.663) (-786.759) [-783.829] (-785.546) -- 0:00:32
523500 -- (-784.746) [-785.781] (-788.134) (-785.639) * (-784.036) (-786.021) (-783.652) [-784.186] -- 0:00:32
524000 -- (-786.664) (-788.511) [-784.417] (-784.021) * [-785.972] (-785.959) (-786.026) (-785.013) -- 0:00:33
524500 -- (-784.579) (-785.674) (-785.351) [-784.938] * (-784.011) (-784.484) (-787.380) [-784.035] -- 0:00:33
525000 -- (-784.885) [-786.638] (-786.846) (-784.436) * (-784.076) [-785.574] (-788.207) (-788.341) -- 0:00:33
Average standard deviation of split frequencies: 0.006722
525500 -- [-787.872] (-784.777) (-785.561) (-785.065) * (-787.978) [-786.167] (-784.703) (-783.810) -- 0:00:33
526000 -- (-785.625) (-787.115) (-784.540) [-784.311] * (-784.469) [-784.485] (-785.528) (-786.505) -- 0:00:33
526500 -- (-784.281) (-787.300) [-784.390] (-789.380) * [-785.404] (-783.273) (-784.779) (-786.176) -- 0:00:33
527000 -- (-784.179) (-787.853) (-786.056) [-788.380] * (-787.765) (-788.417) (-783.734) [-785.605] -- 0:00:33
527500 -- (-784.755) (-784.543) (-784.634) [-785.420] * (-787.448) (-785.612) (-784.997) [-784.535] -- 0:00:33
528000 -- (-788.244) (-785.814) (-789.162) [-787.882] * (-786.197) [-786.292] (-783.800) (-786.031) -- 0:00:33
528500 -- (-786.389) (-790.106) (-787.491) [-784.591] * (-784.733) (-785.682) [-784.436] (-785.672) -- 0:00:33
529000 -- (-785.263) (-784.400) (-788.344) [-786.331] * [-787.539] (-784.386) (-786.449) (-785.166) -- 0:00:32
529500 -- (-789.845) (-783.777) [-784.004] (-787.811) * (-788.313) (-785.670) [-783.997] (-785.407) -- 0:00:32
530000 -- (-784.352) (-784.234) (-785.645) [-784.285] * (-784.789) (-783.559) [-783.588] (-783.985) -- 0:00:32
Average standard deviation of split frequencies: 0.006885
530500 -- (-785.411) [-786.831] (-789.730) (-785.577) * [-785.160] (-789.296) (-785.174) (-784.746) -- 0:00:32
531000 -- (-784.460) (-788.522) [-791.556] (-786.693) * (-784.943) [-785.143] (-786.837) (-784.853) -- 0:00:32
531500 -- [-784.140] (-783.848) (-791.756) (-789.473) * (-784.499) [-785.405] (-785.007) (-786.743) -- 0:00:32
532000 -- (-785.774) [-785.747] (-785.894) (-785.828) * (-787.364) (-785.511) [-784.217] (-789.178) -- 0:00:32
532500 -- [-785.166] (-785.533) (-786.421) (-786.969) * [-785.895] (-784.763) (-784.260) (-784.450) -- 0:00:32
533000 -- [-783.337] (-789.131) (-786.558) (-788.368) * [-789.690] (-785.281) (-783.791) (-786.150) -- 0:00:32
533500 -- [-786.201] (-787.262) (-785.410) (-784.426) * (-788.251) [-784.207] (-784.759) (-787.696) -- 0:00:32
534000 -- (-786.465) (-789.661) [-787.123] (-785.897) * (-786.284) (-784.816) [-784.230] (-786.043) -- 0:00:32
534500 -- (-783.573) [-785.501] (-785.485) (-791.407) * (-785.190) (-785.522) (-783.847) [-783.891] -- 0:00:32
535000 -- (-783.912) (-785.675) [-784.286] (-785.947) * (-787.393) (-787.386) (-783.988) [-786.161] -- 0:00:32
Average standard deviation of split frequencies: 0.006761
535500 -- [-784.989] (-787.394) (-783.422) (-784.434) * (-785.180) (-786.249) (-789.203) [-786.000] -- 0:00:32
536000 -- [-789.021] (-785.111) (-789.884) (-784.640) * (-785.383) [-784.791] (-786.471) (-788.513) -- 0:00:32
536500 -- (-787.044) (-785.010) (-784.404) [-786.182] * (-784.898) [-785.421] (-783.919) (-787.110) -- 0:00:31
537000 -- (-788.387) (-785.295) [-783.831] (-786.330) * [-784.838] (-783.532) (-785.238) (-786.856) -- 0:00:31
537500 -- (-787.688) (-784.950) (-784.413) [-786.038] * (-783.572) (-784.488) (-792.867) [-787.008] -- 0:00:31
538000 -- (-785.075) [-785.013] (-784.531) (-787.918) * (-783.944) (-783.673) (-786.531) [-785.471] -- 0:00:31
538500 -- (-785.346) (-783.688) [-783.695] (-787.329) * [-784.307] (-785.892) (-788.162) (-785.964) -- 0:00:32
539000 -- (-788.042) (-784.649) [-784.410] (-789.971) * (-788.930) (-787.097) [-786.115] (-784.915) -- 0:00:32
539500 -- [-785.652] (-786.728) (-784.851) (-789.753) * (-787.093) [-784.908] (-786.451) (-783.751) -- 0:00:32
540000 -- (-788.217) [-786.608] (-785.304) (-789.727) * (-785.685) (-784.261) [-784.080] (-786.074) -- 0:00:32
Average standard deviation of split frequencies: 0.007139
540500 -- (-784.437) [-785.083] (-784.387) (-787.182) * (-789.084) [-785.842] (-783.943) (-787.876) -- 0:00:32
541000 -- [-785.078] (-785.154) (-788.758) (-784.417) * (-785.391) (-785.981) [-785.923] (-788.775) -- 0:00:32
541500 -- (-790.759) [-783.856] (-786.683) (-789.934) * [-786.092] (-785.446) (-786.241) (-783.527) -- 0:00:32
542000 -- (-786.751) (-784.908) [-787.058] (-792.521) * (-788.325) (-784.233) [-786.008] (-784.512) -- 0:00:32
542500 -- (-787.371) (-789.086) (-789.573) [-790.311] * [-786.933] (-784.186) (-784.754) (-784.731) -- 0:00:32
543000 -- [-784.679] (-790.366) (-786.744) (-787.207) * (-785.149) (-785.713) [-785.706] (-788.354) -- 0:00:31
543500 -- (-784.626) [-786.582] (-786.472) (-789.743) * (-783.786) (-789.620) [-785.556] (-785.906) -- 0:00:31
544000 -- (-786.201) (-784.156) [-788.345] (-786.434) * [-783.802] (-785.925) (-786.559) (-786.535) -- 0:00:31
544500 -- (-785.873) (-784.343) (-786.656) [-790.197] * (-785.665) (-791.443) (-788.390) [-787.579] -- 0:00:31
545000 -- (-788.889) (-785.117) [-786.316] (-786.186) * [-785.796] (-787.832) (-786.510) (-783.290) -- 0:00:31
Average standard deviation of split frequencies: 0.006853
545500 -- (-787.384) [-783.807] (-785.913) (-790.794) * [-785.215] (-786.107) (-785.100) (-786.924) -- 0:00:31
546000 -- [-789.009] (-783.827) (-786.009) (-791.015) * (-786.466) (-785.271) (-784.893) [-784.636] -- 0:00:31
546500 -- (-785.432) (-787.853) [-786.533] (-789.670) * (-787.979) (-785.464) [-787.129] (-786.987) -- 0:00:31
547000 -- (-784.683) (-789.546) (-786.166) [-785.037] * [-784.474] (-784.722) (-786.544) (-785.353) -- 0:00:31
547500 -- (-787.259) [-787.120] (-786.637) (-788.891) * [-784.766] (-785.101) (-785.322) (-790.149) -- 0:00:31
548000 -- (-785.446) [-785.185] (-783.901) (-785.016) * (-787.927) (-783.819) [-788.272] (-784.991) -- 0:00:31
548500 -- (-784.782) [-784.681] (-787.967) (-783.429) * [-786.642] (-784.705) (-787.279) (-784.306) -- 0:00:31
549000 -- [-784.632] (-786.399) (-784.267) (-796.045) * (-786.895) (-785.891) [-784.647] (-783.765) -- 0:00:31
549500 -- (-785.009) (-785.484) (-786.189) [-786.616] * (-786.411) (-784.193) (-784.332) [-783.781] -- 0:00:31
550000 -- [-785.621] (-785.613) (-784.652) (-787.451) * [-788.126] (-786.783) (-786.066) (-792.696) -- 0:00:31
Average standard deviation of split frequencies: 0.006313
550500 -- (-784.047) [-784.368] (-787.360) (-785.706) * [-788.049] (-785.020) (-785.636) (-794.239) -- 0:00:31
551000 -- (-785.284) [-784.519] (-785.330) (-786.335) * [-786.245] (-783.627) (-785.256) (-790.165) -- 0:00:30
551500 -- (-786.645) (-784.750) (-784.756) [-784.477] * [-784.999] (-783.844) (-788.372) (-785.428) -- 0:00:30
552000 -- (-784.879) [-784.474] (-789.801) (-784.050) * [-785.119] (-783.512) (-784.714) (-784.552) -- 0:00:30
552500 -- (-786.644) [-786.670] (-784.892) (-783.997) * (-784.582) (-783.513) [-784.803] (-786.254) -- 0:00:30
553000 -- (-785.528) (-784.629) [-784.394] (-783.388) * (-785.733) (-783.508) (-783.642) [-787.684] -- 0:00:30
553500 -- (-785.257) (-786.744) (-786.178) [-786.042] * (-786.284) (-791.548) (-784.378) [-785.563] -- 0:00:30
554000 -- (-786.182) (-788.389) [-784.171] (-784.348) * [-786.554] (-785.423) (-790.359) (-783.256) -- 0:00:31
554500 -- [-786.021] (-784.936) (-786.818) (-785.057) * (-785.594) [-786.172] (-787.879) (-784.574) -- 0:00:31
555000 -- [-785.146] (-784.510) (-790.633) (-784.491) * (-783.666) (-788.241) [-784.480] (-783.769) -- 0:00:31
Average standard deviation of split frequencies: 0.006677
555500 -- [-784.394] (-785.490) (-786.461) (-787.551) * (-783.591) (-790.420) [-783.218] (-783.794) -- 0:00:31
556000 -- [-790.627] (-784.240) (-785.658) (-785.794) * [-788.197] (-786.072) (-786.802) (-786.899) -- 0:00:31
556500 -- (-785.392) (-786.833) (-785.627) [-786.657] * (-784.541) (-784.606) [-788.815] (-783.782) -- 0:00:31
557000 -- (-791.106) [-787.740] (-787.230) (-786.541) * (-783.776) (-784.032) [-787.918] (-784.340) -- 0:00:31
557500 -- [-786.470] (-789.952) (-786.555) (-786.881) * (-785.407) [-785.804] (-785.542) (-784.474) -- 0:00:30
558000 -- (-786.620) (-787.119) (-784.862) [-788.893] * (-783.838) [-785.150] (-784.329) (-784.096) -- 0:00:30
558500 -- (-785.965) (-784.664) (-784.582) [-785.652] * (-783.987) [-784.936] (-787.352) (-784.046) -- 0:00:30
559000 -- [-785.069] (-784.223) (-785.828) (-787.204) * (-785.040) (-786.235) (-783.777) [-785.659] -- 0:00:30
559500 -- (-789.864) (-784.616) (-786.629) [-789.156] * (-785.981) [-784.192] (-787.853) (-784.257) -- 0:00:30
560000 -- [-784.268] (-784.942) (-785.163) (-787.409) * [-783.656] (-783.993) (-785.645) (-785.142) -- 0:00:30
Average standard deviation of split frequencies: 0.006096
560500 -- (-784.880) (-784.988) [-787.261] (-787.138) * [-783.500] (-787.571) (-786.338) (-787.705) -- 0:00:30
561000 -- (-786.421) (-785.202) (-787.006) [-784.109] * (-786.422) (-785.103) [-784.674] (-787.599) -- 0:00:30
561500 -- (-784.085) (-786.138) (-788.835) [-785.909] * (-787.850) (-786.427) (-787.764) [-784.134] -- 0:00:30
562000 -- (-785.711) (-784.885) (-787.960) [-784.898] * (-787.394) (-786.081) [-785.630] (-784.209) -- 0:00:30
562500 -- (-785.855) [-783.836] (-783.514) (-785.533) * (-785.690) (-786.282) (-784.936) [-785.130] -- 0:00:30
563000 -- (-786.108) (-786.360) (-783.456) [-784.961] * (-784.315) [-788.959] (-785.039) (-789.056) -- 0:00:30
563500 -- [-787.005] (-785.258) (-783.702) (-793.428) * (-785.481) (-787.180) [-784.509] (-785.936) -- 0:00:30
564000 -- (-786.386) (-784.734) [-784.036] (-784.221) * [-783.771] (-788.025) (-784.312) (-789.705) -- 0:00:30
564500 -- (-784.872) [-785.781] (-785.314) (-784.696) * (-787.026) (-787.392) [-785.807] (-783.898) -- 0:00:30
565000 -- (-783.516) (-787.349) [-785.645] (-784.810) * (-785.411) [-784.503] (-786.609) (-787.734) -- 0:00:30
Average standard deviation of split frequencies: 0.006611
565500 -- (-783.422) [-786.988] (-786.470) (-784.490) * (-785.378) [-786.161] (-783.271) (-785.489) -- 0:00:29
566000 -- [-784.041] (-790.574) (-784.038) (-790.854) * (-784.150) (-787.266) [-784.153] (-788.316) -- 0:00:29
566500 -- (-786.068) [-787.900] (-785.373) (-786.016) * (-785.634) (-784.023) [-784.296] (-786.058) -- 0:00:29
567000 -- (-789.065) (-786.556) (-786.517) [-786.912] * (-785.544) (-784.770) [-784.627] (-786.179) -- 0:00:29
567500 -- (-788.888) (-785.879) (-789.042) [-785.273] * (-784.982) [-785.369] (-785.767) (-785.587) -- 0:00:29
568000 -- (-789.362) (-785.418) (-787.316) [-786.469] * [-786.006] (-786.036) (-785.321) (-785.938) -- 0:00:30
568500 -- (-790.480) [-786.005] (-787.558) (-783.828) * (-784.685) (-786.769) (-785.365) [-784.920] -- 0:00:30
569000 -- (-788.949) (-786.211) [-789.457] (-783.684) * (-787.262) [-784.814] (-784.008) (-788.263) -- 0:00:30
569500 -- (-785.888) (-785.205) (-786.447) [-783.524] * [-785.078] (-784.045) (-784.227) (-786.198) -- 0:00:30
570000 -- (-785.209) [-787.992] (-786.221) (-783.522) * (-785.286) (-784.725) [-786.025] (-787.079) -- 0:00:30
Average standard deviation of split frequencies: 0.006195
570500 -- (-786.374) (-784.461) (-787.750) [-783.590] * (-785.438) (-784.539) [-786.976] (-785.608) -- 0:00:30
571000 -- (-784.080) (-790.937) [-786.831] (-784.798) * (-784.203) [-784.032] (-787.757) (-788.064) -- 0:00:30
571500 -- (-788.661) (-786.992) (-789.255) [-786.174] * (-785.066) (-787.470) [-786.956] (-786.715) -- 0:00:29
572000 -- (-784.606) [-788.576] (-785.932) (-786.716) * [-786.391] (-787.569) (-786.591) (-784.338) -- 0:00:29
572500 -- (-788.090) [-785.056] (-785.042) (-786.152) * (-784.000) (-785.540) (-787.115) [-783.691] -- 0:00:29
573000 -- (-789.529) (-785.557) [-785.753] (-784.223) * [-784.254] (-793.011) (-785.681) (-784.429) -- 0:00:29
573500 -- (-786.072) (-784.861) (-786.876) [-784.651] * (-785.627) [-786.008] (-789.514) (-787.502) -- 0:00:29
574000 -- [-785.590] (-783.855) (-789.203) (-785.600) * (-784.646) [-783.905] (-788.871) (-786.536) -- 0:00:29
574500 -- [-784.266] (-785.669) (-786.747) (-785.193) * [-784.734] (-784.510) (-786.975) (-786.951) -- 0:00:29
575000 -- (-786.153) [-784.440] (-785.173) (-788.290) * (-787.425) [-784.603] (-785.346) (-784.822) -- 0:00:29
Average standard deviation of split frequencies: 0.006394
575500 -- [-785.587] (-784.392) (-785.179) (-784.676) * (-788.902) (-785.486) [-787.425] (-783.688) -- 0:00:29
576000 -- (-784.605) (-787.621) [-784.408] (-786.141) * (-788.362) (-788.027) (-784.774) [-785.033] -- 0:00:29
576500 -- (-784.217) [-785.714] (-784.936) (-784.895) * [-787.942] (-785.306) (-784.800) (-784.817) -- 0:00:29
577000 -- (-789.028) (-785.018) (-784.852) [-788.481] * (-788.374) (-784.251) (-784.507) [-784.580] -- 0:00:29
577500 -- (-788.154) (-786.948) (-787.128) [-783.982] * (-785.499) (-783.809) [-786.275] (-785.364) -- 0:00:29
578000 -- [-787.737] (-785.365) (-787.898) (-786.916) * (-786.244) (-783.863) (-784.849) [-785.952] -- 0:00:29
578500 -- (-788.278) [-792.305] (-784.258) (-786.414) * (-784.512) (-784.033) [-789.599] (-784.367) -- 0:00:29
579000 -- (-786.116) (-788.200) (-787.656) [-787.699] * (-784.902) (-786.332) (-790.196) [-786.957] -- 0:00:29
579500 -- (-785.510) (-785.445) (-787.115) [-785.338] * (-784.255) (-783.888) (-790.127) [-786.763] -- 0:00:29
580000 -- (-783.836) [-784.766] (-786.763) (-785.135) * (-783.434) (-786.021) (-790.041) [-784.222] -- 0:00:28
Average standard deviation of split frequencies: 0.006495
580500 -- (-784.560) (-785.589) (-787.570) [-787.411] * (-788.280) [-786.685] (-786.180) (-784.894) -- 0:00:28
581000 -- (-784.464) (-783.852) [-786.296] (-784.368) * (-785.490) (-783.983) [-786.656] (-786.198) -- 0:00:28
581500 -- (-785.625) [-783.952] (-785.949) (-785.632) * (-783.804) [-784.520] (-785.506) (-785.700) -- 0:00:28
582000 -- (-784.841) [-783.944] (-787.150) (-784.399) * (-787.287) (-791.415) (-789.570) [-784.381] -- 0:00:28
582500 -- (-786.584) (-783.649) [-785.182] (-783.409) * (-785.543) [-789.562] (-790.276) (-785.874) -- 0:00:28
583000 -- (-785.970) (-785.112) [-784.883] (-787.841) * (-784.820) (-787.535) (-784.492) [-784.309] -- 0:00:29
583500 -- (-784.176) (-783.815) (-784.714) [-789.814] * [-783.744] (-787.817) (-784.936) (-786.160) -- 0:00:29
584000 -- (-784.575) (-784.413) (-788.013) [-784.585] * [-784.156] (-785.620) (-785.835) (-785.780) -- 0:00:29
584500 -- (-786.894) [-784.340] (-789.060) (-784.932) * (-784.590) (-785.419) [-784.405] (-787.359) -- 0:00:29
585000 -- [-784.262] (-784.446) (-785.728) (-785.602) * (-784.799) (-785.222) [-784.685] (-787.507) -- 0:00:29
Average standard deviation of split frequencies: 0.007666
585500 -- (-787.702) (-784.362) (-784.908) [-784.986] * (-785.209) (-784.460) [-783.903] (-786.708) -- 0:00:29
586000 -- (-786.198) [-784.739] (-785.695) (-787.479) * (-783.670) [-785.148] (-785.813) (-786.528) -- 0:00:28
586500 -- (-785.937) (-785.282) [-783.763] (-784.638) * (-785.858) (-784.550) (-784.789) [-786.344] -- 0:00:28
587000 -- [-784.468] (-786.120) (-786.703) (-788.797) * (-784.606) (-789.070) (-784.617) [-783.957] -- 0:00:28
587500 -- (-785.000) (-786.923) (-787.318) [-784.942] * (-786.058) (-784.856) [-785.453] (-787.503) -- 0:00:28
588000 -- (-786.647) (-786.081) (-791.511) [-784.216] * (-785.100) (-787.679) [-786.650] (-784.031) -- 0:00:28
588500 -- (-786.202) (-788.059) [-784.801] (-784.410) * (-784.670) (-786.536) [-783.329] (-785.895) -- 0:00:28
589000 -- (-784.788) (-785.034) (-784.597) [-786.947] * (-783.764) [-789.977] (-786.913) (-786.814) -- 0:00:28
589500 -- (-785.366) [-783.767] (-783.499) (-784.639) * (-785.164) (-786.920) (-784.914) [-785.129] -- 0:00:28
590000 -- (-783.973) (-786.232) [-783.383] (-783.883) * (-786.821) (-793.203) (-784.242) [-783.781] -- 0:00:28
Average standard deviation of split frequencies: 0.007183
590500 -- (-786.315) (-785.958) (-785.264) [-784.462] * (-785.137) (-784.491) [-786.535] (-785.733) -- 0:00:28
591000 -- (-785.776) (-786.064) [-788.569] (-783.610) * (-787.348) [-785.711] (-787.029) (-787.847) -- 0:00:28
591500 -- (-785.953) (-786.285) (-786.273) [-785.126] * (-787.574) (-785.180) [-786.539] (-784.859) -- 0:00:28
592000 -- (-786.496) (-785.588) [-785.116] (-787.843) * [-784.726] (-785.589) (-785.315) (-784.306) -- 0:00:28
592500 -- (-785.162) [-786.528] (-790.757) (-785.356) * (-784.403) (-790.723) [-786.127] (-785.534) -- 0:00:28
593000 -- (-785.605) (-786.985) [-786.709] (-785.421) * (-787.779) (-785.353) (-785.890) [-786.830] -- 0:00:28
593500 -- (-788.272) (-784.467) (-784.372) [-786.481] * [-785.335] (-786.913) (-785.320) (-786.686) -- 0:00:28
594000 -- [-785.684] (-788.634) (-784.293) (-788.110) * [-786.243] (-787.660) (-789.796) (-785.224) -- 0:00:28
594500 -- [-783.750] (-788.552) (-785.742) (-787.316) * (-784.810) [-787.449] (-786.454) (-785.326) -- 0:00:27
595000 -- (-785.029) (-786.646) (-785.906) [-787.239] * [-783.882] (-785.301) (-787.386) (-791.289) -- 0:00:27
Average standard deviation of split frequencies: 0.007956
595500 -- [-784.030] (-784.251) (-785.891) (-784.321) * (-791.954) (-786.141) (-785.893) [-786.370] -- 0:00:27
596000 -- (-786.704) [-785.406] (-787.948) (-783.294) * (-784.995) [-787.171] (-785.901) (-787.906) -- 0:00:27
596500 -- (-785.291) [-786.835] (-785.509) (-783.907) * (-784.921) [-784.232] (-784.127) (-783.509) -- 0:00:27
597000 -- (-792.690) (-786.969) [-784.382] (-784.177) * [-785.125] (-785.239) (-784.327) (-783.665) -- 0:00:27
597500 -- (-784.504) (-786.123) (-786.763) [-784.366] * [-784.805] (-786.091) (-789.466) (-783.958) -- 0:00:27
598000 -- [-783.560] (-786.248) (-785.300) (-787.777) * [-785.114] (-784.919) (-788.253) (-787.515) -- 0:00:28
598500 -- (-784.206) [-784.071] (-784.735) (-784.651) * (-788.902) (-785.557) [-785.034] (-791.112) -- 0:00:28
599000 -- [-785.228] (-785.751) (-784.558) (-789.681) * (-789.965) (-784.860) [-788.265] (-784.034) -- 0:00:28
599500 -- (-784.044) (-787.695) [-786.024] (-785.406) * (-784.393) (-784.353) (-786.566) [-786.127] -- 0:00:28
600000 -- (-784.179) (-788.387) (-788.097) [-789.480] * (-786.222) (-788.067) [-785.183] (-788.250) -- 0:00:27
Average standard deviation of split frequencies: 0.007995
600500 -- (-784.446) (-784.627) (-784.377) [-785.863] * (-786.042) [-788.016] (-787.910) (-784.670) -- 0:00:27
601000 -- [-783.895] (-783.578) (-784.417) (-788.174) * (-783.728) (-790.775) [-786.682] (-785.065) -- 0:00:27
601500 -- (-784.759) (-783.777) (-786.505) [-785.645] * (-787.534) (-785.451) [-784.650] (-787.886) -- 0:00:27
602000 -- (-784.689) (-784.356) [-784.434] (-784.628) * (-789.539) (-785.558) [-785.228] (-786.632) -- 0:00:27
602500 -- (-785.472) (-787.378) [-783.371] (-785.979) * [-784.163] (-785.711) (-784.738) (-789.542) -- 0:00:27
603000 -- (-786.862) [-784.195] (-786.632) (-784.048) * (-786.284) (-785.780) (-785.432) [-787.799] -- 0:00:27
603500 -- (-784.345) (-786.600) (-784.372) [-785.929] * (-784.569) (-785.065) (-786.995) [-785.758] -- 0:00:27
604000 -- (-787.439) (-784.015) [-785.125] (-784.884) * [-784.009] (-784.297) (-785.192) (-784.276) -- 0:00:27
604500 -- (-785.579) [-784.373] (-784.623) (-784.847) * (-789.637) (-785.911) [-787.482] (-784.662) -- 0:00:27
605000 -- (-784.416) [-786.807] (-785.187) (-784.736) * (-784.983) [-785.716] (-787.439) (-784.637) -- 0:00:27
Average standard deviation of split frequencies: 0.007973
605500 -- [-785.398] (-785.999) (-784.444) (-785.743) * [-784.842] (-786.426) (-786.087) (-784.725) -- 0:00:27
606000 -- [-784.576] (-785.157) (-784.870) (-786.586) * (-785.313) (-787.241) [-784.073] (-784.683) -- 0:00:27
606500 -- (-785.764) (-785.998) (-784.567) [-784.593] * (-788.277) [-786.211] (-784.899) (-785.643) -- 0:00:27
607000 -- (-784.902) (-785.451) (-788.525) [-783.595] * (-784.962) (-784.809) (-783.899) [-788.869] -- 0:00:27
607500 -- (-786.988) (-789.371) (-788.096) [-784.257] * (-787.325) [-785.559] (-783.807) (-788.593) -- 0:00:27
608000 -- (-786.982) (-785.124) [-786.422] (-786.574) * (-786.520) (-783.915) [-787.726] (-787.200) -- 0:00:27
608500 -- (-791.992) (-785.100) [-784.383] (-785.529) * [-785.895] (-784.462) (-786.121) (-783.695) -- 0:00:27
609000 -- [-785.612] (-784.196) (-787.648) (-788.292) * (-787.372) [-784.798] (-785.567) (-788.702) -- 0:00:26
609500 -- (-787.248) [-786.684] (-789.332) (-784.924) * (-786.741) (-784.617) [-784.782] (-786.374) -- 0:00:26
610000 -- [-784.948] (-785.458) (-786.451) (-785.809) * [-785.146] (-788.041) (-784.661) (-786.585) -- 0:00:26
Average standard deviation of split frequencies: 0.008298
610500 -- [-786.069] (-786.394) (-786.150) (-783.920) * (-786.684) (-785.057) [-786.196] (-786.323) -- 0:00:26
611000 -- (-785.935) (-785.634) (-785.576) [-786.218] * (-784.097) [-784.430] (-785.142) (-784.037) -- 0:00:26
611500 -- (-785.821) (-784.142) (-788.387) [-791.563] * [-784.843] (-786.038) (-787.034) (-785.407) -- 0:00:26
612000 -- (-786.575) [-784.599] (-787.610) (-788.860) * (-785.035) [-784.669] (-787.612) (-788.737) -- 0:00:26
612500 -- (-785.791) (-786.316) [-785.511] (-786.807) * (-785.655) [-783.930] (-785.544) (-786.845) -- 0:00:26
613000 -- [-784.466] (-784.332) (-784.546) (-785.229) * (-788.067) (-786.765) (-784.720) [-786.372] -- 0:00:27
613500 -- (-784.746) (-785.921) (-783.412) [-786.074] * (-783.575) [-787.064] (-784.472) (-789.333) -- 0:00:27
614000 -- (-786.938) (-784.473) (-790.264) [-784.994] * (-783.750) (-787.771) [-783.329] (-788.756) -- 0:00:27
614500 -- (-788.448) [-785.412] (-788.002) (-785.282) * (-783.763) (-787.416) [-785.037] (-785.462) -- 0:00:26
615000 -- (-786.113) (-786.491) (-784.986) [-783.891] * (-786.963) (-785.103) [-785.282] (-783.746) -- 0:00:26
Average standard deviation of split frequencies: 0.007940
615500 -- (-786.747) (-784.909) (-786.124) [-787.026] * (-784.374) (-784.517) [-784.134] (-786.116) -- 0:00:26
616000 -- (-785.245) (-788.119) [-787.934] (-787.559) * (-787.194) [-784.370] (-783.311) (-786.266) -- 0:00:26
616500 -- (-784.084) (-785.679) (-789.344) [-784.265] * (-785.154) (-784.165) [-783.547] (-785.941) -- 0:00:26
617000 -- (-785.573) (-789.067) [-784.178] (-784.654) * [-788.494] (-785.977) (-785.572) (-785.138) -- 0:00:26
617500 -- (-789.616) (-789.092) (-783.588) [-783.700] * (-794.815) [-788.007] (-786.493) (-786.663) -- 0:00:26
618000 -- (-790.818) (-784.283) (-785.758) [-783.700] * (-791.992) [-787.005] (-783.993) (-783.981) -- 0:00:26
618500 -- (-786.382) [-786.205] (-790.709) (-785.793) * (-785.688) [-784.498] (-784.204) (-783.489) -- 0:00:26
619000 -- (-784.361) [-787.914] (-790.522) (-784.313) * (-784.093) [-785.441] (-784.086) (-786.457) -- 0:00:26
619500 -- [-788.359] (-788.446) (-789.827) (-784.650) * (-784.916) (-784.769) [-783.803] (-788.291) -- 0:00:26
620000 -- (-785.612) [-784.086] (-784.297) (-784.816) * (-785.418) (-788.669) [-785.048] (-786.621) -- 0:00:26
Average standard deviation of split frequencies: 0.008712
620500 -- [-785.072] (-783.927) (-786.901) (-786.051) * [-784.714] (-785.613) (-787.694) (-787.605) -- 0:00:26
621000 -- (-787.657) [-785.793] (-784.951) (-789.370) * (-784.299) [-788.094] (-785.604) (-786.682) -- 0:00:26
621500 -- (-784.827) (-787.082) [-788.190] (-785.175) * (-785.019) [-786.048] (-787.033) (-784.363) -- 0:00:26
622000 -- (-784.252) [-787.752] (-785.678) (-784.075) * (-785.726) (-783.673) (-784.907) [-784.676] -- 0:00:26
622500 -- (-787.473) [-785.394] (-786.061) (-784.808) * [-785.504] (-785.369) (-784.596) (-788.446) -- 0:00:26
623000 -- [-783.978] (-784.857) (-786.539) (-785.234) * (-787.122) (-789.034) [-784.564] (-786.650) -- 0:00:26
623500 -- (-784.415) (-785.138) [-785.162] (-785.377) * [-786.572] (-787.286) (-788.895) (-788.821) -- 0:00:25
624000 -- (-784.632) (-784.808) (-783.897) [-784.262] * (-785.635) [-785.617] (-785.485) (-784.771) -- 0:00:25
624500 -- (-784.203) (-784.950) (-784.305) [-784.582] * (-787.043) (-792.171) (-786.184) [-785.304] -- 0:00:25
625000 -- [-784.198] (-785.162) (-784.023) (-785.915) * (-785.228) [-786.019] (-785.815) (-785.628) -- 0:00:25
Average standard deviation of split frequencies: 0.008372
625500 -- [-791.524] (-784.391) (-786.458) (-787.544) * (-785.184) [-783.621] (-787.177) (-784.118) -- 0:00:25
626000 -- (-784.859) [-784.297] (-791.953) (-783.683) * (-785.577) [-784.369] (-791.880) (-787.176) -- 0:00:25
626500 -- [-784.551] (-783.907) (-791.323) (-784.507) * [-784.366] (-786.503) (-786.044) (-784.256) -- 0:00:25
627000 -- (-785.846) (-784.362) (-788.368) [-784.168] * (-786.836) (-785.017) [-786.239] (-785.285) -- 0:00:25
627500 -- (-787.919) [-785.699] (-787.575) (-783.660) * (-787.350) [-785.411] (-784.538) (-788.462) -- 0:00:25
628000 -- [-783.683] (-786.354) (-783.738) (-786.215) * (-791.557) [-786.750] (-787.006) (-785.112) -- 0:00:26
628500 -- (-785.108) (-786.946) (-783.223) [-785.158] * [-790.235] (-787.285) (-786.524) (-784.950) -- 0:00:26
629000 -- (-787.332) (-787.678) [-784.572] (-789.401) * [-786.001] (-797.144) (-787.024) (-785.484) -- 0:00:25
629500 -- (-790.068) (-786.784) [-785.084] (-786.801) * [-787.084] (-790.008) (-784.484) (-787.307) -- 0:00:25
630000 -- [-784.313] (-785.116) (-784.145) (-790.262) * (-785.463) (-787.919) (-785.379) [-783.655] -- 0:00:25
Average standard deviation of split frequencies: 0.008574
630500 -- (-784.405) (-783.655) [-788.572] (-787.955) * (-786.452) (-786.988) [-784.437] (-786.312) -- 0:00:25
631000 -- (-789.770) (-785.185) [-783.782] (-786.103) * (-786.356) (-785.381) (-786.044) [-787.383] -- 0:00:25
631500 -- [-786.213] (-783.407) (-786.190) (-787.591) * [-786.205] (-784.589) (-784.152) (-785.467) -- 0:00:25
632000 -- (-786.811) [-784.579] (-785.620) (-785.663) * (-783.663) [-784.567] (-784.262) (-786.072) -- 0:00:25
632500 -- (-788.609) (-784.943) (-784.489) [-785.792] * (-785.921) (-785.002) (-784.873) [-784.595] -- 0:00:25
633000 -- (-789.252) (-784.344) [-784.258] (-789.163) * (-786.635) (-785.353) (-784.957) [-785.056] -- 0:00:25
633500 -- (-788.198) (-784.501) (-785.017) [-787.781] * (-784.246) (-785.203) [-784.140] (-783.925) -- 0:00:25
634000 -- (-789.521) (-786.313) [-783.434] (-790.063) * (-785.066) (-787.730) (-784.140) [-783.996] -- 0:00:25
634500 -- [-785.142] (-785.613) (-783.462) (-783.649) * (-785.185) [-785.782] (-786.252) (-784.919) -- 0:00:25
635000 -- (-785.893) (-784.536) (-783.768) [-786.869] * (-784.368) [-785.578] (-787.408) (-785.468) -- 0:00:25
Average standard deviation of split frequencies: 0.007783
635500 -- (-788.409) (-785.253) (-785.345) [-786.513] * [-785.109] (-784.446) (-789.503) (-785.006) -- 0:00:25
636000 -- (-784.919) (-785.152) [-785.027] (-783.427) * (-783.976) (-786.166) (-787.703) [-784.835] -- 0:00:25
636500 -- (-787.768) [-787.158] (-785.570) (-784.243) * (-784.111) [-784.730] (-784.400) (-786.891) -- 0:00:25
637000 -- (-785.119) (-784.320) [-785.224] (-785.703) * (-786.217) (-785.838) (-783.235) [-788.602] -- 0:00:25
637500 -- (-785.504) [-788.378] (-786.553) (-786.529) * (-786.229) (-786.050) (-785.767) [-784.978] -- 0:00:25
638000 -- (-785.597) [-785.206] (-784.484) (-783.971) * [-786.824] (-789.742) (-786.233) (-788.696) -- 0:00:24
638500 -- (-784.646) (-786.991) [-784.153] (-783.794) * (-789.061) (-785.449) (-784.039) [-784.804] -- 0:00:24
639000 -- (-784.144) (-785.616) [-784.345] (-790.155) * (-788.404) (-788.275) (-785.334) [-784.524] -- 0:00:24
639500 -- (-789.078) (-786.952) [-784.414] (-784.665) * (-789.504) (-783.911) (-786.040) [-784.979] -- 0:00:24
640000 -- (-786.360) (-784.593) [-784.904] (-784.009) * [-788.339] (-787.664) (-785.226) (-785.085) -- 0:00:24
Average standard deviation of split frequencies: 0.008140
640500 -- (-783.927) [-785.613] (-786.661) (-785.202) * [-785.289] (-788.970) (-786.125) (-784.994) -- 0:00:24
641000 -- (-785.769) [-783.795] (-786.661) (-785.087) * [-785.886] (-787.752) (-787.271) (-784.784) -- 0:00:24
641500 -- (-784.277) (-787.554) (-786.185) [-787.474] * (-784.302) (-790.161) [-790.360] (-789.453) -- 0:00:24
642000 -- [-783.951] (-784.504) (-786.633) (-787.662) * (-784.765) (-787.883) [-784.891] (-787.883) -- 0:00:24
642500 -- [-787.732] (-785.694) (-786.775) (-785.444) * [-784.050] (-790.552) (-785.010) (-786.702) -- 0:00:24
643000 -- (-788.920) (-784.904) (-789.035) [-785.163] * (-784.547) (-784.916) (-785.282) [-788.347] -- 0:00:24
643500 -- (-785.917) [-785.049] (-790.227) (-783.921) * [-783.640] (-786.518) (-785.782) (-788.299) -- 0:00:24
644000 -- (-785.425) [-789.390] (-785.447) (-789.002) * [-784.108] (-786.446) (-786.232) (-785.143) -- 0:00:24
644500 -- (-789.098) (-783.900) [-785.547] (-787.839) * (-785.031) (-785.482) [-784.192] (-787.452) -- 0:00:24
645000 -- [-786.582] (-784.080) (-785.207) (-784.427) * (-786.613) [-784.654] (-784.026) (-783.915) -- 0:00:24
Average standard deviation of split frequencies: 0.008848
645500 -- (-785.842) (-784.180) (-787.165) [-785.466] * [-787.171] (-783.953) (-783.861) (-785.366) -- 0:00:24
646000 -- (-785.110) (-789.663) (-792.038) [-784.816] * (-783.763) (-788.053) [-783.625] (-784.064) -- 0:00:24
646500 -- (-788.095) (-784.799) (-791.465) [-785.333] * (-788.116) [-785.301] (-784.482) (-784.608) -- 0:00:24
647000 -- (-785.792) (-788.725) [-784.405] (-785.118) * (-786.594) (-784.828) (-785.164) [-784.433] -- 0:00:24
647500 -- (-786.221) (-791.955) [-785.304] (-785.803) * (-786.935) [-785.090] (-787.159) (-788.142) -- 0:00:24
648000 -- (-787.235) (-785.618) [-785.445] (-785.032) * [-784.909] (-786.543) (-786.231) (-784.616) -- 0:00:24
648500 -- (-788.020) [-784.628] (-789.146) (-785.182) * (-786.538) (-785.032) (-784.745) [-784.222] -- 0:00:24
649000 -- (-785.115) (-785.859) [-785.469] (-787.118) * (-785.374) (-784.506) [-786.270] (-784.143) -- 0:00:24
649500 -- [-784.804] (-790.893) (-785.640) (-785.523) * (-784.327) [-785.603] (-783.996) (-783.585) -- 0:00:24
650000 -- [-789.296] (-791.856) (-785.180) (-786.090) * [-787.271] (-787.429) (-788.738) (-786.004) -- 0:00:24
Average standard deviation of split frequencies: 0.008558
650500 -- [-788.532] (-788.921) (-785.453) (-784.357) * (-784.354) (-785.333) (-784.187) [-788.638] -- 0:00:24
651000 -- [-784.038] (-793.423) (-787.973) (-784.401) * (-785.282) (-784.784) (-786.887) [-786.328] -- 0:00:24
651500 -- (-791.513) (-790.432) [-783.766] (-783.676) * (-784.638) [-790.381] (-786.063) (-784.017) -- 0:00:24
652000 -- (-784.057) [-786.425] (-785.588) (-786.094) * (-784.646) (-786.586) [-786.893] (-783.886) -- 0:00:24
652500 -- [-784.658] (-784.833) (-784.993) (-785.697) * (-785.347) [-787.191] (-785.771) (-791.429) -- 0:00:23
653000 -- (-785.438) (-785.317) (-784.418) [-783.584] * (-786.035) (-789.860) (-788.191) [-784.895] -- 0:00:23
653500 -- (-787.906) (-784.075) (-785.581) [-787.455] * (-788.338) (-784.217) [-783.417] (-786.796) -- 0:00:23
654000 -- [-785.185] (-784.391) (-788.105) (-784.724) * (-786.152) [-788.119] (-785.058) (-785.579) -- 0:00:23
654500 -- (-784.712) (-783.991) (-788.277) [-785.177] * [-785.479] (-786.192) (-784.437) (-784.261) -- 0:00:23
655000 -- [-787.899] (-784.205) (-790.529) (-785.495) * (-785.889) (-785.505) [-784.430] (-785.577) -- 0:00:23
Average standard deviation of split frequencies: 0.008713
655500 -- [-785.269] (-784.209) (-785.893) (-786.991) * (-786.775) (-784.067) (-784.319) [-786.392] -- 0:00:23
656000 -- [-784.402] (-785.593) (-786.142) (-789.073) * (-787.142) (-784.061) (-785.932) [-787.174] -- 0:00:23
656500 -- (-784.446) (-785.689) (-787.548) [-790.151] * [-786.008] (-784.207) (-785.781) (-784.397) -- 0:00:23
657000 -- (-784.505) [-783.556] (-783.654) (-786.793) * (-784.783) [-784.519] (-786.585) (-786.354) -- 0:00:23
657500 -- (-785.004) (-783.488) (-784.240) [-786.444] * (-785.745) (-784.877) [-785.156] (-789.013) -- 0:00:23
658000 -- (-785.161) (-785.091) (-784.834) [-787.792] * (-787.300) [-785.854] (-785.821) (-785.011) -- 0:00:23
658500 -- (-784.880) (-783.840) (-785.117) [-786.604] * [-786.185] (-785.359) (-785.606) (-784.095) -- 0:00:23
659000 -- (-784.692) (-785.500) [-784.690] (-786.828) * (-784.763) (-788.422) [-785.634] (-785.219) -- 0:00:23
659500 -- (-785.540) (-787.425) [-786.509] (-785.542) * (-785.827) (-784.174) (-784.644) [-783.523] -- 0:00:23
660000 -- (-785.559) (-783.853) (-785.930) [-784.565] * [-785.420] (-788.615) (-785.217) (-786.073) -- 0:00:23
Average standard deviation of split frequencies: 0.009444
660500 -- (-786.396) (-784.163) (-786.250) [-785.584] * [-785.340] (-788.556) (-784.843) (-785.946) -- 0:00:23
661000 -- (-786.763) (-787.504) (-786.017) [-787.963] * [-785.517] (-784.417) (-785.666) (-787.425) -- 0:00:23
661500 -- (-790.103) (-784.562) (-787.990) [-788.617] * (-790.517) (-785.697) [-783.826] (-785.247) -- 0:00:23
662000 -- [-784.965] (-786.364) (-786.792) (-789.424) * [-789.116] (-784.979) (-785.262) (-786.783) -- 0:00:23
662500 -- (-789.429) (-783.879) (-790.246) [-783.778] * (-787.348) [-785.518] (-787.993) (-789.825) -- 0:00:23
663000 -- (-786.509) (-785.210) [-784.598] (-784.788) * [-786.325] (-784.776) (-788.434) (-786.974) -- 0:00:23
663500 -- (-785.965) [-783.593] (-791.107) (-785.611) * (-784.476) (-788.907) (-791.358) [-787.067] -- 0:00:23
664000 -- (-788.424) [-783.456] (-784.509) (-784.753) * [-784.193] (-785.773) (-787.253) (-785.124) -- 0:00:23
664500 -- (-785.470) [-783.402] (-786.045) (-786.914) * (-788.020) [-785.567] (-786.028) (-785.630) -- 0:00:23
665000 -- (-787.984) [-785.863] (-784.199) (-786.820) * (-785.027) (-784.398) [-785.218] (-784.750) -- 0:00:23
Average standard deviation of split frequencies: 0.009535
665500 -- (-787.347) [-784.645] (-786.047) (-785.416) * (-785.464) [-784.991] (-785.200) (-784.117) -- 0:00:23
666000 -- [-784.563] (-785.703) (-785.070) (-787.011) * (-785.642) (-786.347) (-788.155) [-784.077] -- 0:00:23
666500 -- (-786.147) (-787.087) [-784.492] (-790.289) * (-789.351) (-787.316) (-788.659) [-784.272] -- 0:00:23
667000 -- (-783.490) (-789.249) [-783.692] (-784.100) * (-786.292) [-787.505] (-788.367) (-785.771) -- 0:00:22
667500 -- (-784.487) [-789.711] (-783.898) (-786.290) * (-784.537) (-784.398) [-783.889] (-785.337) -- 0:00:22
668000 -- (-785.707) (-784.875) (-785.278) [-784.392] * (-785.351) [-785.537] (-784.780) (-784.353) -- 0:00:22
668500 -- [-787.985] (-786.086) (-787.261) (-785.411) * [-785.847] (-784.461) (-787.484) (-787.505) -- 0:00:22
669000 -- (-788.979) (-788.009) (-786.902) [-784.959] * (-785.600) [-784.050] (-787.758) (-786.308) -- 0:00:22
669500 -- (-787.049) [-787.447] (-789.555) (-783.535) * [-786.813] (-784.934) (-789.159) (-783.689) -- 0:00:22
670000 -- [-783.668] (-788.667) (-784.657) (-783.718) * [-785.380] (-786.944) (-786.071) (-784.691) -- 0:00:22
Average standard deviation of split frequencies: 0.008874
670500 -- (-785.732) [-787.585] (-784.462) (-787.536) * [-784.866] (-784.583) (-785.108) (-786.034) -- 0:00:22
671000 -- (-787.760) (-786.595) (-784.375) [-788.228] * (-786.411) (-785.218) (-789.330) [-784.483] -- 0:00:22
671500 -- (-787.649) [-786.877] (-787.731) (-784.573) * [-784.013] (-785.980) (-789.737) (-784.720) -- 0:00:22
672000 -- (-786.359) [-786.986] (-785.257) (-785.184) * (-784.377) (-791.838) [-784.830] (-784.993) -- 0:00:22
672500 -- (-784.380) (-784.650) [-785.172] (-789.533) * (-784.341) [-790.752] (-792.839) (-788.636) -- 0:00:22
673000 -- [-785.485] (-783.941) (-784.923) (-788.264) * [-787.967] (-786.212) (-790.485) (-785.684) -- 0:00:22
673500 -- (-784.062) (-784.053) [-784.597] (-788.692) * (-786.020) [-787.929] (-790.633) (-785.275) -- 0:00:22
674000 -- [-787.152] (-783.759) (-784.616) (-784.943) * (-790.831) [-787.023] (-789.438) (-784.519) -- 0:00:22
674500 -- (-786.927) (-785.132) [-784.780] (-785.596) * (-785.479) (-783.968) [-788.195] (-789.082) -- 0:00:22
675000 -- [-784.407] (-785.857) (-784.319) (-786.218) * [-786.649] (-784.272) (-784.336) (-784.507) -- 0:00:22
Average standard deviation of split frequencies: 0.009545
675500 -- (-786.055) [-783.830] (-787.281) (-786.062) * (-785.323) (-785.815) [-786.388] (-784.446) -- 0:00:22
676000 -- [-786.741] (-785.471) (-784.965) (-784.458) * (-784.448) (-787.037) (-785.538) [-785.518] -- 0:00:22
676500 -- (-786.507) (-784.174) [-785.431] (-784.183) * (-785.397) (-784.834) [-786.259] (-786.015) -- 0:00:22
677000 -- (-790.313) [-784.489] (-783.525) (-784.379) * (-787.166) (-783.342) [-788.012] (-791.096) -- 0:00:22
677500 -- (-787.266) (-790.975) [-784.125] (-785.437) * [-786.742] (-784.142) (-789.057) (-788.192) -- 0:00:22
678000 -- (-788.882) (-787.657) (-784.391) [-784.069] * [-785.935] (-786.456) (-785.008) (-790.060) -- 0:00:22
678500 -- (-785.834) (-784.579) [-785.115] (-783.930) * (-786.902) [-785.881] (-784.311) (-789.507) -- 0:00:22
679000 -- (-785.129) (-786.428) [-785.354] (-784.180) * (-784.750) (-785.884) (-787.851) [-784.954] -- 0:00:22
679500 -- [-786.535] (-787.298) (-786.568) (-787.666) * (-783.953) [-786.148] (-786.102) (-786.674) -- 0:00:22
680000 -- (-785.076) [-790.769] (-787.145) (-784.950) * (-784.072) (-788.089) [-784.643] (-789.956) -- 0:00:22
Average standard deviation of split frequencies: 0.009350
680500 -- (-784.900) (-786.205) (-788.818) [-784.399] * [-785.291] (-787.096) (-785.139) (-784.394) -- 0:00:22
681000 -- (-786.869) (-786.984) [-784.206] (-784.166) * (-786.447) (-784.958) (-786.414) [-783.351] -- 0:00:22
681500 -- (-785.110) (-787.795) (-788.666) [-783.795] * (-786.479) (-786.962) [-784.329] (-786.915) -- 0:00:21
682000 -- (-784.876) [-784.406] (-788.368) (-783.794) * (-784.056) (-785.220) [-786.693] (-789.895) -- 0:00:21
682500 -- (-786.632) [-786.746] (-786.792) (-785.054) * (-784.392) (-786.460) (-785.102) [-785.873] -- 0:00:21
683000 -- (-783.765) (-792.319) (-784.831) [-784.856] * (-786.127) (-785.448) (-788.323) [-786.387] -- 0:00:21
683500 -- (-783.555) (-787.450) (-786.581) [-783.625] * [-787.248] (-785.185) (-786.327) (-788.612) -- 0:00:21
684000 -- (-783.791) (-786.425) (-783.362) [-784.924] * [-784.091] (-787.001) (-784.485) (-783.762) -- 0:00:21
684500 -- (-784.408) (-784.307) (-784.857) [-784.439] * (-785.614) (-789.584) (-785.675) [-786.817] -- 0:00:21
685000 -- (-785.797) (-783.785) (-785.469) [-784.821] * [-788.565] (-784.848) (-787.433) (-786.202) -- 0:00:21
Average standard deviation of split frequencies: 0.008976
685500 -- (-788.875) (-783.581) (-785.267) [-783.709] * (-790.905) [-784.600] (-784.483) (-791.832) -- 0:00:21
686000 -- (-783.491) (-785.814) (-785.236) [-784.699] * (-786.778) (-785.254) (-785.113) [-784.114] -- 0:00:21
686500 -- (-783.949) [-785.538] (-784.964) (-785.305) * (-783.979) (-787.451) (-786.732) [-783.970] -- 0:00:21
687000 -- (-784.550) [-786.377] (-785.015) (-784.905) * (-783.719) (-786.734) [-786.343] (-785.976) -- 0:00:21
687500 -- (-785.283) (-787.246) (-785.398) [-785.715] * (-785.163) (-790.687) [-784.051] (-785.408) -- 0:00:21
688000 -- (-784.480) (-784.528) [-785.828] (-784.268) * (-787.752) (-784.677) (-788.137) [-784.653] -- 0:00:21
688500 -- (-784.463) (-784.625) [-785.642] (-789.756) * [-787.830] (-783.446) (-787.932) (-786.502) -- 0:00:21
689000 -- [-785.304] (-783.288) (-783.919) (-786.589) * (-787.058) (-785.431) [-786.893] (-784.154) -- 0:00:21
689500 -- (-785.996) (-784.124) [-784.289] (-789.609) * (-786.163) (-786.087) (-787.170) [-784.641] -- 0:00:21
690000 -- (-792.806) [-786.558] (-784.473) (-791.032) * [-785.461] (-786.395) (-785.187) (-783.492) -- 0:00:21
Average standard deviation of split frequencies: 0.008617
690500 -- (-786.521) (-783.809) (-784.285) [-786.870] * (-785.188) (-786.794) [-786.395] (-790.060) -- 0:00:21
691000 -- (-797.972) (-783.915) [-784.144] (-789.336) * (-785.604) (-784.554) [-787.865] (-788.974) -- 0:00:21
691500 -- (-789.395) (-783.773) (-787.601) [-784.031] * (-787.724) (-789.461) (-785.401) [-785.070] -- 0:00:21
692000 -- [-786.555] (-785.449) (-785.276) (-784.523) * (-783.905) (-787.822) (-783.611) [-786.333] -- 0:00:21
692500 -- (-787.437) (-784.429) [-785.419] (-786.710) * (-785.607) (-784.420) [-784.130] (-787.958) -- 0:00:21
693000 -- [-785.175] (-785.927) (-784.012) (-789.273) * (-786.617) (-785.269) (-783.618) [-785.005] -- 0:00:21
693500 -- (-784.319) [-783.919] (-784.166) (-788.798) * (-785.239) (-784.849) (-784.762) [-784.149] -- 0:00:21
694000 -- (-784.444) (-785.679) [-783.839] (-784.989) * [-787.782] (-785.600) (-787.467) (-785.469) -- 0:00:21
694500 -- (-785.265) [-783.982] (-785.003) (-785.332) * (-785.217) (-786.516) (-786.731) [-788.037] -- 0:00:21
695000 -- [-786.725] (-785.783) (-785.172) (-785.047) * (-784.800) (-784.875) [-785.405] (-786.178) -- 0:00:21
Average standard deviation of split frequencies: 0.008551
695500 -- (-786.350) [-784.075] (-784.056) (-786.011) * (-785.564) [-786.039] (-787.823) (-787.232) -- 0:00:21
696000 -- (-788.202) (-783.538) [-784.544] (-784.116) * (-789.348) (-784.440) (-785.513) [-784.089] -- 0:00:20
696500 -- (-786.749) [-784.800] (-789.425) (-787.413) * (-787.425) (-784.928) [-784.917] (-786.684) -- 0:00:20
697000 -- [-785.431] (-784.576) (-786.681) (-784.918) * [-786.570] (-784.099) (-785.183) (-785.995) -- 0:00:20
697500 -- (-786.998) [-786.036] (-784.388) (-784.344) * (-787.582) [-784.751] (-785.864) (-787.199) -- 0:00:20
698000 -- (-787.130) [-787.496] (-789.854) (-784.956) * [-785.603] (-783.603) (-789.176) (-784.323) -- 0:00:20
698500 -- [-787.811] (-786.721) (-785.756) (-786.166) * [-784.810] (-785.719) (-788.790) (-787.570) -- 0:00:20
699000 -- (-787.505) (-788.091) (-785.512) [-786.255] * (-787.651) (-787.076) [-785.171] (-786.541) -- 0:00:20
699500 -- (-786.371) (-786.461) (-783.890) [-784.067] * (-787.035) (-786.859) [-786.328] (-784.748) -- 0:00:20
700000 -- (-787.284) (-788.048) [-783.735] (-784.791) * [-786.803] (-786.044) (-785.919) (-784.268) -- 0:00:20
Average standard deviation of split frequencies: 0.008284
700500 -- (-786.949) [-789.222] (-783.753) (-786.871) * (-785.176) (-789.630) (-784.811) [-786.377] -- 0:00:20
701000 -- [-786.364] (-786.487) (-786.156) (-788.582) * [-787.549] (-788.591) (-787.382) (-788.346) -- 0:00:20
701500 -- [-785.416] (-785.635) (-784.092) (-787.080) * (-784.673) [-784.557] (-788.423) (-786.870) -- 0:00:20
702000 -- (-788.370) (-785.068) (-785.010) [-784.831] * [-786.278] (-783.507) (-786.181) (-789.173) -- 0:00:20
702500 -- (-788.506) (-785.887) (-785.159) [-785.647] * [-786.869] (-783.505) (-786.140) (-787.048) -- 0:00:20
703000 -- (-785.124) [-785.290] (-784.830) (-791.506) * (-787.011) (-784.078) (-785.112) [-785.744] -- 0:00:20
703500 -- (-784.263) [-786.251] (-785.290) (-788.629) * [-784.278] (-786.662) (-785.787) (-786.634) -- 0:00:20
704000 -- (-784.795) [-786.471] (-785.117) (-786.484) * [-784.420] (-784.413) (-784.794) (-785.293) -- 0:00:20
704500 -- (-785.316) (-787.315) [-785.398] (-784.575) * (-785.633) [-786.503] (-786.386) (-783.820) -- 0:00:20
705000 -- (-784.669) (-784.877) [-787.250] (-784.475) * (-791.448) [-784.053] (-784.496) (-792.165) -- 0:00:20
Average standard deviation of split frequencies: 0.008639
705500 -- (-789.710) (-784.262) [-785.338] (-787.647) * (-786.687) [-786.550] (-787.529) (-784.578) -- 0:00:20
706000 -- [-785.311] (-787.469) (-785.538) (-784.587) * [-784.545] (-786.626) (-794.727) (-785.303) -- 0:00:20
706500 -- (-785.474) (-787.394) [-788.691] (-784.845) * (-788.058) (-785.295) [-786.005] (-784.147) -- 0:00:20
707000 -- [-787.841] (-786.821) (-785.454) (-785.914) * (-785.113) [-785.323] (-786.101) (-784.129) -- 0:00:20
707500 -- (-787.907) (-783.831) (-786.220) [-786.074] * (-788.238) (-784.647) (-787.800) [-783.788] -- 0:00:20
708000 -- (-790.240) (-785.990) [-787.051] (-786.479) * (-784.463) (-785.638) (-784.350) [-783.494] -- 0:00:20
708500 -- (-784.540) [-784.051] (-783.833) (-784.940) * (-784.419) [-788.292] (-784.328) (-785.218) -- 0:00:20
709000 -- (-787.972) (-785.994) (-786.504) [-784.290] * [-784.448] (-784.959) (-784.203) (-786.031) -- 0:00:20
709500 -- [-783.936] (-785.863) (-790.574) (-783.844) * (-785.629) (-786.496) [-785.026] (-788.719) -- 0:00:20
710000 -- (-787.192) (-789.835) (-788.385) [-785.888] * (-787.919) [-790.220] (-784.902) (-785.014) -- 0:00:20
Average standard deviation of split frequencies: 0.008913
710500 -- [-784.925] (-785.678) (-788.652) (-786.414) * (-785.850) [-784.140] (-788.905) (-786.969) -- 0:00:19
711000 -- (-789.745) (-784.942) [-786.855] (-784.753) * (-784.462) (-784.947) (-790.362) [-786.692] -- 0:00:19
711500 -- (-784.573) (-790.357) (-787.326) [-784.704] * [-787.538] (-784.734) (-785.962) (-784.769) -- 0:00:19
712000 -- [-784.849] (-788.911) (-784.999) (-785.363) * (-786.908) (-785.304) [-785.919] (-784.540) -- 0:00:19
712500 -- (-785.510) (-785.236) (-784.175) [-785.443] * (-784.280) [-786.714] (-786.211) (-785.483) -- 0:00:19
713000 -- [-784.662] (-783.826) (-787.989) (-783.895) * [-785.043] (-791.259) (-784.182) (-784.489) -- 0:00:19
713500 -- (-784.108) (-785.509) (-790.032) [-784.393] * (-783.801) [-786.162] (-789.013) (-788.688) -- 0:00:19
714000 -- (-784.461) (-785.375) [-783.685] (-783.732) * [-787.952] (-785.086) (-786.704) (-789.952) -- 0:00:19
714500 -- [-784.567] (-789.282) (-785.774) (-784.175) * (-791.444) (-784.367) (-783.350) [-784.114] -- 0:00:19
715000 -- [-787.214] (-791.460) (-786.975) (-790.661) * (-787.484) (-786.952) (-786.354) [-784.752] -- 0:00:19
Average standard deviation of split frequencies: 0.009012
715500 -- (-786.339) (-785.120) (-785.203) [-785.250] * (-785.985) (-787.088) [-784.510] (-785.969) -- 0:00:19
716000 -- (-784.340) (-788.170) [-784.611] (-785.364) * [-784.704] (-783.816) (-783.790) (-785.144) -- 0:00:19
716500 -- (-786.019) (-786.141) [-787.118] (-789.902) * (-785.342) (-784.162) (-785.147) [-784.847] -- 0:00:19
717000 -- [-786.974] (-786.089) (-786.135) (-784.828) * (-785.951) (-786.325) [-786.235] (-786.421) -- 0:00:19
717500 -- (-786.067) (-786.384) (-785.811) [-785.674] * (-786.047) [-785.249] (-783.686) (-792.510) -- 0:00:19
718000 -- (-786.083) (-784.860) (-786.042) [-786.261] * (-786.113) (-786.770) (-786.223) [-785.403] -- 0:00:19
718500 -- (-784.680) (-784.600) (-784.988) [-785.258] * (-787.972) (-785.677) [-787.910] (-784.554) -- 0:00:19
719000 -- (-786.299) (-784.678) (-784.318) [-786.622] * [-786.191] (-785.386) (-786.617) (-788.022) -- 0:00:19
719500 -- (-784.515) (-784.625) [-784.655] (-785.011) * (-784.934) (-787.155) [-784.933] (-786.811) -- 0:00:19
720000 -- (-784.154) [-784.880] (-784.937) (-790.252) * (-787.360) (-785.429) (-784.084) [-786.720] -- 0:00:19
Average standard deviation of split frequencies: 0.008953
720500 -- (-787.132) (-785.020) [-785.905] (-786.440) * (-784.896) [-787.872] (-783.872) (-786.983) -- 0:00:19
721000 -- (-785.258) (-786.807) [-786.369] (-786.746) * (-785.318) (-784.240) [-785.138] (-784.184) -- 0:00:19
721500 -- (-791.489) [-787.516] (-785.352) (-787.249) * [-784.568] (-784.937) (-786.631) (-785.734) -- 0:00:19
722000 -- (-791.405) (-786.279) [-786.917] (-785.622) * (-787.839) (-788.391) (-784.603) [-785.585] -- 0:00:19
722500 -- (-786.076) (-791.563) [-785.113] (-785.673) * [-787.253] (-787.991) (-784.813) (-786.064) -- 0:00:19
723000 -- [-784.958] (-783.612) (-785.286) (-785.704) * [-785.298] (-783.504) (-786.402) (-787.181) -- 0:00:19
723500 -- [-783.481] (-785.530) (-786.549) (-784.708) * (-785.784) [-785.859] (-787.862) (-787.692) -- 0:00:19
724000 -- [-787.285] (-786.330) (-786.152) (-785.521) * (-785.599) (-785.335) (-787.217) [-792.328] -- 0:00:19
724500 -- (-786.648) (-784.570) [-783.606] (-786.870) * (-784.536) (-788.408) [-786.530] (-786.871) -- 0:00:19
725000 -- [-785.727] (-784.763) (-785.309) (-783.460) * (-785.022) [-789.107] (-786.584) (-784.517) -- 0:00:18
Average standard deviation of split frequencies: 0.008441
725500 -- (-783.872) (-786.178) (-786.387) [-785.795] * (-788.906) [-786.293] (-787.399) (-788.837) -- 0:00:18
726000 -- (-785.226) (-786.459) (-784.711) [-788.979] * (-786.015) (-786.031) (-783.530) [-784.439] -- 0:00:18
726500 -- (-788.009) [-785.155] (-785.638) (-791.435) * [-783.550] (-787.694) (-789.257) (-784.890) -- 0:00:18
727000 -- (-784.605) [-786.771] (-785.028) (-787.688) * (-784.779) (-784.658) (-785.746) [-784.293] -- 0:00:18
727500 -- [-784.821] (-785.727) (-784.316) (-783.630) * [-785.052] (-787.345) (-784.907) (-787.507) -- 0:00:18
728000 -- [-784.242] (-784.659) (-789.076) (-783.942) * (-784.608) (-785.533) (-785.692) [-787.422] -- 0:00:18
728500 -- (-785.552) [-783.363] (-785.484) (-784.678) * (-786.803) (-789.438) (-790.879) [-785.812] -- 0:00:18
729000 -- (-785.801) (-784.742) (-783.844) [-784.501] * (-789.463) [-786.303] (-785.737) (-786.130) -- 0:00:18
729500 -- [-790.712] (-787.834) (-790.856) (-790.737) * (-783.962) (-784.204) (-787.393) [-783.891] -- 0:00:18
730000 -- (-784.782) (-784.488) (-789.193) [-786.330] * (-784.615) (-783.843) (-783.804) [-783.706] -- 0:00:18
Average standard deviation of split frequencies: 0.007863
730500 -- (-785.755) (-785.082) [-785.657] (-786.977) * [-787.293] (-783.719) (-785.090) (-784.244) -- 0:00:18
731000 -- (-788.772) [-785.273] (-786.344) (-785.430) * [-786.549] (-788.455) (-784.408) (-789.999) -- 0:00:18
731500 -- [-784.033] (-785.476) (-784.135) (-784.177) * (-787.474) (-788.508) [-784.087] (-789.876) -- 0:00:18
732000 -- [-785.666] (-785.870) (-786.966) (-785.353) * (-786.196) (-785.960) [-785.437] (-790.233) -- 0:00:18
732500 -- (-785.405) (-786.132) (-784.121) [-787.332] * (-787.329) [-784.989] (-788.021) (-791.219) -- 0:00:18
733000 -- (-787.498) (-788.529) [-785.359] (-787.879) * [-786.012] (-787.336) (-786.834) (-785.708) -- 0:00:18
733500 -- (-784.803) [-788.285] (-786.936) (-785.975) * (-786.772) [-787.367] (-783.494) (-784.496) -- 0:00:18
734000 -- (-783.512) (-784.549) (-784.611) [-785.439] * (-790.629) (-785.408) [-783.496] (-787.223) -- 0:00:18
734500 -- [-787.879] (-784.582) (-786.420) (-789.949) * (-785.924) (-787.448) [-786.043] (-795.641) -- 0:00:18
735000 -- (-785.260) [-786.522] (-785.267) (-787.561) * (-786.811) (-786.728) [-784.581] (-788.419) -- 0:00:18
Average standard deviation of split frequencies: 0.007406
735500 -- (-784.057) (-786.928) (-784.478) [-784.564] * (-785.416) [-789.965] (-786.072) (-786.998) -- 0:00:18
736000 -- (-785.996) (-789.278) (-784.527) [-784.456] * (-784.124) [-784.090] (-787.891) (-784.768) -- 0:00:18
736500 -- (-788.250) (-787.840) (-785.490) [-785.673] * (-784.966) (-784.576) [-784.460] (-785.441) -- 0:00:18
737000 -- (-784.832) (-785.582) [-786.608] (-784.600) * (-786.232) (-786.073) (-785.471) [-784.842] -- 0:00:18
737500 -- (-785.351) (-784.854) [-787.456] (-786.960) * (-785.356) (-784.847) (-788.444) [-784.436] -- 0:00:18
738000 -- (-787.726) (-786.029) [-784.111] (-784.847) * (-787.937) (-783.737) [-785.112] (-786.810) -- 0:00:18
738500 -- [-784.550] (-785.758) (-784.972) (-784.097) * [-785.956] (-784.697) (-786.672) (-784.415) -- 0:00:18
739000 -- (-783.903) (-784.257) (-786.075) [-783.697] * (-784.921) (-787.013) [-784.185] (-785.353) -- 0:00:18
739500 -- (-784.203) (-788.872) (-787.573) [-785.366] * (-785.571) (-785.590) [-787.580] (-785.567) -- 0:00:17
740000 -- [-787.944] (-785.272) (-786.346) (-786.315) * (-789.009) (-785.771) [-785.673] (-785.792) -- 0:00:17
Average standard deviation of split frequencies: 0.007439
740500 -- (-784.729) (-784.272) (-790.238) [-787.608] * (-784.437) (-783.469) [-786.598] (-785.264) -- 0:00:17
741000 -- [-785.187] (-787.753) (-789.802) (-791.351) * (-785.641) [-783.492] (-785.927) (-784.523) -- 0:00:17
741500 -- (-787.021) (-784.924) (-787.060) [-787.807] * [-786.381] (-783.492) (-787.376) (-786.808) -- 0:00:17
742000 -- [-784.783] (-784.496) (-788.113) (-786.621) * (-784.331) (-784.701) (-788.844) [-784.466] -- 0:00:17
742500 -- (-787.478) (-784.673) [-784.869] (-785.431) * (-788.151) (-784.355) [-789.836] (-783.770) -- 0:00:17
743000 -- (-787.563) (-791.746) [-785.604] (-783.506) * (-788.179) (-787.790) [-785.013] (-787.978) -- 0:00:17
743500 -- (-784.690) (-788.216) (-789.531) [-785.557] * (-786.453) (-784.337) [-786.550] (-784.955) -- 0:00:17
744000 -- (-785.795) (-792.287) [-784.417] (-784.370) * (-786.273) (-785.452) (-787.811) [-784.598] -- 0:00:17
744500 -- (-788.761) (-784.903) [-786.641] (-784.267) * [-787.483] (-783.996) (-786.759) (-789.080) -- 0:00:17
745000 -- (-788.764) [-785.842] (-788.535) (-784.124) * (-789.884) (-784.243) [-785.846] (-787.225) -- 0:00:17
Average standard deviation of split frequencies: 0.007148
745500 -- (-783.702) [-783.443] (-786.176) (-784.135) * (-785.373) [-785.966] (-787.042) (-785.962) -- 0:00:17
746000 -- [-783.735] (-783.501) (-791.032) (-785.896) * (-786.181) (-783.510) (-784.357) [-785.401] -- 0:00:17
746500 -- (-783.705) (-783.715) [-784.047] (-784.052) * [-788.024] (-784.548) (-785.167) (-784.879) -- 0:00:17
747000 -- [-784.275] (-783.716) (-788.565) (-784.670) * (-788.002) (-787.333) [-786.062] (-783.518) -- 0:00:17
747500 -- (-784.762) (-787.832) [-786.214] (-784.000) * (-785.506) (-784.795) (-785.116) [-784.409] -- 0:00:17
748000 -- [-786.640] (-784.353) (-784.794) (-786.060) * (-783.697) [-784.873] (-785.039) (-784.806) -- 0:00:17
748500 -- (-784.265) (-789.934) (-784.836) [-785.600] * [-784.627] (-785.629) (-784.457) (-784.677) -- 0:00:17
749000 -- (-787.406) (-784.579) [-786.294] (-784.540) * (-784.068) (-785.678) [-784.459] (-784.489) -- 0:00:17
749500 -- [-784.915] (-787.570) (-786.313) (-784.776) * (-784.125) (-785.842) (-796.216) [-783.893] -- 0:00:17
750000 -- (-784.047) (-786.244) [-784.198] (-784.495) * [-783.551] (-788.891) (-788.388) (-784.268) -- 0:00:17
Average standard deviation of split frequencies: 0.007732
750500 -- [-784.631] (-785.172) (-786.607) (-786.897) * (-783.583) (-783.792) (-784.463) [-785.306] -- 0:00:17
751000 -- (-785.446) (-784.485) (-784.878) [-785.518] * (-786.284) (-786.206) [-785.783] (-783.951) -- 0:00:17
751500 -- (-785.483) (-789.860) [-785.116] (-787.564) * [-789.233] (-792.142) (-786.406) (-784.114) -- 0:00:17
752000 -- (-787.431) [-787.431] (-784.170) (-783.584) * [-789.313] (-790.984) (-788.066) (-784.092) -- 0:00:17
752500 -- (-786.703) (-796.532) (-785.220) [-783.897] * [-785.231] (-788.343) (-787.561) (-784.585) -- 0:00:17
753000 -- [-785.081] (-785.992) (-784.011) (-785.242) * (-784.052) (-785.229) [-784.469] (-785.888) -- 0:00:17
753500 -- (-783.960) (-787.872) [-783.746] (-786.970) * (-784.004) (-783.782) (-784.446) [-784.277] -- 0:00:17
754000 -- (-784.817) [-788.217] (-787.396) (-787.631) * (-787.983) [-784.729] (-783.871) (-784.892) -- 0:00:16
754500 -- (-784.142) (-785.230) (-784.333) [-784.224] * (-785.524) (-784.510) [-785.606] (-786.790) -- 0:00:16
755000 -- [-783.919] (-784.942) (-785.489) (-788.471) * (-784.434) [-783.529] (-785.072) (-788.832) -- 0:00:16
Average standard deviation of split frequencies: 0.007561
755500 -- (-786.053) [-789.207] (-785.662) (-784.990) * (-784.985) [-785.128] (-784.112) (-785.554) -- 0:00:16
756000 -- (-786.898) (-792.364) (-784.948) [-785.894] * [-784.397] (-786.287) (-790.308) (-784.176) -- 0:00:16
756500 -- (-786.544) [-783.652] (-784.609) (-785.019) * (-784.343) (-786.791) [-787.074] (-785.996) -- 0:00:16
757000 -- [-785.052] (-785.009) (-786.118) (-788.523) * (-786.256) (-784.145) (-785.993) [-788.393] -- 0:00:16
757500 -- (-784.289) (-785.083) [-786.856] (-787.724) * (-786.014) (-786.645) (-783.327) [-787.515] -- 0:00:16
758000 -- (-785.836) (-786.761) [-787.361] (-785.098) * [-784.664] (-784.399) (-785.654) (-788.158) -- 0:00:16
758500 -- (-784.793) (-784.776) (-789.941) [-787.080] * (-784.932) (-786.665) (-791.250) [-787.862] -- 0:00:16
759000 -- (-783.948) (-785.002) [-792.701] (-790.772) * (-785.773) [-785.429] (-787.279) (-788.892) -- 0:00:16
759500 -- (-784.827) (-784.249) (-784.217) [-786.103] * (-786.269) [-784.138] (-788.435) (-785.717) -- 0:00:16
760000 -- (-787.223) (-786.878) [-785.162] (-791.678) * (-787.877) (-784.650) [-785.592] (-785.267) -- 0:00:16
Average standard deviation of split frequencies: 0.007514
760500 -- (-791.364) (-789.200) [-784.072] (-787.577) * (-785.460) [-786.772] (-785.409) (-787.097) -- 0:00:16
761000 -- (-786.285) (-784.717) (-787.118) [-785.496] * (-788.322) [-786.056] (-792.003) (-786.851) -- 0:00:16
761500 -- (-790.461) (-787.571) [-788.210] (-785.116) * (-789.303) (-786.351) [-786.170] (-784.088) -- 0:00:16
762000 -- (-784.910) (-784.616) (-786.992) [-786.813] * (-785.145) (-785.641) (-790.879) [-785.675] -- 0:00:16
762500 -- (-785.019) [-784.630] (-792.392) (-786.741) * (-787.422) (-786.304) (-787.543) [-784.859] -- 0:00:16
763000 -- (-784.349) [-791.513] (-789.109) (-791.292) * [-787.887] (-787.817) (-785.599) (-786.254) -- 0:00:16
763500 -- [-787.831] (-785.189) (-785.527) (-785.390) * [-784.971] (-786.380) (-785.924) (-787.334) -- 0:00:16
764000 -- [-785.421] (-784.256) (-790.709) (-784.941) * (-783.712) (-785.812) (-784.681) [-784.412] -- 0:00:16
764500 -- (-785.007) [-785.635] (-784.922) (-784.609) * (-784.704) (-786.071) [-786.679] (-784.796) -- 0:00:16
765000 -- [-784.040] (-784.929) (-785.719) (-783.453) * (-784.681) [-784.578] (-792.668) (-786.499) -- 0:00:16
Average standard deviation of split frequencies: 0.007116
765500 -- (-785.695) (-792.398) [-784.700] (-786.830) * (-783.369) [-786.117] (-784.844) (-784.655) -- 0:00:16
766000 -- (-787.660) (-787.374) (-786.936) [-786.576] * [-784.268] (-785.436) (-784.641) (-785.543) -- 0:00:16
766500 -- (-784.120) (-786.387) [-783.719] (-784.807) * (-785.517) (-787.574) [-783.664] (-785.302) -- 0:00:16
767000 -- [-785.051] (-783.924) (-786.884) (-785.373) * (-788.058) (-786.233) (-785.060) [-785.706] -- 0:00:16
767500 -- (-785.696) (-784.937) (-786.482) [-786.262] * (-786.452) (-784.300) [-785.973] (-785.108) -- 0:00:16
768000 -- (-787.562) [-783.798] (-783.877) (-787.395) * [-784.634] (-786.559) (-785.405) (-783.532) -- 0:00:16
768500 -- (-786.682) (-783.914) [-784.972] (-786.343) * [-786.319] (-786.799) (-784.524) (-784.253) -- 0:00:15
769000 -- (-784.168) (-785.263) (-789.878) [-783.616] * (-786.773) (-788.880) (-786.188) [-784.421] -- 0:00:15
769500 -- (-786.999) (-784.333) (-787.457) [-783.705] * (-786.958) (-783.832) (-785.309) [-784.551] -- 0:00:15
770000 -- (-786.699) [-784.659] (-788.716) (-787.055) * (-793.061) (-785.795) [-785.685] (-786.690) -- 0:00:15
Average standard deviation of split frequencies: 0.007556
770500 -- (-790.513) [-785.123] (-784.974) (-786.986) * (-785.771) [-786.844] (-785.820) (-787.042) -- 0:00:15
771000 -- (-784.177) [-784.522] (-786.269) (-783.948) * [-785.334] (-784.707) (-786.182) (-784.212) -- 0:00:15
771500 -- (-792.946) [-785.729] (-790.249) (-785.744) * (-785.023) (-786.261) (-786.631) [-785.165] -- 0:00:15
772000 -- (-784.498) (-787.114) [-785.765] (-789.598) * (-785.887) (-783.653) (-785.874) [-784.827] -- 0:00:15
772500 -- [-785.753] (-785.612) (-784.676) (-785.270) * (-785.770) (-785.903) (-785.316) [-784.480] -- 0:00:15
773000 -- (-785.349) (-786.468) (-783.928) [-784.520] * (-784.207) (-785.332) (-787.933) [-784.546] -- 0:00:15
773500 -- (-785.392) (-789.948) [-785.755] (-786.041) * (-784.895) (-786.859) (-787.537) [-786.425] -- 0:00:15
774000 -- [-785.412] (-784.790) (-784.105) (-785.302) * (-789.500) [-785.893] (-792.126) (-789.340) -- 0:00:15
774500 -- (-788.983) [-783.748] (-785.349) (-786.573) * (-791.770) (-785.912) (-785.610) [-787.059] -- 0:00:15
775000 -- (-785.411) [-784.572] (-783.766) (-785.222) * (-789.070) (-785.901) (-784.462) [-785.358] -- 0:00:15
Average standard deviation of split frequencies: 0.006644
775500 -- [-785.027] (-783.654) (-783.832) (-787.296) * (-788.234) [-786.958] (-783.539) (-787.200) -- 0:00:15
776000 -- (-787.820) (-788.190) [-784.115] (-785.760) * (-785.734) [-786.737] (-787.206) (-784.677) -- 0:00:15
776500 -- (-791.991) (-785.777) (-784.555) [-785.803] * (-783.813) (-785.817) (-786.973) [-785.242] -- 0:00:15
777000 -- (-784.225) [-789.920] (-784.853) (-784.290) * [-786.835] (-785.809) (-786.400) (-786.267) -- 0:00:15
777500 -- (-784.698) (-787.458) [-785.491] (-785.832) * (-783.871) (-784.784) (-790.439) [-785.061] -- 0:00:15
778000 -- [-786.651] (-788.727) (-792.006) (-785.166) * (-786.156) [-785.685] (-787.051) (-785.974) -- 0:00:15
778500 -- (-785.316) (-787.393) [-786.902] (-785.005) * (-786.642) [-785.750] (-787.113) (-784.949) -- 0:00:15
779000 -- (-786.078) [-786.100] (-787.008) (-786.862) * [-784.255] (-785.914) (-785.065) (-784.542) -- 0:00:15
779500 -- [-785.401] (-786.039) (-788.308) (-788.126) * (-788.971) (-786.230) [-785.879] (-792.017) -- 0:00:15
780000 -- (-788.211) (-787.755) (-785.517) [-786.365] * (-790.226) [-784.024] (-788.416) (-786.195) -- 0:00:15
Average standard deviation of split frequencies: 0.006680
780500 -- (-785.768) (-788.032) [-784.513] (-785.763) * (-787.975) (-785.577) (-783.697) [-785.446] -- 0:00:15
781000 -- (-784.249) (-787.756) (-784.012) [-785.065] * (-788.264) (-790.747) [-787.860] (-785.628) -- 0:00:15
781500 -- [-787.731] (-785.023) (-785.224) (-784.802) * [-787.598] (-785.121) (-787.046) (-786.491) -- 0:00:15
782000 -- [-785.923] (-783.650) (-785.694) (-785.977) * (-784.577) [-784.781] (-786.730) (-784.851) -- 0:00:15
782500 -- (-784.021) (-787.290) [-785.187] (-785.441) * (-783.857) (-784.115) [-785.919] (-786.503) -- 0:00:15
783000 -- (-786.747) [-786.282] (-785.449) (-785.084) * (-786.875) [-785.964] (-785.226) (-785.739) -- 0:00:14
783500 -- (-786.412) (-786.395) [-786.365] (-783.785) * [-785.503] (-787.575) (-787.955) (-785.854) -- 0:00:14
784000 -- (-784.437) [-786.569] (-785.459) (-789.347) * (-784.850) (-786.252) (-784.883) [-785.632] -- 0:00:14
784500 -- (-784.968) (-786.061) (-783.953) [-787.616] * (-786.982) (-785.525) [-783.609] (-785.087) -- 0:00:14
785000 -- (-784.954) (-786.542) [-786.395] (-785.350) * [-784.640] (-783.951) (-788.024) (-784.364) -- 0:00:14
Average standard deviation of split frequencies: 0.006372
785500 -- (-784.860) (-786.600) (-787.363) [-784.924] * [-784.562] (-784.302) (-786.224) (-786.102) -- 0:00:14
786000 -- [-783.965] (-786.387) (-787.420) (-786.873) * [-785.366] (-784.217) (-785.755) (-785.335) -- 0:00:14
786500 -- (-783.868) [-785.200] (-786.163) (-785.498) * (-790.053) (-783.918) (-785.320) [-786.647] -- 0:00:14
787000 -- [-784.315] (-786.479) (-785.858) (-787.513) * [-788.217] (-784.314) (-786.714) (-785.437) -- 0:00:14
787500 -- [-785.512] (-784.918) (-785.811) (-784.566) * (-788.317) (-785.905) (-786.448) [-786.502] -- 0:00:14
788000 -- (-784.539) (-784.336) (-784.249) [-785.961] * [-784.298] (-786.285) (-784.073) (-786.648) -- 0:00:14
788500 -- (-784.684) (-786.265) (-786.906) [-784.171] * (-784.238) [-786.810] (-784.100) (-785.264) -- 0:00:14
789000 -- (-785.706) (-790.335) (-785.003) [-783.497] * (-784.016) [-784.294] (-783.614) (-785.708) -- 0:00:14
789500 -- (-787.789) (-785.268) (-786.096) [-783.491] * (-788.445) (-785.851) (-783.758) [-788.933] -- 0:00:14
790000 -- (-785.212) (-783.750) [-787.377] (-789.083) * [-784.221] (-785.947) (-783.778) (-789.107) -- 0:00:14
Average standard deviation of split frequencies: 0.006260
790500 -- (-787.306) (-784.702) (-784.293) [-785.435] * (-785.550) (-785.422) [-786.776] (-785.508) -- 0:00:14
791000 -- [-786.847] (-787.316) (-783.576) (-784.768) * [-784.023] (-785.236) (-787.827) (-787.865) -- 0:00:14
791500 -- [-784.457] (-789.411) (-793.772) (-787.531) * (-785.177) (-785.879) [-784.445] (-787.758) -- 0:00:14
792000 -- [-784.993] (-785.661) (-786.284) (-783.959) * (-784.317) (-792.683) [-785.441] (-787.883) -- 0:00:14
792500 -- [-786.079] (-784.464) (-787.170) (-784.119) * [-784.396] (-788.372) (-786.322) (-787.479) -- 0:00:14
793000 -- (-785.269) (-784.393) [-783.380] (-784.862) * (-783.912) [-789.366] (-785.654) (-786.861) -- 0:00:14
793500 -- (-783.660) [-785.411] (-785.716) (-787.283) * (-785.792) (-787.678) [-785.097] (-785.859) -- 0:00:14
794000 -- (-786.644) (-786.431) (-786.687) [-784.773] * (-784.474) (-786.193) (-785.097) [-785.820] -- 0:00:14
794500 -- (-784.880) (-788.026) (-785.143) [-784.357] * (-788.482) (-785.338) [-786.187] (-784.804) -- 0:00:14
795000 -- [-785.271] (-784.430) (-786.880) (-786.480) * (-785.399) (-784.873) [-785.078] (-785.132) -- 0:00:14
Average standard deviation of split frequencies: 0.006366
795500 -- (-783.843) (-783.422) [-784.815] (-784.949) * (-790.052) [-784.985] (-792.840) (-784.396) -- 0:00:14
796000 -- [-787.930] (-786.855) (-790.057) (-786.423) * [-785.649] (-786.965) (-789.002) (-784.889) -- 0:00:14
796500 -- (-786.935) (-787.938) (-786.050) [-785.053] * (-786.673) (-787.502) [-785.717] (-783.505) -- 0:00:14
797000 -- (-785.336) (-789.344) (-785.569) [-786.823] * [-785.538] (-787.992) (-786.559) (-789.077) -- 0:00:14
797500 -- [-784.702] (-784.983) (-785.074) (-786.032) * [-787.017] (-786.135) (-784.766) (-785.172) -- 0:00:13
798000 -- (-785.993) [-784.710] (-784.267) (-784.294) * (-784.970) [-786.660] (-786.012) (-787.915) -- 0:00:13
798500 -- [-787.536] (-785.466) (-784.887) (-786.934) * [-787.492] (-785.480) (-784.467) (-784.712) -- 0:00:13
799000 -- (-786.924) [-786.102] (-785.375) (-784.248) * [-785.722] (-784.759) (-787.846) (-785.317) -- 0:00:13
799500 -- (-788.154) (-787.731) [-784.104] (-787.059) * (-785.949) (-786.632) [-788.827] (-786.785) -- 0:00:13
800000 -- (-788.962) [-787.753] (-783.678) (-789.334) * (-787.214) (-783.928) (-790.577) [-786.864] -- 0:00:13
Average standard deviation of split frequencies: 0.006182
800500 -- (-784.200) (-787.970) [-785.151] (-787.125) * (-786.423) [-784.657] (-785.819) (-783.775) -- 0:00:13
801000 -- (-787.847) (-783.652) (-789.197) [-786.169] * (-785.221) (-785.216) (-784.529) [-783.745] -- 0:00:13
801500 -- (-784.298) (-786.040) (-787.199) [-785.062] * (-785.583) [-784.980] (-788.587) (-783.850) -- 0:00:13
802000 -- (-784.256) (-787.661) (-787.119) [-784.814] * (-785.980) (-786.066) [-785.048] (-786.331) -- 0:00:13
802500 -- (-785.157) [-784.822] (-784.693) (-786.696) * (-785.769) [-784.961] (-784.595) (-785.508) -- 0:00:13
803000 -- (-788.646) (-784.851) (-787.612) [-784.881] * [-786.117] (-784.768) (-783.580) (-788.923) -- 0:00:13
803500 -- [-785.028] (-784.939) (-786.289) (-784.303) * [-786.007] (-786.232) (-784.113) (-786.280) -- 0:00:13
804000 -- (-783.887) (-785.538) [-787.599] (-785.987) * (-785.963) (-786.458) (-786.389) [-789.585] -- 0:00:13
804500 -- (-788.034) (-787.683) (-787.909) [-784.868] * (-785.529) (-785.527) (-789.044) [-784.738] -- 0:00:13
805000 -- (-786.720) (-784.255) (-785.842) [-784.439] * (-788.214) (-785.147) (-785.408) [-785.688] -- 0:00:13
Average standard deviation of split frequencies: 0.006141
805500 -- (-789.180) (-784.001) [-786.001] (-784.867) * (-783.695) [-783.992] (-793.812) (-788.754) -- 0:00:13
806000 -- (-789.958) (-783.553) (-784.420) [-784.343] * (-784.040) (-784.083) [-784.597] (-786.347) -- 0:00:13
806500 -- (-784.742) (-788.276) (-785.636) [-783.994] * (-785.544) (-784.245) [-787.922] (-785.990) -- 0:00:13
807000 -- (-786.493) [-793.041] (-786.117) (-784.631) * (-785.540) (-787.166) [-786.745] (-786.133) -- 0:00:13
807500 -- [-784.273] (-786.249) (-786.377) (-784.974) * [-784.239] (-783.503) (-785.583) (-785.858) -- 0:00:13
808000 -- (-784.744) (-786.058) (-785.631) [-786.993] * (-785.440) (-783.272) [-788.470] (-786.411) -- 0:00:13
808500 -- (-785.377) [-784.924] (-784.094) (-786.130) * (-784.002) [-787.150] (-785.340) (-789.366) -- 0:00:13
809000 -- [-785.422] (-785.012) (-783.748) (-787.351) * (-784.368) (-788.466) (-783.797) [-788.040] -- 0:00:13
809500 -- (-787.800) (-785.683) (-783.798) [-785.804] * (-784.315) [-785.104] (-783.999) (-784.412) -- 0:00:13
810000 -- (-785.147) (-788.797) [-784.820] (-784.268) * (-784.168) (-784.087) (-787.252) [-785.980] -- 0:00:13
Average standard deviation of split frequencies: 0.006069
810500 -- (-787.439) [-786.547] (-785.364) (-792.251) * (-785.149) (-783.765) [-784.863] (-785.488) -- 0:00:13
811000 -- [-785.734] (-784.993) (-785.545) (-788.429) * (-785.594) (-784.292) (-785.012) [-785.045] -- 0:00:13
811500 -- (-787.489) (-784.520) [-790.456] (-787.677) * (-785.594) (-787.553) [-784.808] (-786.328) -- 0:00:13
812000 -- (-783.887) [-787.210] (-788.214) (-784.137) * (-786.093) (-787.038) [-785.162] (-787.388) -- 0:00:12
812500 -- (-787.728) (-785.645) [-785.386] (-784.536) * [-786.887] (-785.004) (-785.636) (-784.500) -- 0:00:12
813000 -- (-786.406) (-786.589) [-785.397] (-783.779) * [-784.152] (-784.970) (-785.554) (-788.365) -- 0:00:12
813500 -- (-786.574) (-793.179) (-784.093) [-785.459] * [-785.096] (-787.379) (-786.247) (-787.496) -- 0:00:12
814000 -- (-785.023) (-793.782) [-784.688] (-787.161) * (-786.897) [-789.655] (-788.939) (-784.518) -- 0:00:12
814500 -- (-787.942) (-787.384) (-789.523) [-786.343] * (-786.899) (-784.458) (-790.291) [-784.025] -- 0:00:12
815000 -- (-783.784) [-786.215] (-785.583) (-786.330) * (-786.396) (-784.894) (-784.718) [-783.381] -- 0:00:12
Average standard deviation of split frequencies: 0.006138
815500 -- (-792.071) (-785.592) [-788.069] (-784.440) * [-784.762] (-786.071) (-785.386) (-784.568) -- 0:00:12
816000 -- (-784.532) (-783.416) [-786.786] (-784.901) * [-786.000] (-787.618) (-785.194) (-787.094) -- 0:00:12
816500 -- (-784.678) (-786.041) (-787.190) [-785.382] * (-788.305) (-790.430) [-786.751] (-784.332) -- 0:00:12
817000 -- (-789.144) (-786.550) (-785.921) [-784.610] * (-788.193) (-785.326) (-785.608) [-788.937] -- 0:00:12
817500 -- (-785.030) [-789.260] (-785.883) (-784.732) * (-785.977) (-786.054) [-783.628] (-791.198) -- 0:00:12
818000 -- (-788.312) [-785.332] (-785.447) (-785.163) * (-788.447) [-786.749] (-785.063) (-784.659) -- 0:00:12
818500 -- (-788.530) [-784.921] (-783.875) (-784.679) * (-786.000) [-786.358] (-784.872) (-785.048) -- 0:00:12
819000 -- [-786.394] (-789.571) (-784.857) (-788.498) * [-785.067] (-783.934) (-787.434) (-788.411) -- 0:00:12
819500 -- [-784.976] (-785.630) (-784.863) (-786.984) * (-785.223) (-785.060) (-783.885) [-784.833] -- 0:00:12
820000 -- (-786.996) (-788.007) [-786.286] (-786.695) * (-785.603) [-785.024] (-786.534) (-784.867) -- 0:00:12
Average standard deviation of split frequencies: 0.005960
820500 -- (-785.756) [-788.098] (-784.788) (-785.947) * (-784.902) (-791.794) [-784.026] (-785.573) -- 0:00:12
821000 -- (-786.125) (-786.103) [-784.277] (-783.884) * (-785.223) [-785.471] (-784.690) (-786.839) -- 0:00:12
821500 -- [-786.514] (-786.376) (-785.461) (-785.456) * (-787.741) (-785.863) [-786.127] (-788.842) -- 0:00:12
822000 -- (-787.319) [-784.365] (-786.219) (-785.112) * (-786.587) (-785.835) (-784.786) [-786.675] -- 0:00:12
822500 -- [-785.109] (-784.867) (-784.518) (-785.051) * (-783.848) [-786.975] (-787.713) (-784.348) -- 0:00:12
823000 -- (-786.833) [-785.134] (-784.354) (-785.492) * (-784.492) (-785.238) [-786.094] (-784.051) -- 0:00:12
823500 -- (-789.434) (-788.989) [-785.227] (-785.698) * (-786.973) [-785.909] (-785.245) (-786.549) -- 0:00:12
824000 -- (-785.777) (-787.563) (-784.686) [-789.096] * (-784.473) (-787.505) [-785.547] (-784.872) -- 0:00:12
824500 -- (-788.792) (-783.761) [-785.656] (-787.857) * (-785.128) (-787.146) [-785.070] (-785.789) -- 0:00:12
825000 -- (-784.950) [-783.876] (-787.053) (-787.868) * (-785.157) (-787.608) (-785.470) [-785.468] -- 0:00:12
Average standard deviation of split frequencies: 0.006028
825500 -- (-786.349) (-784.559) [-783.962] (-784.965) * (-784.261) [-783.931] (-791.034) (-785.746) -- 0:00:12
826000 -- (-785.628) (-790.096) [-791.668] (-786.304) * (-785.821) (-785.844) [-787.545] (-785.443) -- 0:00:12
826500 -- (-786.304) (-788.823) (-785.800) [-787.134] * (-786.139) (-784.401) (-789.961) [-784.153] -- 0:00:11
827000 -- [-783.739] (-784.804) (-784.757) (-788.678) * [-788.301] (-786.508) (-787.549) (-785.735) -- 0:00:11
827500 -- (-786.022) [-786.504] (-784.645) (-788.710) * (-785.085) (-785.560) (-787.437) [-787.334] -- 0:00:11
828000 -- (-784.832) (-785.098) [-786.074] (-791.670) * (-786.079) (-785.163) [-785.686] (-785.692) -- 0:00:11
828500 -- (-784.228) (-783.516) (-787.373) [-786.040] * [-785.892] (-784.536) (-786.470) (-785.602) -- 0:00:11
829000 -- (-784.945) (-784.299) [-784.117] (-783.318) * (-790.493) [-786.163] (-785.061) (-785.387) -- 0:00:11
829500 -- [-784.634] (-784.278) (-785.176) (-783.316) * (-784.144) (-789.817) (-785.747) [-783.716] -- 0:00:11
830000 -- (-785.015) [-784.990] (-785.221) (-783.667) * [-786.248] (-786.835) (-787.273) (-783.610) -- 0:00:11
Average standard deviation of split frequencies: 0.005888
830500 -- [-785.515] (-787.555) (-787.802) (-783.362) * (-786.652) [-785.155] (-784.979) (-783.608) -- 0:00:11
831000 -- (-788.420) (-785.651) [-788.323] (-785.670) * (-786.480) [-784.303] (-785.525) (-783.921) -- 0:00:11
831500 -- (-785.885) (-786.470) [-786.581] (-785.545) * (-786.391) [-786.193] (-786.133) (-787.193) -- 0:00:11
832000 -- (-789.141) [-785.551] (-785.119) (-788.774) * (-790.663) [-785.441] (-787.859) (-784.583) -- 0:00:11
832500 -- (-787.618) [-783.837] (-786.716) (-786.162) * (-789.667) (-784.547) (-785.789) [-786.929] -- 0:00:11
833000 -- [-785.126] (-787.215) (-786.947) (-788.347) * (-786.647) (-786.185) (-784.272) [-785.485] -- 0:00:11
833500 -- [-784.985] (-785.705) (-783.893) (-784.532) * (-785.401) (-784.359) [-785.389] (-784.196) -- 0:00:11
834000 -- (-784.975) [-785.480] (-784.957) (-783.435) * (-783.791) [-792.403] (-797.608) (-789.052) -- 0:00:11
834500 -- (-784.430) (-787.792) [-784.957] (-784.344) * [-783.818] (-788.526) (-788.799) (-788.955) -- 0:00:11
835000 -- [-785.738] (-786.920) (-786.663) (-784.523) * (-785.329) [-784.786] (-784.176) (-785.306) -- 0:00:11
Average standard deviation of split frequencies: 0.006203
835500 -- [-786.266] (-786.859) (-786.831) (-785.654) * [-784.803] (-784.060) (-790.390) (-788.085) -- 0:00:11
836000 -- [-784.560] (-787.333) (-786.944) (-784.355) * (-785.588) (-787.185) [-787.062] (-791.266) -- 0:00:11
836500 -- (-784.182) (-784.659) [-784.120] (-784.943) * (-786.232) (-786.671) (-786.347) [-787.486] -- 0:00:11
837000 -- (-785.838) (-785.646) [-784.690] (-787.398) * [-784.977] (-784.243) (-785.138) (-789.050) -- 0:00:11
837500 -- (-785.313) (-786.490) [-788.434] (-785.249) * [-785.541] (-784.939) (-785.442) (-788.638) -- 0:00:11
838000 -- (-787.432) (-785.051) [-784.143] (-785.876) * (-786.062) (-787.552) [-784.445] (-787.034) -- 0:00:11
838500 -- (-785.928) [-787.236] (-784.690) (-784.979) * (-784.753) (-783.917) [-784.137] (-787.838) -- 0:00:11
839000 -- (-791.259) (-787.071) [-784.908] (-785.829) * (-784.822) (-783.891) [-784.238] (-786.726) -- 0:00:11
839500 -- (-785.478) [-785.440] (-785.967) (-787.403) * (-784.384) [-784.183] (-785.096) (-784.009) -- 0:00:11
840000 -- (-786.077) [-784.582] (-789.357) (-786.963) * (-785.193) (-784.156) [-784.623] (-784.768) -- 0:00:11
Average standard deviation of split frequencies: 0.006168
840500 -- (-785.908) [-784.475] (-784.812) (-787.794) * (-786.457) (-784.711) [-784.514] (-784.690) -- 0:00:11
841000 -- [-786.787] (-786.136) (-787.900) (-788.094) * (-785.991) (-784.262) (-785.144) [-784.575] -- 0:00:10
841500 -- (-785.902) (-784.631) [-786.667] (-786.159) * (-785.737) [-786.926] (-785.652) (-783.878) -- 0:00:10
842000 -- (-788.977) (-784.528) (-785.912) [-785.311] * (-789.634) (-785.512) (-784.984) [-787.187] -- 0:00:10
842500 -- [-784.664] (-786.887) (-786.710) (-787.857) * (-786.389) (-784.253) [-783.641] (-785.156) -- 0:00:10
843000 -- [-784.458] (-787.333) (-785.535) (-785.677) * [-790.013] (-784.598) (-786.842) (-784.987) -- 0:00:10
843500 -- [-784.780] (-787.846) (-785.844) (-786.218) * [-784.429] (-788.026) (-785.366) (-783.653) -- 0:00:10
844000 -- (-786.073) (-785.246) (-785.460) [-785.698] * (-783.761) [-786.248] (-786.272) (-783.911) -- 0:00:10
844500 -- (-785.497) (-785.174) (-783.558) [-784.376] * [-785.189] (-785.324) (-784.929) (-787.984) -- 0:00:10
845000 -- (-788.760) (-785.845) (-787.186) [-786.665] * (-784.750) (-784.567) (-785.990) [-789.311] -- 0:00:10
Average standard deviation of split frequencies: 0.006547
845500 -- [-786.494] (-784.636) (-787.664) (-789.509) * (-787.528) (-785.960) (-784.222) [-791.235] -- 0:00:10
846000 -- [-787.064] (-786.855) (-788.580) (-787.485) * (-787.689) [-786.294] (-784.955) (-786.052) -- 0:00:10
846500 -- (-785.270) (-788.183) [-789.307] (-788.178) * (-787.749) (-784.714) (-788.075) [-787.032] -- 0:00:10
847000 -- (-785.365) (-786.038) (-786.878) [-787.973] * [-785.685] (-786.889) (-790.879) (-787.593) -- 0:00:10
847500 -- [-785.404] (-783.775) (-783.936) (-787.619) * [-783.685] (-784.537) (-785.318) (-791.200) -- 0:00:10
848000 -- [-785.857] (-783.854) (-787.901) (-784.828) * (-785.779) [-784.239] (-790.273) (-787.222) -- 0:00:10
848500 -- [-786.646] (-784.916) (-791.734) (-787.279) * (-785.631) (-783.794) [-790.448] (-784.581) -- 0:00:10
849000 -- (-785.668) (-791.625) [-783.974] (-786.477) * (-784.872) (-785.349) (-784.963) [-786.294] -- 0:00:10
849500 -- (-787.454) (-787.011) [-786.287] (-787.228) * (-784.587) (-783.412) (-784.025) [-784.718] -- 0:00:10
850000 -- (-785.941) [-785.367] (-784.560) (-787.249) * (-786.317) [-784.195] (-783.783) (-788.826) -- 0:00:10
Average standard deviation of split frequencies: 0.006269
850500 -- [-784.598] (-787.447) (-783.747) (-787.219) * [-784.808] (-785.133) (-785.912) (-791.168) -- 0:00:10
851000 -- (-784.019) (-784.257) [-786.926] (-785.429) * [-787.608] (-789.182) (-788.318) (-785.315) -- 0:00:10
851500 -- [-784.745] (-787.032) (-785.604) (-786.171) * (-785.171) (-786.495) (-787.774) [-784.300] -- 0:00:10
852000 -- [-785.085] (-787.840) (-785.080) (-787.888) * (-785.806) (-784.212) [-785.618] (-788.952) -- 0:00:10
852500 -- (-785.096) [-785.399] (-784.372) (-786.242) * [-785.027] (-784.733) (-785.650) (-784.592) -- 0:00:10
853000 -- (-784.410) (-785.852) (-785.580) [-784.863] * (-783.906) (-786.770) (-786.304) [-787.629] -- 0:00:10
853500 -- (-786.141) (-786.491) [-786.908] (-785.394) * [-786.406] (-784.574) (-787.238) (-784.798) -- 0:00:10
854000 -- (-785.166) (-784.236) (-787.419) [-788.485] * (-789.195) (-784.117) (-784.750) [-785.552] -- 0:00:10
854500 -- (-789.166) (-787.378) (-787.309) [-785.239] * (-787.053) (-791.846) (-785.754) [-784.500] -- 0:00:10
855000 -- (-787.396) (-784.482) (-784.102) [-784.937] * (-785.514) (-790.233) (-783.972) [-785.447] -- 0:00:10
Average standard deviation of split frequencies: 0.006058
855500 -- (-784.899) (-786.263) (-785.712) [-785.004] * (-785.401) [-786.478] (-784.497) (-784.568) -- 0:00:09
856000 -- [-785.505] (-783.795) (-785.078) (-786.280) * [-784.406] (-784.559) (-783.497) (-786.857) -- 0:00:09
856500 -- (-785.950) [-785.323] (-784.660) (-785.254) * (-784.493) (-783.930) (-786.099) [-786.116] -- 0:00:09
857000 -- (-785.762) (-785.446) [-783.741] (-783.813) * (-786.862) (-783.309) [-786.511] (-786.767) -- 0:00:09
857500 -- (-785.087) (-784.602) [-784.608] (-786.381) * [-785.608] (-783.309) (-785.134) (-786.103) -- 0:00:09
858000 -- (-787.069) (-784.944) (-784.548) [-788.124] * (-787.870) [-784.194] (-784.266) (-784.228) -- 0:00:09
858500 -- (-783.667) (-787.370) (-785.139) [-784.949] * (-785.804) (-784.057) [-787.640] (-783.766) -- 0:00:09
859000 -- (-783.592) (-783.853) (-783.932) [-787.994] * [-790.732] (-784.080) (-787.533) (-786.901) -- 0:00:09
859500 -- (-786.245) (-788.385) (-784.118) [-786.569] * [-788.182] (-785.388) (-787.356) (-785.195) -- 0:00:09
860000 -- (-788.686) [-784.050] (-785.811) (-785.470) * (-785.060) [-787.225] (-787.473) (-783.504) -- 0:00:09
Average standard deviation of split frequencies: 0.006093
860500 -- (-784.587) (-784.636) (-789.585) [-784.593] * (-783.975) (-785.948) (-788.591) [-784.587] -- 0:00:09
861000 -- (-784.817) (-785.826) (-786.522) [-784.671] * (-784.999) [-786.083] (-788.401) (-785.131) -- 0:00:09
861500 -- (-785.200) [-784.238] (-789.224) (-791.645) * [-784.287] (-783.855) (-784.673) (-786.972) -- 0:00:09
862000 -- (-785.360) [-784.373] (-787.182) (-787.542) * (-784.976) (-784.279) [-785.340] (-785.756) -- 0:00:09
862500 -- (-786.584) (-785.516) (-788.714) [-786.013] * (-787.824) [-784.588] (-784.686) (-784.396) -- 0:00:09
863000 -- (-783.580) [-785.910] (-786.573) (-783.753) * [-787.761] (-787.360) (-783.856) (-783.940) -- 0:00:09
863500 -- [-787.648] (-789.499) (-788.333) (-783.729) * [-786.514] (-787.937) (-784.108) (-785.327) -- 0:00:09
864000 -- (-786.134) (-785.747) [-785.408] (-783.777) * (-786.039) (-785.155) (-786.387) [-783.990] -- 0:00:09
864500 -- [-785.944] (-785.869) (-786.691) (-784.653) * (-784.911) [-786.370] (-785.147) (-785.995) -- 0:00:09
865000 -- (-787.176) (-788.302) (-784.396) [-784.030] * (-784.959) (-787.548) (-785.074) [-783.707] -- 0:00:09
Average standard deviation of split frequencies: 0.006362
865500 -- (-787.705) (-788.172) (-785.106) [-784.036] * (-784.070) [-784.221] (-784.089) (-785.114) -- 0:00:09
866000 -- (-784.561) [-784.351] (-783.956) (-785.465) * (-785.403) (-784.469) [-786.065] (-784.446) -- 0:00:09
866500 -- (-784.516) (-784.583) [-783.669] (-786.524) * (-785.875) [-787.364] (-783.544) (-786.134) -- 0:00:09
867000 -- [-784.158] (-783.971) (-786.567) (-783.997) * (-783.929) [-784.392] (-785.666) (-785.111) -- 0:00:09
867500 -- (-784.812) (-786.566) (-787.051) [-784.781] * (-784.092) [-785.272] (-784.761) (-786.568) -- 0:00:09
868000 -- (-784.057) (-784.680) [-785.961] (-785.012) * (-785.124) (-785.447) (-784.768) [-788.028] -- 0:00:09
868500 -- (-787.953) [-788.439] (-787.037) (-784.263) * (-787.028) [-786.117] (-789.374) (-785.633) -- 0:00:09
869000 -- (-785.759) [-788.621] (-786.491) (-788.928) * (-784.957) (-785.183) (-786.163) [-786.608] -- 0:00:09
869500 -- (-785.029) (-786.217) [-784.765] (-786.983) * (-784.591) (-786.474) [-783.605] (-786.034) -- 0:00:09
870000 -- (-784.267) [-784.474] (-784.376) (-785.913) * [-785.114] (-784.997) (-784.607) (-788.071) -- 0:00:08
Average standard deviation of split frequencies: 0.006226
870500 -- (-786.816) (-787.525) [-784.391] (-785.352) * [-785.332] (-785.058) (-784.698) (-784.666) -- 0:00:08
871000 -- (-787.675) (-784.177) [-785.059] (-786.277) * (-784.219) (-785.847) [-785.467] (-784.143) -- 0:00:08
871500 -- [-786.734] (-788.644) (-784.792) (-785.099) * (-785.436) (-785.093) [-785.020] (-786.762) -- 0:00:08
872000 -- (-786.715) (-785.987) [-785.157] (-784.493) * (-785.234) [-784.177] (-786.688) (-788.593) -- 0:00:08
872500 -- (-785.340) (-785.697) [-785.470] (-787.101) * (-785.224) (-785.906) [-786.068] (-788.062) -- 0:00:08
873000 -- (-786.268) (-785.664) (-785.352) [-785.501] * [-790.894] (-786.815) (-784.713) (-787.091) -- 0:00:08
873500 -- (-786.143) [-786.135] (-788.383) (-789.772) * (-784.444) [-786.044] (-786.797) (-785.757) -- 0:00:08
874000 -- [-789.427] (-789.338) (-784.686) (-783.620) * (-785.771) [-784.403] (-785.295) (-787.204) -- 0:00:08
874500 -- (-785.812) (-784.130) [-784.048] (-784.772) * [-785.286] (-783.527) (-784.598) (-788.290) -- 0:00:08
875000 -- (-786.879) [-785.617] (-783.859) (-785.355) * (-785.800) [-787.930] (-784.445) (-786.345) -- 0:00:08
Average standard deviation of split frequencies: 0.006760
875500 -- (-786.006) (-785.075) (-785.164) [-787.098] * (-787.825) (-787.494) [-783.715] (-787.982) -- 0:00:08
876000 -- (-787.725) (-784.693) (-784.301) [-785.924] * (-786.659) (-789.021) [-784.725] (-785.456) -- 0:00:08
876500 -- (-785.844) (-783.646) [-783.833] (-784.044) * [-786.685] (-784.340) (-785.988) (-786.488) -- 0:00:08
877000 -- (-784.705) (-783.618) [-783.466] (-785.047) * [-789.145] (-784.946) (-786.195) (-786.132) -- 0:00:08
877500 -- [-785.398] (-785.378) (-787.938) (-783.695) * (-787.821) [-783.356] (-786.299) (-785.040) -- 0:00:08
878000 -- (-785.125) (-783.493) (-786.342) [-783.695] * (-789.391) [-786.495] (-787.071) (-786.029) -- 0:00:08
878500 -- (-786.646) (-783.699) [-784.342] (-787.452) * (-786.801) (-786.106) [-785.377] (-787.431) -- 0:00:08
879000 -- (-786.510) [-784.109] (-788.774) (-787.262) * [-784.162] (-784.391) (-784.201) (-785.458) -- 0:00:08
879500 -- (-785.107) [-784.044] (-784.537) (-784.797) * (-784.151) [-784.281] (-786.620) (-785.469) -- 0:00:08
880000 -- (-786.477) (-787.879) (-785.570) [-784.503] * [-784.519] (-783.861) (-784.581) (-784.753) -- 0:00:08
Average standard deviation of split frequencies: 0.006624
880500 -- (-783.849) (-785.869) (-785.090) [-783.454] * [-786.566] (-785.025) (-784.181) (-784.913) -- 0:00:08
881000 -- (-783.525) (-786.552) (-784.656) [-785.633] * (-788.927) [-784.053] (-785.004) (-787.444) -- 0:00:08
881500 -- [-784.686] (-783.887) (-783.755) (-786.548) * (-786.955) (-786.380) [-784.357] (-786.679) -- 0:00:08
882000 -- (-787.393) [-783.669] (-784.757) (-786.354) * (-790.577) [-784.297] (-788.473) (-788.020) -- 0:00:08
882500 -- (-787.731) (-783.878) [-785.437] (-785.381) * (-784.208) (-785.257) [-785.028] (-786.979) -- 0:00:08
883000 -- (-790.954) [-785.597] (-784.788) (-783.497) * (-785.178) [-785.086] (-785.265) (-788.651) -- 0:00:08
883500 -- (-784.503) [-785.188] (-785.210) (-786.508) * (-785.685) [-784.732] (-785.735) (-787.844) -- 0:00:08
884000 -- (-784.292) [-783.641] (-786.326) (-786.404) * [-785.955] (-784.634) (-784.676) (-786.492) -- 0:00:08
884500 -- (-785.471) [-787.126] (-789.491) (-789.632) * [-785.395] (-785.039) (-786.986) (-786.072) -- 0:00:07
885000 -- (-784.696) (-783.779) [-788.197] (-786.646) * (-785.185) [-786.639] (-787.930) (-784.900) -- 0:00:07
Average standard deviation of split frequencies: 0.006884
885500 -- (-785.812) (-785.497) (-785.208) [-785.690] * [-786.129] (-786.257) (-787.597) (-784.632) -- 0:00:07
886000 -- (-787.147) [-787.099] (-785.208) (-789.587) * [-784.230] (-787.694) (-786.547) (-785.323) -- 0:00:07
886500 -- (-789.117) (-784.645) [-786.686] (-785.453) * (-784.880) [-787.687] (-785.188) (-785.058) -- 0:00:07
887000 -- (-786.022) (-792.130) [-783.988] (-784.408) * (-785.171) (-785.807) (-784.573) [-786.113] -- 0:00:07
887500 -- [-785.330] (-789.924) (-785.817) (-784.886) * (-785.766) (-787.365) [-785.309] (-788.141) -- 0:00:07
888000 -- [-783.982] (-784.470) (-784.604) (-785.095) * [-784.217] (-790.255) (-785.787) (-787.225) -- 0:00:07
888500 -- (-789.969) (-786.251) (-786.116) [-784.646] * (-784.757) (-785.113) (-787.060) [-786.555] -- 0:00:07
889000 -- (-792.354) [-784.497] (-787.046) (-783.843) * (-785.783) (-783.614) (-787.315) [-784.040] -- 0:00:07
889500 -- (-784.994) (-785.861) (-789.621) [-786.981] * (-784.503) (-784.342) [-783.896] (-785.135) -- 0:00:07
890000 -- [-786.537] (-787.074) (-789.777) (-788.653) * (-786.529) [-784.061] (-784.953) (-784.726) -- 0:00:07
Average standard deviation of split frequencies: 0.006914
890500 -- (-785.857) [-786.620] (-785.562) (-786.077) * (-788.414) [-786.758] (-784.423) (-786.981) -- 0:00:07
891000 -- (-784.949) [-788.148] (-783.775) (-784.192) * (-790.426) [-784.098] (-785.191) (-787.306) -- 0:00:07
891500 -- (-785.773) (-789.831) (-784.960) [-783.857] * (-787.953) (-784.658) (-785.495) [-784.879] -- 0:00:07
892000 -- [-785.133] (-784.982) (-785.665) (-784.107) * (-786.432) (-787.546) [-786.947] (-786.909) -- 0:00:07
892500 -- [-784.416] (-787.122) (-787.795) (-786.238) * (-785.631) (-786.120) (-786.203) [-784.892] -- 0:00:07
893000 -- (-786.995) (-789.557) (-788.198) [-785.233] * (-787.912) (-786.921) (-789.186) [-783.997] -- 0:00:07
893500 -- (-786.858) [-786.081] (-787.238) (-785.899) * (-786.190) [-784.006] (-785.906) (-784.784) -- 0:00:07
894000 -- (-785.366) (-786.680) [-785.677] (-791.891) * (-789.687) (-785.075) [-785.499] (-786.993) -- 0:00:07
894500 -- (-784.401) (-784.240) (-785.827) [-785.544] * (-787.558) [-785.027] (-787.475) (-786.318) -- 0:00:07
895000 -- [-786.287] (-786.424) (-789.059) (-787.888) * (-785.073) (-784.037) (-788.810) [-787.484] -- 0:00:07
Average standard deviation of split frequencies: 0.006840
895500 -- (-784.602) [-784.051] (-783.627) (-786.072) * (-785.735) [-786.737] (-785.658) (-786.513) -- 0:00:07
896000 -- (-787.506) (-784.223) (-785.784) [-785.981] * (-785.554) [-786.217] (-784.958) (-786.613) -- 0:00:07
896500 -- (-785.766) (-787.544) (-786.453) [-784.747] * [-785.116] (-789.269) (-786.925) (-784.395) -- 0:00:07
897000 -- (-786.964) (-785.060) [-785.856] (-787.352) * (-783.878) (-792.473) [-787.773] (-784.673) -- 0:00:07
897500 -- (-785.844) (-785.147) [-786.603] (-786.724) * [-786.310] (-794.048) (-792.013) (-785.479) -- 0:00:07
898000 -- (-794.119) (-784.851) [-785.359] (-785.318) * (-789.399) [-788.191] (-789.908) (-786.405) -- 0:00:07
898500 -- [-788.995] (-784.489) (-785.895) (-784.569) * (-786.298) (-784.771) [-784.687] (-784.527) -- 0:00:07
899000 -- (-785.901) (-786.215) [-786.934] (-785.262) * (-787.078) (-790.427) (-787.672) [-785.678] -- 0:00:06
899500 -- (-786.120) (-787.357) [-784.998] (-784.376) * (-786.118) (-786.473) [-786.568] (-784.728) -- 0:00:06
900000 -- (-785.708) [-784.890] (-785.144) (-785.398) * (-785.465) [-787.892] (-784.662) (-788.648) -- 0:00:06
Average standard deviation of split frequencies: 0.006870
900500 -- [-785.342] (-788.350) (-784.092) (-791.052) * (-785.154) (-785.905) (-783.952) [-789.559] -- 0:00:06
901000 -- (-786.399) [-789.637] (-788.950) (-786.488) * (-786.079) (-784.431) [-784.893] (-784.000) -- 0:00:06
901500 -- (-785.012) [-784.131] (-787.140) (-785.611) * (-785.533) [-784.989] (-786.161) (-786.395) -- 0:00:06
902000 -- (-785.644) (-785.100) (-785.890) [-786.628] * (-786.123) (-784.203) (-786.131) [-787.291] -- 0:00:06
902500 -- [-786.048] (-785.413) (-788.943) (-787.544) * [-788.886] (-784.000) (-783.941) (-784.697) -- 0:00:06
903000 -- (-786.434) (-784.175) (-789.529) [-783.663] * (-787.170) [-784.138] (-788.064) (-784.415) -- 0:00:06
903500 -- [-786.137] (-784.410) (-787.377) (-783.541) * (-788.415) (-785.088) [-788.616] (-785.722) -- 0:00:06
904000 -- (-786.125) (-786.204) [-785.330] (-785.105) * [-785.633] (-785.880) (-786.773) (-783.370) -- 0:00:06
904500 -- (-784.208) (-783.726) (-784.758) [-783.736] * (-787.886) (-788.504) (-787.016) [-784.016] -- 0:00:06
905000 -- [-787.883] (-787.911) (-786.254) (-783.670) * (-785.347) [-786.999] (-784.846) (-785.478) -- 0:00:06
Average standard deviation of split frequencies: 0.006732
905500 -- (-789.551) [-784.626] (-788.145) (-785.747) * (-784.013) [-787.078] (-785.639) (-785.692) -- 0:00:06
906000 -- (-785.547) (-784.167) (-786.227) [-784.610] * [-784.318] (-785.681) (-787.349) (-784.729) -- 0:00:06
906500 -- (-784.749) (-785.934) (-784.929) [-784.121] * (-787.728) [-784.611] (-786.418) (-786.335) -- 0:00:06
907000 -- [-786.562] (-785.524) (-788.934) (-784.911) * [-785.630] (-790.744) (-784.452) (-784.928) -- 0:00:06
907500 -- (-786.919) [-784.659] (-792.776) (-785.182) * (-785.307) [-786.533] (-788.486) (-784.334) -- 0:00:06
908000 -- (-787.700) (-787.549) [-783.638] (-784.447) * [-784.424] (-785.928) (-785.109) (-784.721) -- 0:00:06
908500 -- [-784.451] (-784.693) (-784.764) (-787.306) * (-785.592) (-783.720) [-783.577] (-785.478) -- 0:00:06
909000 -- (-784.928) [-785.231] (-787.646) (-786.106) * (-784.863) [-783.586] (-785.783) (-785.254) -- 0:00:06
909500 -- (-785.722) [-789.790] (-785.937) (-786.705) * (-786.010) [-785.581] (-783.801) (-784.609) -- 0:00:06
910000 -- (-785.676) (-786.607) (-783.921) [-786.444] * (-785.116) (-787.257) [-784.606] (-785.943) -- 0:00:06
Average standard deviation of split frequencies: 0.006632
910500 -- (-784.321) [-783.547] (-786.960) (-788.723) * (-785.777) [-786.014] (-786.735) (-785.955) -- 0:00:06
911000 -- (-787.560) (-783.676) [-786.741] (-783.730) * [-784.344] (-793.496) (-785.644) (-785.861) -- 0:00:06
911500 -- (-784.632) (-783.512) (-794.405) [-784.385] * [-783.561] (-788.191) (-785.422) (-786.044) -- 0:00:06
912000 -- [-786.703] (-783.359) (-789.143) (-784.210) * [-783.422] (-784.167) (-785.201) (-788.927) -- 0:00:06
912500 -- (-787.536) [-783.934] (-785.906) (-789.478) * (-783.840) [-785.191] (-785.586) (-787.033) -- 0:00:06
913000 -- [-785.103] (-784.469) (-784.766) (-785.970) * [-783.744] (-784.395) (-786.831) (-784.469) -- 0:00:06
913500 -- [-784.919] (-788.830) (-784.856) (-786.043) * (-785.222) (-789.373) [-785.914] (-784.561) -- 0:00:05
914000 -- (-787.639) (-785.024) (-785.339) [-787.668] * [-786.766] (-790.070) (-786.028) (-784.910) -- 0:00:05
914500 -- (-785.700) [-787.920] (-784.681) (-789.614) * (-784.910) (-786.290) [-785.627] (-785.557) -- 0:00:05
915000 -- (-788.332) (-785.766) (-787.225) [-783.982] * (-787.850) (-789.864) [-787.618] (-785.752) -- 0:00:05
Average standard deviation of split frequencies: 0.006626
915500 -- [-788.661] (-784.447) (-786.390) (-786.725) * (-783.589) (-786.743) (-788.443) [-786.294] -- 0:00:05
916000 -- (-790.485) (-785.196) [-788.589] (-786.483) * [-785.015] (-787.335) (-785.522) (-786.397) -- 0:00:05
916500 -- (-787.742) [-787.203] (-784.768) (-786.035) * (-783.718) [-786.683] (-784.997) (-785.197) -- 0:00:05
917000 -- (-785.604) [-783.763] (-784.150) (-783.861) * (-783.644) (-785.812) [-785.676] (-785.391) -- 0:00:05
917500 -- (-785.652) (-784.450) (-785.336) [-784.061] * (-783.880) (-785.843) (-785.591) [-784.632] -- 0:00:05
918000 -- (-785.472) (-785.598) (-785.061) [-784.310] * (-783.721) (-788.177) [-785.796] (-788.145) -- 0:00:05
918500 -- (-783.899) [-785.813] (-785.217) (-784.795) * (-784.947) (-788.359) [-785.216] (-784.464) -- 0:00:05
919000 -- (-784.800) [-786.963] (-784.569) (-787.009) * (-785.642) (-785.427) (-786.473) [-786.517] -- 0:00:05
919500 -- (-783.651) [-785.174] (-784.027) (-786.140) * (-785.121) [-784.173] (-785.830) (-787.084) -- 0:00:05
920000 -- (-788.318) [-784.358] (-784.529) (-785.185) * (-784.734) (-786.131) (-787.422) [-787.103] -- 0:00:05
Average standard deviation of split frequencies: 0.006816
920500 -- (-785.630) (-784.315) [-785.195] (-784.904) * (-785.133) (-785.834) [-784.774] (-785.519) -- 0:00:05
921000 -- (-786.521) (-785.722) [-786.449] (-785.209) * [-786.624] (-784.671) (-783.358) (-785.055) -- 0:00:05
921500 -- [-783.944] (-784.191) (-790.048) (-786.133) * (-784.832) (-784.970) [-783.813] (-786.761) -- 0:00:05
922000 -- (-789.331) [-787.645] (-791.643) (-785.799) * (-788.919) (-785.449) [-786.387] (-784.213) -- 0:00:05
922500 -- [-784.911] (-787.019) (-791.464) (-785.934) * (-787.112) (-789.324) (-787.386) [-790.341] -- 0:00:05
923000 -- (-786.869) (-786.115) (-787.734) [-789.210] * (-786.901) (-784.898) [-786.082] (-783.839) -- 0:00:05
923500 -- (-785.681) [-785.331] (-787.178) (-784.199) * [-785.540] (-785.547) (-787.022) (-786.320) -- 0:00:05
924000 -- [-787.335] (-786.189) (-786.038) (-784.251) * [-787.478] (-783.587) (-786.024) (-786.417) -- 0:00:05
924500 -- (-793.701) [-784.224] (-785.579) (-786.785) * (-784.363) (-784.249) [-784.642] (-783.570) -- 0:00:05
925000 -- (-787.276) (-785.154) (-786.711) [-785.849] * [-785.873] (-785.552) (-784.100) (-786.306) -- 0:00:05
Average standard deviation of split frequencies: 0.006968
925500 -- [-784.319] (-784.257) (-787.975) (-787.358) * [-785.997] (-784.624) (-784.269) (-786.286) -- 0:00:05
926000 -- (-786.962) (-785.118) (-786.611) [-784.195] * (-785.097) (-784.261) [-785.989] (-787.400) -- 0:00:05
926500 -- (-784.568) [-784.657] (-786.505) (-783.335) * (-785.122) [-786.035] (-786.952) (-794.858) -- 0:00:05
927000 -- (-783.824) (-784.551) [-785.926] (-784.910) * (-787.920) (-788.483) [-784.781] (-785.811) -- 0:00:05
927500 -- (-785.692) (-784.730) (-786.289) [-784.840] * (-784.542) (-787.396) [-785.195] (-786.380) -- 0:00:05
928000 -- (-784.900) [-784.148] (-785.058) (-784.517) * (-784.981) (-791.533) [-784.126] (-783.718) -- 0:00:04
928500 -- [-785.092] (-788.808) (-785.155) (-790.006) * (-784.314) (-785.312) (-784.317) [-783.729] -- 0:00:04
929000 -- (-788.561) (-783.549) (-783.931) [-785.383] * (-786.799) [-784.231] (-783.819) (-783.901) -- 0:00:04
929500 -- (-788.104) [-791.671] (-786.979) (-784.607) * (-788.565) [-785.357] (-785.624) (-783.942) -- 0:00:04
930000 -- (-786.907) [-785.110] (-787.591) (-784.845) * [-784.371] (-786.133) (-789.108) (-784.276) -- 0:00:04
Average standard deviation of split frequencies: 0.006711
930500 -- [-787.521] (-787.962) (-787.453) (-785.353) * (-785.219) [-785.200] (-786.143) (-783.519) -- 0:00:04
931000 -- (-784.666) (-785.437) [-785.396] (-784.545) * [-786.164] (-785.179) (-789.726) (-785.955) -- 0:00:04
931500 -- (-784.255) [-786.880] (-787.319) (-785.463) * (-785.391) (-784.479) [-788.802] (-784.608) -- 0:00:04
932000 -- [-783.800] (-784.767) (-786.641) (-785.455) * (-785.495) (-786.489) (-785.150) [-784.608] -- 0:00:04
932500 -- (-785.098) [-784.433] (-784.225) (-786.037) * (-785.380) (-783.775) (-784.130) [-786.525] -- 0:00:04
933000 -- (-786.394) (-783.835) [-785.073] (-785.209) * [-787.687] (-786.322) (-785.904) (-784.711) -- 0:00:04
933500 -- (-788.070) [-784.305] (-787.021) (-790.477) * [-786.542] (-790.333) (-786.976) (-784.880) -- 0:00:04
934000 -- (-783.792) (-785.999) (-783.917) [-786.541] * [-785.186] (-785.931) (-786.600) (-785.214) -- 0:00:04
934500 -- [-785.014] (-787.945) (-787.996) (-786.972) * (-784.251) [-784.644] (-784.586) (-785.456) -- 0:00:04
935000 -- (-784.065) [-787.110] (-787.723) (-785.117) * (-788.938) (-788.986) [-784.569] (-786.261) -- 0:00:04
Average standard deviation of split frequencies: 0.006862
935500 -- [-785.654] (-786.007) (-785.322) (-786.784) * (-789.269) (-785.662) (-785.593) [-784.242] -- 0:00:04
936000 -- [-785.500] (-787.336) (-784.545) (-786.299) * (-786.172) (-784.353) [-786.523] (-784.644) -- 0:00:04
936500 -- [-784.912] (-786.873) (-785.412) (-788.918) * (-784.887) (-787.877) [-788.664] (-784.754) -- 0:00:04
937000 -- (-784.362) (-785.101) (-787.119) [-785.799] * (-784.592) (-789.272) [-784.572] (-786.883) -- 0:00:04
937500 -- (-785.263) (-785.067) [-784.754] (-785.384) * [-787.976] (-787.723) (-785.037) (-785.246) -- 0:00:04
938000 -- (-783.773) [-785.541] (-784.777) (-785.638) * [-784.131] (-787.576) (-789.808) (-788.923) -- 0:00:04
938500 -- (-787.286) (-788.759) (-784.690) [-784.747] * (-785.555) (-789.128) (-785.344) [-784.758] -- 0:00:04
939000 -- (-785.869) [-785.532] (-786.260) (-785.790) * [-789.301] (-789.379) (-788.968) (-790.466) -- 0:00:04
939500 -- (-785.305) (-786.086) [-789.444] (-788.656) * (-786.205) (-788.807) (-787.183) [-785.218] -- 0:00:04
940000 -- (-789.937) (-784.198) (-783.646) [-788.287] * (-790.224) (-784.832) [-785.149] (-785.894) -- 0:00:04
Average standard deviation of split frequencies: 0.006452
940500 -- [-784.671] (-785.759) (-785.752) (-791.620) * (-784.647) (-785.595) (-787.461) [-785.926] -- 0:00:04
941000 -- (-784.691) [-786.154] (-785.680) (-786.938) * (-785.913) (-783.931) [-784.069] (-784.316) -- 0:00:04
941500 -- [-784.724] (-785.699) (-786.755) (-785.610) * [-786.624] (-784.415) (-785.222) (-784.840) -- 0:00:04
942000 -- (-785.605) (-786.089) [-784.408] (-785.821) * (-784.104) (-785.084) [-785.981] (-785.574) -- 0:00:04
942500 -- (-785.197) [-784.227] (-787.460) (-784.922) * [-786.771] (-788.240) (-786.420) (-784.846) -- 0:00:03
943000 -- [-784.545] (-785.471) (-784.723) (-785.111) * (-787.932) (-787.094) (-790.716) [-783.607] -- 0:00:03
943500 -- (-786.391) [-784.473] (-785.336) (-788.490) * (-790.612) (-786.832) [-787.193] (-783.731) -- 0:00:03
944000 -- (-787.600) [-783.888] (-784.705) (-785.102) * [-785.612] (-785.532) (-784.373) (-784.717) -- 0:00:03
944500 -- (-787.231) (-785.550) [-784.110] (-783.944) * (-787.753) (-785.802) (-788.662) [-787.288] -- 0:00:03
945000 -- (-784.242) [-785.186] (-783.888) (-785.183) * (-785.133) (-789.181) [-790.658] (-784.787) -- 0:00:03
Average standard deviation of split frequencies: 0.006603
945500 -- [-784.521] (-784.316) (-783.888) (-786.603) * (-784.773) [-790.652] (-789.449) (-786.409) -- 0:00:03
946000 -- (-786.071) [-786.800] (-785.824) (-791.198) * [-783.940] (-786.384) (-787.172) (-787.149) -- 0:00:03
946500 -- [-790.591] (-787.857) (-783.782) (-788.352) * (-784.354) (-787.406) (-785.451) [-787.029] -- 0:00:03
947000 -- (-787.531) [-785.780] (-787.293) (-783.865) * (-784.923) (-787.778) [-784.935] (-784.870) -- 0:00:03
947500 -- (-785.279) [-787.974] (-784.637) (-786.327) * (-784.151) (-784.978) [-785.655] (-787.951) -- 0:00:03
948000 -- (-784.813) [-784.954] (-790.431) (-786.899) * (-784.619) [-784.055] (-784.789) (-784.438) -- 0:00:03
948500 -- [-784.455] (-785.761) (-783.791) (-788.786) * [-784.096] (-783.949) (-784.318) (-784.669) -- 0:00:03
949000 -- (-784.388) (-783.682) [-783.948] (-789.631) * (-784.700) (-785.778) (-785.367) [-787.151] -- 0:00:03
949500 -- (-784.454) (-784.530) (-788.210) [-783.555] * (-784.516) (-784.230) [-784.146] (-792.632) -- 0:00:03
950000 -- (-785.582) [-786.181] (-785.455) (-789.431) * (-784.892) (-786.791) (-790.589) [-787.011] -- 0:00:03
Average standard deviation of split frequencies: 0.006725
950500 -- (-787.063) (-784.829) (-785.662) [-787.095] * (-784.630) (-785.010) [-784.241] (-784.385) -- 0:00:03
951000 -- (-787.530) [-786.681] (-784.494) (-788.872) * (-784.140) (-786.836) (-784.048) [-784.324] -- 0:00:03
951500 -- (-787.103) [-785.891] (-788.628) (-785.563) * (-784.195) (-787.497) (-783.350) [-788.816] -- 0:00:03
952000 -- (-787.169) (-784.510) (-786.764) [-786.772] * (-784.844) [-784.316] (-784.282) (-785.005) -- 0:00:03
952500 -- [-785.391] (-784.217) (-789.443) (-785.127) * (-784.530) [-788.088] (-784.075) (-783.648) -- 0:00:03
953000 -- (-785.131) (-783.993) (-785.998) [-785.996] * (-786.178) (-784.662) (-784.870) [-784.002] -- 0:00:03
953500 -- [-785.239] (-784.729) (-787.806) (-785.882) * [-783.862] (-784.152) (-784.593) (-785.489) -- 0:00:03
954000 -- (-785.397) (-785.615) [-783.897] (-784.162) * (-785.420) (-788.526) [-787.667] (-784.967) -- 0:00:03
954500 -- (-784.202) [-784.076] (-785.234) (-785.471) * [-788.642] (-785.893) (-785.560) (-785.051) -- 0:00:03
955000 -- (-786.095) [-788.468] (-786.351) (-785.845) * [-786.546] (-791.582) (-786.338) (-786.771) -- 0:00:03
Average standard deviation of split frequencies: 0.006842
955500 -- (-787.494) (-791.665) (-787.900) [-788.207] * [-785.048] (-785.904) (-785.499) (-785.293) -- 0:00:03
956000 -- (-791.446) (-790.181) (-784.885) [-784.577] * (-784.625) [-785.460] (-784.220) (-783.935) -- 0:00:03
956500 -- [-785.483] (-788.468) (-785.628) (-785.459) * [-791.566] (-784.232) (-787.027) (-784.263) -- 0:00:03
957000 -- (-785.955) (-787.092) [-785.948] (-784.383) * (-787.796) (-786.020) [-784.175] (-785.392) -- 0:00:02
957500 -- (-785.408) [-789.681] (-784.025) (-784.213) * (-788.102) (-787.313) [-784.089] (-787.047) -- 0:00:02
958000 -- [-785.228] (-789.364) (-784.421) (-784.198) * (-786.077) (-784.587) (-786.726) [-784.048] -- 0:00:02
958500 -- (-784.166) (-787.070) [-785.559] (-784.166) * (-786.121) (-786.269) [-786.451] (-785.211) -- 0:00:02
959000 -- (-784.008) (-786.442) (-791.129) [-784.575] * (-785.467) (-791.281) (-784.209) [-786.870] -- 0:00:02
959500 -- (-784.390) (-787.790) (-790.564) [-785.459] * (-787.209) (-788.212) (-786.208) [-786.509] -- 0:00:02
960000 -- (-785.889) (-789.193) (-785.256) [-785.450] * (-787.171) (-787.669) [-784.673] (-784.550) -- 0:00:02
Average standard deviation of split frequencies: 0.006717
960500 -- (-787.806) (-788.223) (-786.076) [-784.963] * (-785.371) (-785.317) [-783.888] (-786.097) -- 0:00:02
961000 -- (-792.470) (-792.258) [-785.611] (-790.215) * (-785.218) (-784.105) (-784.068) [-785.341] -- 0:00:02
961500 -- (-793.562) [-788.390] (-785.771) (-794.959) * (-785.319) [-783.711] (-784.731) (-784.897) -- 0:00:02
962000 -- [-783.858] (-784.240) (-790.600) (-787.687) * (-788.113) [-783.914] (-788.308) (-784.238) -- 0:00:02
962500 -- (-785.246) (-784.923) (-785.370) [-785.817] * [-787.635] (-784.606) (-786.463) (-784.562) -- 0:00:02
963000 -- (-783.900) [-786.775] (-785.563) (-786.130) * (-786.281) [-785.922] (-785.709) (-785.733) -- 0:00:02
963500 -- (-787.964) (-783.936) [-786.822] (-787.015) * (-783.326) (-787.592) [-787.380] (-783.956) -- 0:00:02
964000 -- [-784.944] (-785.536) (-788.843) (-785.596) * [-783.927] (-786.609) (-788.233) (-783.796) -- 0:00:02
964500 -- [-785.542] (-786.589) (-788.214) (-785.123) * [-784.539] (-787.433) (-787.851) (-786.893) -- 0:00:02
965000 -- (-784.576) [-787.234] (-783.805) (-785.122) * (-787.859) (-784.499) (-788.389) [-784.662] -- 0:00:02
Average standard deviation of split frequencies: 0.006618
965500 -- (-785.928) (-785.713) [-783.801] (-785.408) * (-790.136) (-785.695) (-786.332) [-787.224] -- 0:00:02
966000 -- (-785.500) (-786.932) (-787.199) [-787.066] * (-786.366) (-785.971) [-787.727] (-783.383) -- 0:00:02
966500 -- (-789.461) (-784.833) (-785.127) [-784.048] * (-786.775) (-786.593) (-788.845) [-790.130] -- 0:00:02
967000 -- (-785.541) (-783.943) [-786.750] (-783.523) * [-785.854] (-785.731) (-784.449) (-789.568) -- 0:00:02
967500 -- (-785.352) (-783.867) (-784.412) [-783.943] * [-784.715] (-787.161) (-784.940) (-786.029) -- 0:00:02
968000 -- (-787.952) (-786.890) (-787.838) [-784.534] * (-786.571) [-785.531] (-785.547) (-784.028) -- 0:00:02
968500 -- (-786.310) (-784.540) (-788.700) [-786.244] * (-783.573) [-783.751] (-786.755) (-784.664) -- 0:00:02
969000 -- (-786.625) (-786.499) (-791.217) [-784.103] * [-783.640] (-785.345) (-788.074) (-784.774) -- 0:00:02
969500 -- (-786.380) (-785.843) [-787.347] (-787.108) * (-785.898) (-785.050) (-783.949) [-786.567] -- 0:00:02
970000 -- (-784.445) [-787.991] (-787.745) (-786.977) * (-784.521) (-788.999) (-785.537) [-785.466] -- 0:00:02
Average standard deviation of split frequencies: 0.006829
970500 -- [-785.052] (-784.120) (-786.387) (-785.074) * (-783.712) (-788.109) [-784.332] (-786.168) -- 0:00:02
971000 -- (-785.536) (-784.412) (-786.108) [-784.301] * [-784.020] (-786.208) (-784.825) (-789.789) -- 0:00:02
971500 -- (-784.844) (-786.722) [-784.366] (-785.173) * (-785.061) (-784.527) [-784.746] (-786.671) -- 0:00:01
972000 -- (-783.833) (-788.056) [-784.390] (-784.111) * (-787.236) (-785.318) [-784.367] (-787.586) -- 0:00:01
972500 -- (-783.867) (-784.482) [-784.895] (-787.901) * [-785.687] (-787.951) (-784.406) (-786.858) -- 0:00:01
973000 -- (-787.819) (-789.926) [-785.047] (-786.576) * [-786.458] (-784.650) (-787.929) (-784.032) -- 0:00:01
973500 -- (-786.172) [-784.295] (-783.746) (-784.624) * [-789.378] (-785.440) (-784.641) (-784.054) -- 0:00:01
974000 -- (-785.747) (-786.458) [-783.446] (-790.132) * [-785.052] (-783.950) (-784.551) (-784.474) -- 0:00:01
974500 -- (-783.972) (-786.413) [-784.878] (-788.970) * [-784.703] (-785.291) (-785.426) (-784.036) -- 0:00:01
975000 -- [-785.700] (-785.679) (-787.965) (-786.020) * (-785.312) (-784.615) [-783.818] (-785.831) -- 0:00:01
Average standard deviation of split frequencies: 0.007003
975500 -- (-785.031) [-784.397] (-787.827) (-788.380) * (-788.278) (-785.195) (-786.825) [-785.863] -- 0:00:01
976000 -- (-784.971) [-784.191] (-789.898) (-786.149) * (-788.187) (-785.465) (-783.911) [-786.010] -- 0:00:01
976500 -- (-785.372) [-785.227] (-787.217) (-790.422) * (-784.361) (-784.978) (-783.926) [-785.491] -- 0:00:01
977000 -- (-785.768) [-786.573] (-783.882) (-788.834) * [-785.737] (-787.052) (-788.922) (-783.842) -- 0:00:01
977500 -- (-783.806) [-786.695] (-787.588) (-786.918) * (-785.700) (-784.182) (-784.369) [-792.438] -- 0:00:01
978000 -- (-783.694) [-786.060] (-785.411) (-789.801) * [-784.665] (-787.705) (-784.789) (-789.080) -- 0:00:01
978500 -- (-783.936) [-784.143] (-785.130) (-786.214) * (-784.805) [-784.152] (-789.405) (-788.190) -- 0:00:01
979000 -- [-784.253] (-783.340) (-784.780) (-785.090) * (-785.168) (-785.833) [-784.075] (-786.661) -- 0:00:01
979500 -- [-786.139] (-783.828) (-784.956) (-785.522) * [-785.141] (-785.963) (-784.297) (-784.404) -- 0:00:01
980000 -- (-783.184) (-784.262) [-784.106] (-786.725) * [-786.288] (-785.962) (-784.306) (-784.616) -- 0:00:01
Average standard deviation of split frequencies: 0.007421
980500 -- (-786.509) [-785.445] (-785.476) (-784.804) * [-785.333] (-784.024) (-788.416) (-786.205) -- 0:00:01
981000 -- (-785.946) (-788.906) (-787.130) [-786.341] * (-789.051) (-789.042) (-784.789) [-785.241] -- 0:00:01
981500 -- (-785.491) (-788.565) [-784.117] (-783.657) * (-786.467) (-785.437) [-784.891] (-785.368) -- 0:00:01
982000 -- (-783.929) (-786.190) (-785.420) [-785.131] * [-784.215] (-787.376) (-787.079) (-785.588) -- 0:00:01
982500 -- (-783.412) (-784.014) [-786.216] (-784.719) * (-786.674) (-787.599) (-784.780) [-786.598] -- 0:00:01
983000 -- (-783.330) (-784.962) (-784.255) [-784.901] * (-785.699) [-789.448] (-784.696) (-785.894) -- 0:00:01
983500 -- (-783.327) [-785.384] (-784.395) (-786.103) * [-785.940] (-785.262) (-785.099) (-788.285) -- 0:00:01
984000 -- (-784.849) (-785.528) (-784.651) [-784.892] * (-785.750) [-784.219] (-783.936) (-788.815) -- 0:00:01
984500 -- (-784.017) (-784.997) [-786.148] (-784.323) * (-784.706) (-784.374) (-784.917) [-787.105] -- 0:00:01
985000 -- (-787.279) (-785.663) [-784.413] (-787.221) * (-790.258) [-784.537] (-786.326) (-784.248) -- 0:00:01
Average standard deviation of split frequencies: 0.007351
985500 -- (-792.587) [-785.876] (-783.968) (-789.624) * [-784.175] (-784.676) (-785.373) (-786.204) -- 0:00:01
986000 -- (-788.873) [-785.695] (-787.993) (-786.249) * (-785.685) [-784.803] (-787.510) (-785.147) -- 0:00:00
986500 -- [-786.596] (-785.209) (-789.751) (-787.559) * (-784.404) [-783.827] (-784.756) (-784.541) -- 0:00:00
987000 -- (-786.351) (-783.924) [-785.109] (-788.866) * (-785.873) [-784.535] (-784.661) (-785.007) -- 0:00:00
987500 -- (-788.448) (-784.050) (-784.427) [-784.174] * (-788.928) (-783.548) [-784.206] (-783.831) -- 0:00:00
988000 -- (-791.554) (-784.049) (-787.517) [-783.885] * (-785.491) (-783.551) (-787.507) [-785.328] -- 0:00:00
988500 -- [-784.492] (-785.438) (-789.075) (-784.203) * [-788.639] (-786.963) (-787.932) (-784.852) -- 0:00:00
989000 -- (-783.595) (-785.989) [-783.903] (-785.962) * (-789.018) (-784.799) [-786.638] (-790.685) -- 0:00:00
989500 -- [-787.304] (-785.074) (-785.262) (-785.274) * (-784.554) (-784.220) (-787.171) [-786.585] -- 0:00:00
990000 -- (-784.622) (-786.944) [-784.345] (-789.354) * (-784.027) (-783.665) (-786.704) [-786.603] -- 0:00:00
Average standard deviation of split frequencies: 0.007078
990500 -- (-784.953) (-789.468) (-789.650) [-785.452] * [-785.372] (-784.263) (-787.571) (-786.787) -- 0:00:00
991000 -- (-786.136) (-784.768) (-784.793) [-785.101] * (-786.866) (-785.829) (-786.995) [-783.754] -- 0:00:00
991500 -- (-785.346) [-783.775] (-785.565) (-787.097) * (-787.316) (-784.560) [-784.072] (-786.947) -- 0:00:00
992000 -- (-785.636) [-784.567] (-785.085) (-784.567) * [-785.697] (-784.360) (-787.167) (-786.232) -- 0:00:00
992500 -- [-786.727] (-786.734) (-785.714) (-785.854) * (-784.142) (-783.851) (-784.895) [-783.955] -- 0:00:00
993000 -- [-785.746] (-785.207) (-791.778) (-786.212) * [-789.911] (-790.482) (-784.285) (-784.740) -- 0:00:00
993500 -- (-784.841) (-787.372) (-785.353) [-788.306] * (-785.295) (-788.086) (-785.247) [-784.320] -- 0:00:00
994000 -- (-783.810) (-787.795) [-786.778] (-794.091) * (-787.224) [-784.525] (-785.210) (-783.788) -- 0:00:00
994500 -- (-785.377) [-785.581] (-789.010) (-785.953) * [-785.154] (-784.103) (-786.071) (-784.128) -- 0:00:00
995000 -- (-785.072) (-785.044) [-785.272] (-788.050) * [-787.018] (-787.576) (-785.791) (-783.815) -- 0:00:00
Average standard deviation of split frequencies: 0.006952
995500 -- (-789.721) [-784.575] (-786.953) (-783.815) * [-784.916] (-783.787) (-785.597) (-785.630) -- 0:00:00
996000 -- (-787.626) (-783.844) [-785.904] (-783.790) * (-789.405) (-784.097) (-785.489) [-786.643] -- 0:00:00
996500 -- (-785.836) (-784.202) (-785.668) [-786.508] * (-787.078) [-784.022] (-785.078) (-787.157) -- 0:00:00
997000 -- (-785.743) [-784.362] (-788.026) (-784.583) * (-792.675) (-787.912) (-785.176) [-786.571] -- 0:00:00
997500 -- (-785.326) (-784.998) (-786.511) [-783.794] * (-789.382) [-785.245] (-786.721) (-785.993) -- 0:00:00
998000 -- (-783.979) [-785.679] (-784.840) (-785.959) * (-790.354) (-784.826) (-783.256) [-786.511] -- 0:00:00
998500 -- (-783.600) (-785.247) (-786.194) [-784.227] * (-787.651) (-788.845) (-786.779) [-785.174] -- 0:00:00
999000 -- (-785.221) (-784.452) (-787.625) [-783.822] * (-786.920) (-785.524) (-783.768) [-785.406] -- 0:00:00
999500 -- (-784.846) [-788.797] (-785.333) (-784.222) * (-794.352) (-783.828) (-783.760) [-784.784] -- 0:00:00
1000000 -- (-785.649) (-788.562) (-784.736) [-785.739] * (-789.593) (-785.282) [-784.196] (-784.484) -- 0:00:00
Average standard deviation of split frequencies: 0.006507
Analysis completed in 1 mins 9 seconds
Analysis used 67.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -783.16
Likelihood of best state for "cold" chain of run 2 was -783.16
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 80 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.5 % ( 24 %) Dirichlet(Pi{all})
31.6 % ( 29 %) Slider(Pi{all})
79.0 % ( 58 %) Multiplier(Alpha{1,2})
78.1 % ( 55 %) Multiplier(Alpha{3})
22.7 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.9 % ( 21 %) Dirichlet(Pi{all})
30.8 % ( 30 %) Slider(Pi{all})
78.5 % ( 55 %) Multiplier(Alpha{1,2})
78.0 % ( 50 %) Multiplier(Alpha{3})
22.3 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166007 0.82 0.67
3 | 167002 166429 0.84
4 | 166648 167036 166878
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166885 0.82 0.67
3 | 166240 166787 0.83
4 | 166255 167274 166559
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -785.10
| 1 1 |
|2 2 2 1 |
| 22 2 1 1 111|
| 1 2 1 2 |
| 121 2 22 1 1*1* 1 1 1 2 1 |
|112 2 22 2 12 1 1 2* * 22|
| * 21 2 2 2 2 2 2 2 |
| 1 1 2 1 2 2 22 1 22 |
| 2 1 2 1 1 2 22 * 2 1 1 |
| 2 1 1 1 1 1 2*2 2 1 |
| 1 1 1 1 1 211 |
| 1 1 1 * 2 2 |
| 2 2 |
| |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -786.38
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -784.90 -788.00
2 -784.92 -787.61
--------------------------------------
TOTAL -784.91 -787.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893332 0.088201 0.346307 1.477585 0.865922 1501.00 1501.00 1.000
r(A<->C){all} 0.165368 0.020733 0.000016 0.469779 0.126843 205.59 256.57 1.004
r(A<->G){all} 0.174624 0.022625 0.000160 0.479510 0.129116 143.16 224.20 1.000
r(A<->T){all} 0.159640 0.018657 0.000127 0.432878 0.120647 223.87 266.81 1.004
r(C<->G){all} 0.156316 0.017701 0.000141 0.421860 0.121222 168.19 253.09 1.000
r(C<->T){all} 0.160873 0.020044 0.000003 0.443948 0.119338 229.78 250.90 1.000
r(G<->T){all} 0.183179 0.023372 0.000047 0.489102 0.141934 135.96 138.29 1.002
pi(A){all} 0.180886 0.000255 0.149445 0.211441 0.180416 1179.29 1257.50 1.000
pi(C){all} 0.274484 0.000332 0.240476 0.311083 0.274486 1460.36 1468.64 1.000
pi(G){all} 0.331206 0.000396 0.290908 0.368294 0.330769 1235.08 1323.14 1.000
pi(T){all} 0.213424 0.000293 0.178028 0.245671 0.213436 1453.12 1477.06 1.000
alpha{1,2} 0.429403 0.242445 0.000342 1.424146 0.263465 1407.63 1428.01 1.000
alpha{3} 0.462110 0.255652 0.000456 1.460591 0.299466 1393.83 1447.42 1.000
pinvar{all} 0.997275 0.000011 0.991429 0.999999 0.998261 1284.04 1296.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- .*...*
10 -- ..*.*.
11 -- .*.***
12 -- ...**.
13 -- ....**
14 -- .****.
15 -- .***.*
16 -- ..**..
17 -- ..****
18 -- .**...
19 -- .**.**
20 -- .*.*..
21 -- ..*..*
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 466 0.155230 0.004711 0.151899 0.158561 2
8 450 0.149900 0.004711 0.146569 0.153231 2
9 444 0.147901 0.015075 0.137242 0.158561 2
10 444 0.147901 0.004711 0.144570 0.151233 2
11 438 0.145903 0.000942 0.145237 0.146569 2
12 433 0.144237 0.012719 0.135243 0.153231 2
13 431 0.143571 0.001413 0.142572 0.144570 2
14 429 0.142905 0.012719 0.133911 0.151899 2
15 429 0.142905 0.004240 0.139907 0.145903 2
16 428 0.142572 0.000000 0.142572 0.142572 2
17 426 0.141905 0.004711 0.138574 0.145237 2
18 413 0.137575 0.008009 0.131912 0.143238 2
19 407 0.135576 0.005182 0.131912 0.139241 2
20 398 0.132578 0.006595 0.127915 0.137242 2
21 380 0.126582 0.003769 0.123917 0.129247 2
22 277 0.092272 0.014604 0.081945 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096585 0.008965 0.000053 0.286616 0.065709 1.000 2
length{all}[2] 0.099762 0.010142 0.000091 0.299469 0.068655 1.000 2
length{all}[3] 0.100395 0.009867 0.000017 0.298292 0.071800 1.000 2
length{all}[4] 0.100638 0.010615 0.000028 0.301862 0.070615 1.000 2
length{all}[5] 0.099203 0.009637 0.000081 0.299584 0.068234 1.000 2
length{all}[6] 0.098549 0.009990 0.000008 0.293166 0.068181 1.000 2
length{all}[7] 0.101412 0.010750 0.000042 0.342078 0.065454 0.998 2
length{all}[8] 0.098158 0.013327 0.000018 0.326419 0.061375 0.998 2
length{all}[9] 0.102808 0.010108 0.000114 0.283391 0.072044 1.000 2
length{all}[10] 0.098976 0.009230 0.000254 0.294705 0.067310 0.998 2
length{all}[11] 0.105251 0.009971 0.000027 0.296397 0.075078 1.006 2
length{all}[12] 0.105111 0.011244 0.000174 0.311133 0.069122 0.998 2
length{all}[13] 0.100803 0.012056 0.000014 0.284989 0.068654 0.998 2
length{all}[14] 0.103109 0.009255 0.000022 0.313094 0.077066 1.003 2
length{all}[15] 0.097237 0.010087 0.000264 0.269063 0.066133 0.998 2
length{all}[16] 0.101900 0.011725 0.000021 0.317106 0.064741 1.003 2
length{all}[17] 0.104328 0.010872 0.000053 0.311641 0.071833 0.998 2
length{all}[18] 0.095992 0.007616 0.000644 0.244296 0.070528 0.999 2
length{all}[19] 0.098005 0.009991 0.000629 0.317130 0.067624 0.998 2
length{all}[20] 0.099550 0.008846 0.000330 0.286365 0.068382 1.000 2
length{all}[21] 0.095557 0.009201 0.000109 0.307396 0.067054 1.002 2
length{all}[22] 0.102823 0.011216 0.000076 0.323572 0.063082 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006507
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 576
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 192 / 192 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 192 / 192 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098850 0.065260 0.057420 0.036623 0.052033 0.099715 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -847.222249
Iterating by ming2
Initial: fx= 847.222249
x= 0.09885 0.06526 0.05742 0.03662 0.05203 0.09972 0.30000 1.30000
1 h-m-p 0.0000 0.0002 463.5196 +++ 805.740139 m 0.0002 14 | 1/8
2 h-m-p 0.0012 0.0187 69.5401 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 425.2981 ++ 791.031840 m 0.0001 45 | 2/8
4 h-m-p 0.0005 0.0218 60.7492 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 381.0237 ++ 786.905021 m 0.0000 76 | 3/8
6 h-m-p 0.0002 0.0271 49.3629 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 329.8488 ++ 782.396438 m 0.0000 106 | 4/8
8 h-m-p 0.0003 0.0362 36.9459 ----------.. | 4/8
9 h-m-p 0.0000 0.0002 269.1578 +++ 769.432314 m 0.0002 137 | 5/8
10 h-m-p 0.0013 0.0535 25.5310 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 191.3969 ++ 769.263845 m 0.0000 168 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 -Y 769.263845 0 0.0010 180 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 -----------Y 769.263845 0 0.0000 204
Out..
lnL = -769.263845
205 lfun, 205 eigenQcodon, 1230 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042149 0.030939 0.074568 0.088484 0.097998 0.060964 0.300039 0.721717 0.289657
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.089539
np = 9
lnL0 = -840.421537
Iterating by ming2
Initial: fx= 840.421537
x= 0.04215 0.03094 0.07457 0.08848 0.09800 0.06096 0.30004 0.72172 0.28966
1 h-m-p 0.0000 0.0002 424.3810 +++ 807.918368 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 339.0700 ++ 797.602740 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0001 1019.6112 ++ 784.394525 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0001 543.2218 ++ 776.573639 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 339222.0032 ++ 771.150488 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 1087270.3905 ++ 769.263715 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 769.263715 m 8.0000 87 | 6/9
8 h-m-p 0.0082 4.0880 0.1973 ---------C 769.263715 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0006 +++++ 769.263714 m 8.0000 129 | 6/9
10 h-m-p 0.0123 1.2843 0.3956 -----------Y 769.263714 0 0.0000 155 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 769.263714 m 8.0000 173 | 6/9
12 h-m-p 0.0005 0.2457 3.6091 +++++ 769.263698 m 0.2457 191 | 7/9
13 h-m-p 0.0455 0.2277 4.9703 ++ 769.263488 m 0.2277 203 | 8/9
14 h-m-p 0.6959 8.0000 0.0609 ---------------Y 769.263488 0 0.0000 230 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 -----------Y 769.263488 0 0.0000 254
Out..
lnL = -769.263488
255 lfun, 765 eigenQcodon, 3060 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093741 0.037991 0.108069 0.036926 0.030775 0.099660 0.000100 1.201761 0.199866 0.224725 1.466827
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.866808
np = 11
lnL0 = -839.981589
Iterating by ming2
Initial: fx= 839.981589
x= 0.09374 0.03799 0.10807 0.03693 0.03077 0.09966 0.00011 1.20176 0.19987 0.22473 1.46683
1 h-m-p 0.0000 0.0000 394.5310 ++ 839.633468 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 309.5178 +++ 807.948140 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0001 274.4229 ++ 803.392780 m 0.0001 45 | 3/11
4 h-m-p 0.0000 0.0000 122.2395 ++ 802.741719 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0006 225.1401 +++ 774.262135 m 0.0006 74 | 5/11
6 h-m-p 0.0000 0.0001 87.4031 ++ 773.983331 m 0.0001 88 | 6/11
7 h-m-p 0.0002 0.0029 11.3466 ----------.. | 6/11
8 h-m-p 0.0000 0.0000 258.3389 ++ 771.376766 m 0.0000 124 | 7/11
9 h-m-p 0.0014 0.7183 5.5703 -----------.. | 7/11
10 h-m-p 0.0000 0.0001 184.7917 ++ 769.263746 m 0.0001 161 | 8/11
11 h-m-p 0.1911 8.0000 0.0000 +++ 769.263746 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 0.0130 +++++ 769.263744 m 8.0000 196 | 8/11
13 h-m-p 0.0487 8.0000 2.1378 -------------Y 769.263744 0 0.0000 226 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 769.263744 m 8.0000 243 | 8/11
15 h-m-p 0.0160 8.0000 0.1712 -------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 769.263744 m 8.0000 291 | 8/11
17 h-m-p 0.0160 8.0000 1.8248 -------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 769.263744 m 8.0000 336 | 8/11
19 h-m-p 0.0160 8.0000 0.5737 -----------Y 769.263744 0 0.0000 364 | 8/11
20 h-m-p 0.0160 8.0000 0.0016 +++++ 769.263743 m 8.0000 384 | 8/11
21 h-m-p 0.0160 8.0000 1.6656 -----------C 769.263743 0 0.0000 412 | 8/11
22 h-m-p 0.0160 8.0000 0.0000 ------Y 769.263743 0 0.0000 432 | 8/11
23 h-m-p 0.0160 8.0000 0.0001 ---C 769.263743 0 0.0001 452
Out..
lnL = -769.263743
453 lfun, 1812 eigenQcodon, 8154 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -769.276557 S = -769.261162 -0.005898
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077471 0.044168 0.091557 0.101191 0.073733 0.018385 0.000100 0.822889 1.334814
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.482356
np = 9
lnL0 = -841.161218
Iterating by ming2
Initial: fx= 841.161218
x= 0.07747 0.04417 0.09156 0.10119 0.07373 0.01839 0.00011 0.82289 1.33481
1 h-m-p 0.0000 0.0000 413.1029 ++ 840.861857 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0046 73.6083 +++++ 819.943493 m 0.0046 29 | 2/9
3 h-m-p 0.0001 0.0004 101.8557 ++ 812.901043 m 0.0004 41 | 3/9
4 h-m-p 0.0000 0.0004 824.4787 ++ 799.890673 m 0.0004 53 | 4/9
5 h-m-p 0.0000 0.0001 708.7660 ++ 792.996919 m 0.0001 65 | 5/9
6 h-m-p 0.0000 0.0000 14012.7877 ++ 787.273574 m 0.0000 77 | 6/9
7 h-m-p 0.0004 0.0020 147.4577 ++ 772.656221 m 0.0020 89 | 7/9
8 h-m-p 0.0458 8.0000 6.5182 --------------.. | 7/9
9 h-m-p 0.0000 0.0001 170.0271 ++ 769.263410 m 0.0001 125 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 769.263410 0 1.6000 137 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 N 769.263410 0 0.0160 150
Out..
lnL = -769.263410
151 lfun, 1661 eigenQcodon, 9060 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034251 0.018154 0.026964 0.103386 0.074869 0.014661 0.000100 0.900000 0.616108 1.169055 1.299773
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.053690
np = 11
lnL0 = -817.384241
Iterating by ming2
Initial: fx= 817.384241
x= 0.03425 0.01815 0.02696 0.10339 0.07487 0.01466 0.00011 0.90000 0.61611 1.16905 1.29977
1 h-m-p 0.0000 0.0000 412.7116 ++ 816.883212 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0025 85.1557 ++++ 800.533003 m 0.0025 32 | 2/11
3 h-m-p 0.0000 0.0001 308.7939 ++ 797.631821 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0005 283.2366 ++ 790.533799 m 0.0005 60 | 4/11
5 h-m-p 0.0000 0.0000 819.3629 ++ 787.135744 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0001 3138.5429 ++ 773.991118 m 0.0001 88 | 6/11
7 h-m-p 0.0000 0.0000 3687.2202 ++ 773.033935 m 0.0000 102 | 7/11
8 h-m-p 0.0014 0.0214 9.1439 ++ 771.308603 m 0.0214 116 | 8/11
9 h-m-p 0.0096 0.0480 0.8340 ++ 769.263410 m 0.0480 130 | 9/11
10 h-m-p 1.6000 8.0000 0.0001 ++ 769.263410 m 8.0000 147 | 9/11
11 h-m-p 0.1558 8.0000 0.0054 --Y 769.263410 0 0.0024 165 | 9/11
12 h-m-p 0.0289 8.0000 0.0005 C 769.263410 0 0.0107 181 | 9/11
13 h-m-p 0.0810 8.0000 0.0001 ----------Y 769.263410 0 0.0000 207
Out..
lnL = -769.263410
208 lfun, 2496 eigenQcodon, 13728 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -769.316139 S = -769.264232 -0.023019
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:10
did 20 / 56 patterns 0:11
did 30 / 56 patterns 0:11
did 40 / 56 patterns 0:11
did 50 / 56 patterns 0:11
did 56 / 56 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=192
NC_011896_1_WP_010908108_1_1102_MLBR_RS05170 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
NC_002677_1_NP_301784_1_656_tagA VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
NZ_AP014567_1_WP_010908108_1_1143_tag VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF
**************************************************
NC_011896_1_WP_010908108_1_1102_MLBR_RS05170 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
NC_002677_1_NP_301784_1_656_tagA QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665 QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
NZ_AP014567_1_WP_010908108_1_1143_tag QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV
**************************************************
NC_011896_1_WP_010908108_1_1102_MLBR_RS05170 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
NC_002677_1_NP_301784_1_656_tagA KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665 KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
NZ_AP014567_1_WP_010908108_1_1143_tag KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK
**************************************************
NC_011896_1_WP_010908108_1_1102_MLBR_RS05170 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
NC_002677_1_NP_301784_1_656_tagA AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665 AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
NZ_AP014567_1_WP_010908108_1_1143_tag AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
******************************************
>NC_011896_1_WP_010908108_1_1102_MLBR_RS05170 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT GTACTTGCTGGGTGCCTCCAACACGG >NC_002677_1_NP_301784_1_656_tagA GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT GTACTTGCTGGGTGCCTCCAACACGG >NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT GTACTTGCTGGGTGCCTCCAACACGG >NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT GTACTTGCTGGGTGCCTCCAACACGG >NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665 GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT GTACTTGCTGGGTGCCTCCAACACGG >NZ_AP014567_1_WP_010908108_1_1143_tag GTGAGCGACGATGGGCTGGTTCGCTGTGGCTGGGCGGACGTTCGATCCGG GCTCCACTGGCAGCTGTATCGCAACTATCACGACCAAGAGTGGGGCAGCC CAGTACGATGCGGAGTGGCCTTGTTCGAGCGGATGAGCCTGGAGGCCTTT CAGAGTGGTCTGTCGTGGCTGCTCATTCTGCGCAAACGGGAAAATTTCCG GCGCGCCTTCTCCGGGTTCGATATCGAAGAGGTAGCCCGTTATACCCATG CCGATGTGCAACGGTTGTTGTTCGATGACGGAATTGTGCGCAACCGCGTC AAGATCGAGGCGACAATCGCCAACGCGCGTGCGGCCGCTGAGCTGGGGTC TGCAGCAGACTTGTCTGAGTTGCTGTGGTCATTCGCCCCACAGCCGCGGT CCAGGCCCGCTGACGGATCCGAAATCCCTTCGACCAGTGCGGAAGCGAAG GCGATGGCGCGTGAATTGAAACGGCGCGGGTTCCGCTTCGTCGGGCCTAC TACGGCCTATGCACTTATGCAGGCTACGGGGATGGTTGACGATCACATCT GTACTTGCTGGGTGCCTCCAACACGG
>NC_011896_1_WP_010908108_1_1102_MLBR_RS05170 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR >NC_002677_1_NP_301784_1_656_tagA VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR >NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR >NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR >NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665 VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR >NZ_AP014567_1_WP_010908108_1_1143_tag VSDDGLVRCGWADVRSGLHWQLYRNYHDQEWGSPVRCGVALFERMSLEAF QSGLSWLLILRKRENFRRAFSGFDIEEVARYTHADVQRLLFDDGIVRNRV KIEATIANARAAAELGSAADLSELLWSFAPQPRSRPADGSEIPSTSAEAK AMARELKRRGFRFVGPTTAYALMQATGMVDDHICTCWVPPTR
#NEXUS
[ID: 0091221185]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908108_1_1102_MLBR_RS05170
NC_002677_1_NP_301784_1_656_tagA
NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090
NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600
NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665
NZ_AP014567_1_WP_010908108_1_1143_tag
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908108_1_1102_MLBR_RS05170,
2 NC_002677_1_NP_301784_1_656_tagA,
3 NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090,
4 NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600,
5 NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665,
6 NZ_AP014567_1_WP_010908108_1_1143_tag
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06570947,2:0.06865495,3:0.07180042,4:0.07061548,5:0.0682341,6:0.06818125);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06570947,2:0.06865495,3:0.07180042,4:0.07061548,5:0.0682341,6:0.06818125);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -784.90 -788.00
2 -784.92 -787.61
--------------------------------------
TOTAL -784.91 -787.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/tagA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893332 0.088201 0.346307 1.477585 0.865922 1501.00 1501.00 1.000
r(A<->C){all} 0.165368 0.020733 0.000016 0.469779 0.126843 205.59 256.57 1.004
r(A<->G){all} 0.174624 0.022625 0.000160 0.479510 0.129116 143.16 224.20 1.000
r(A<->T){all} 0.159640 0.018657 0.000127 0.432878 0.120647 223.87 266.81 1.004
r(C<->G){all} 0.156316 0.017701 0.000141 0.421860 0.121222 168.19 253.09 1.000
r(C<->T){all} 0.160873 0.020044 0.000003 0.443948 0.119338 229.78 250.90 1.000
r(G<->T){all} 0.183179 0.023372 0.000047 0.489102 0.141934 135.96 138.29 1.002
pi(A){all} 0.180886 0.000255 0.149445 0.211441 0.180416 1179.29 1257.50 1.000
pi(C){all} 0.274484 0.000332 0.240476 0.311083 0.274486 1460.36 1468.64 1.000
pi(G){all} 0.331206 0.000396 0.290908 0.368294 0.330769 1235.08 1323.14 1.000
pi(T){all} 0.213424 0.000293 0.178028 0.245671 0.213436 1453.12 1477.06 1.000
alpha{1,2} 0.429403 0.242445 0.000342 1.424146 0.263465 1407.63 1428.01 1.000
alpha{3} 0.462110 0.255652 0.000456 1.460591 0.299466 1393.83 1447.42 1.000
pinvar{all} 0.997275 0.000011 0.991429 0.999999 0.998261 1284.04 1296.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/tagA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 192
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 2 2 2 2 2 2
TTC 8 8 8 8 8 8 | TCC 4 4 4 4 4 4 | TAC 0 0 0 0 0 0 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 8 8 8 8 8 8
CTA 0 0 0 0 0 0 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 8 8 8 8 8 8 | CCG 1 1 1 1 1 1 | CAG 4 4 4 4 4 4 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 5 5 5 5 5 5 | ACC 2 2 2 2 2 2 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 9 9 9 9 9 9 | GAC 7 7 7 7 7 7 | GGC 2 2 2 2 2 2
GTA 2 2 2 2 2 2 | GCA 3 3 3 3 3 3 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 5 5 5 5 5 5 | GCG 8 8 8 8 8 8 | GAG 7 7 7 7 7 7 | GGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908108_1_1102_MLBR_RS05170
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
#2: NC_002677_1_NP_301784_1_656_tagA
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
#3: NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
#4: NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
#5: NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
#6: NZ_AP014567_1_WP_010908108_1_1143_tag
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 12
TTC 48 | TCC 24 | TAC 0 | TGC 12
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 12 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 6 | Arg R CGT 18
CTC 12 | CCC 6 | CAC 18 | CGC 48
CTA 0 | CCA 18 | Gln Q CAA 12 | CGA 12
CTG 48 | CCG 6 | CAG 24 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 12
ATC 30 | ACC 12 | AAC 18 | AGC 18
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 24 | ACG 12 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 6
GTC 12 | GCC 54 | GAC 42 | GGC 12
GTA 12 | GCA 18 | Glu E GAA 30 | GGA 18
GTG 30 | GCG 48 | GAG 42 | GGG 42
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19792 C:0.25521 A:0.17188 G:0.37500
position 2: T:0.25521 C:0.25000 A:0.23958 G:0.25521
position 3: T:0.18750 C:0.31771 A:0.13021 G:0.36458
Average T:0.21354 C:0.27431 A:0.18056 G:0.33160
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -769.263845 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300039 1.299773
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908108_1_1102_MLBR_RS05170: 0.000004, NC_002677_1_NP_301784_1_656_tagA: 0.000004, NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090: 0.000004, NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600: 0.000004, NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665: 0.000004, NZ_AP014567_1_WP_010908108_1_1143_tag: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30004
omega (dN/dS) = 1.29977
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 441.8 134.2 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 441.8 134.2 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 441.8 134.2 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 441.8 134.2 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 441.8 134.2 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 441.8 134.2 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -769.263488 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.048035
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908108_1_1102_MLBR_RS05170: 0.000004, NC_002677_1_NP_301784_1_656_tagA: 0.000004, NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090: 0.000004, NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600: 0.000004, NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665: 0.000004, NZ_AP014567_1_WP_010908108_1_1143_tag: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.04803 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.0 128.0 0.0480 0.0000 0.0000 0.0 0.0
7..2 0.000 448.0 128.0 0.0480 0.0000 0.0000 0.0 0.0
7..3 0.000 448.0 128.0 0.0480 0.0000 0.0000 0.0 0.0
7..4 0.000 448.0 128.0 0.0480 0.0000 0.0000 0.0 0.0
7..5 0.000 448.0 128.0 0.0480 0.0000 0.0000 0.0 0.0
7..6 0.000 448.0 128.0 0.0480 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -769.263743 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.606611 0.216067 0.000001 1.371178
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908108_1_1102_MLBR_RS05170: 0.000004, NC_002677_1_NP_301784_1_656_tagA: 0.000004, NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090: 0.000004, NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600: 0.000004, NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665: 0.000004, NZ_AP014567_1_WP_010908108_1_1143_tag: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.60661 0.21607 0.17732
w: 0.00000 1.00000 1.37118
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.0 128.0 0.4592 0.0000 0.0000 0.0 0.0
7..2 0.000 448.0 128.0 0.4592 0.0000 0.0000 0.0 0.0
7..3 0.000 448.0 128.0 0.4592 0.0000 0.0000 0.0 0.0
7..4 0.000 448.0 128.0 0.4592 0.0000 0.0000 0.0 0.0
7..5 0.000 448.0 128.0 0.4592 0.0000 0.0000 0.0 0.0
7..6 0.000 448.0 128.0 0.4592 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908108_1_1102_MLBR_RS05170)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908108_1_1102_MLBR_RS05170)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -769.263410 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.778718
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908108_1_1102_MLBR_RS05170: 0.000004, NC_002677_1_NP_301784_1_656_tagA: 0.000004, NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090: 0.000004, NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600: 0.000004, NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665: 0.000004, NZ_AP014567_1_WP_010908108_1_1143_tag: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.77872
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -769.263410 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.405392 1.497368
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908108_1_1102_MLBR_RS05170: 0.000004, NC_002677_1_NP_301784_1_656_tagA: 0.000004, NZ_LVXE01000047_1_WP_010908108_1_1971_A3216_RS11090: 0.000004, NZ_LYPH01000054_1_WP_010908108_1_2003_A8144_RS09600: 0.000004, NZ_CP029543_1_WP_010908108_1_1118_DIJ64_RS05665: 0.000004, NZ_AP014567_1_WP_010908108_1_1143_tag: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.40539
(p1 = 0.00001) w = 1.49737
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.49737
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 448.0 128.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908108_1_1102_MLBR_RS05170)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:11
Model 1: NearlyNeutral -769.263488 Model 2: PositiveSelection -769.263743 Model 0: one-ratio -769.263845 Model 7: beta -769.26341 Model 8: beta&w>1 -769.26341 Model 0 vs 1 7.13999999788939E-4 Model 2 vs 1 5.099999998492422E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
