--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 21:12:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/340/para-PE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/340/para-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/340/para-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1     -12383.54        -12398.08
2     -12383.56        -12395.18
--------------------------------------
TOTAL   -12383.55        -12397.44
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/340/para-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/340/para-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/340/para-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.215338    0.000234    0.188428    0.248448    0.214732   1362.24   1402.82    1.000
r(A<->C){all}   0.070963    0.000157    0.047016    0.094934    0.070679    918.03   1011.96    1.000
r(A<->G){all}   0.246925    0.000608    0.203243    0.297190    0.246290    923.16    968.05    1.000
r(A<->T){all}   0.076448    0.000263    0.046110    0.108902    0.074832   1145.72   1148.42    1.000
r(C<->G){all}   0.083556    0.000146    0.061321    0.108626    0.083079   1116.21   1144.53    1.000
r(C<->T){all}   0.461757    0.000924    0.403031    0.519206    0.461573    992.43   1045.37    1.000
r(G<->T){all}   0.060352    0.000153    0.035874    0.083990    0.059662   1095.57   1129.41    1.000
pi(A){all}      0.255623    0.000029    0.244684    0.265679    0.255672    733.95    913.78    1.000
pi(C){all}      0.241801    0.000027    0.231273    0.251858    0.241698   1262.33   1267.27    1.000
pi(G){all}      0.264875    0.000029    0.253946    0.274798    0.264827   1218.50   1236.59    1.000
pi(T){all}      0.237701    0.000027    0.227641    0.248044    0.237738   1042.75   1108.74    1.001
alpha{1,2}      0.072768    0.000905    0.003329    0.114604    0.079696   1006.32   1023.17    1.001
alpha{3}        4.549520    1.252948    2.554319    6.729490    4.414763   1501.00   1501.00    1.000
pinvar{all}     0.782454    0.000207    0.754207    0.810132    0.782941    998.52   1176.50    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-11682.504674
Model 2: PositiveSelection	-11673.733031
Model 0: one-ratio	-11790.907272
Model 3: discrete	-11673.689411
Model 7: beta	-11701.015515
Model 8: beta&w>1	-11673.919751


Model 0 vs 1	216.80519600000116

Model 2 vs 1	17.54328600000008

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PE)

            Pr(w>1)     post mean +- SE for w

  1983 E      0.819         3.322
  1994 H      0.980*        3.776
  2003 G      0.797         3.259
  2009 E      0.777         3.201
  2010 A      0.915         3.591
  2011 T      0.676         2.914
  2015 P      0.707         3.002
  2019 S      0.899         3.547
  2053 A      0.664         2.881
  2055 A      0.921         3.610

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PE)

            Pr(w>1)     post mean +- SE for w

   326 S      0.569         1.616 +- 0.843
   870 M      0.707         1.855 +- 0.784
  1983 E      0.842         2.040 +- 0.755
  1992 T      0.644         1.748 +- 0.847
  1994 H      0.924         2.129 +- 0.710
  1997 G      0.568         1.615 +- 0.843
  2003 G      0.812         2.009 +- 0.771
  2004 D      0.536         1.556 +- 0.842
  2006 A      0.611         1.690 +- 0.848
  2009 E      0.809         2.003 +- 0.771
  2010 A      0.876         2.081 +- 0.739
  2011 T      0.760         1.933 +- 0.804
  2012 D      0.657         1.771 +- 0.850
  2013 D      0.701         1.842 +- 0.813
  2015 P      0.776         1.956 +- 0.795
  2016 A      0.643         1.746 +- 0.850
  2017 G      0.655         1.767 +- 0.846
  2019 S      0.869         2.073 +- 0.743
  2025 E      0.596         1.664 +- 0.846
  2039 G      0.663         1.781 +- 0.844
  2051 A      0.632         1.728 +- 0.850
  2052 A      0.632         1.728 +- 0.850
  2053 A      0.777         1.959 +- 0.779
  2055 A      0.878         2.084 +- 0.738


Model 8 vs 7	54.19152799999938

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PE)

            Pr(w>1)     post mean +- SE for w

   112 V      0.588         1.566
   135 M      0.613         1.627
   324 R      0.576         1.534
   326 S      0.950*        2.473
   807 F      0.535         1.431
   870 M      0.997**       2.589
  1983 E      1.000**       2.597
  1986 G      0.759         1.994
  1992 T      0.972*        2.529
  1994 H      1.000**       2.598
  1997 G      0.950         2.472
  2003 G      0.999**       2.596
  2004 D      0.935         2.434
  2006 A      0.964*        2.507
  2007 P      0.554         1.479
  2008 D      0.772         2.026
  2009 E      0.999**       2.596
  2010 A      1.000**       2.598
  2011 T      0.994**       2.582
  2012 D      0.975*        2.534
  2013 D      0.989*        2.570
  2015 P      0.996**       2.587
  2016 A      0.972*        2.527
  2017 G      0.975*        2.535
  2019 S      1.000**       2.597
  2020 V      0.555         1.483
  2023 T      0.598         1.589
  2024 A      0.632         1.676
  2025 E      0.959*        2.496
  2039 G      0.977*        2.540
  2046 A      0.623         1.654
  2047 A      0.604         1.604
  2051 A      0.969*        2.520
  2052 A      0.969*        2.520
  2053 A      0.999**       2.594
  2055 A      1.000**       2.598

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_para-PE)

            Pr(w>1)     post mean +- SE for w

   326 S      0.696         1.183 +- 0.531
   870 M      0.866         1.388 +- 0.353
  1983 E      0.948         1.470 +- 0.233
  1992 T      0.749         1.246 +- 0.496
  1994 H      0.984*        1.502 +- 0.159
  1997 G      0.694         1.182 +- 0.532
  2003 G      0.916         1.438 +- 0.290
  2004 D      0.665         1.147 +- 0.548
  2006 A      0.725         1.218 +- 0.513
  2009 E      0.915         1.437 +- 0.291
  2010 A      0.962*        1.483 +- 0.205
  2011 T      0.858         1.372 +- 0.384
  2012 D      0.753         1.250 +- 0.494
  2013 D      0.826         1.338 +- 0.418
  2015 P      0.875         1.392 +- 0.360
  2016 A      0.745         1.241 +- 0.499
  2017 G      0.757         1.255 +- 0.490
  2019 S      0.958*        1.479 +- 0.216
  2025 E      0.715         1.206 +- 0.520
  2039 G      0.764         1.264 +- 0.484
  2051 A      0.737         1.232 +- 0.505
  2052 A      0.737         1.232 +- 0.505
  2053 A      0.900         1.422 +- 0.311
  2055 A      0.963*        1.484 +- 0.204

>C1
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGGSFEPDTDHGDGGDP
DAGDPAPDEATDGDAPAGGDGSVNGTAEGAADADESNVNSPGEDAAAAAA
AAAAAAAAGTTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSRSPS
ITSRTADVooooooooooooooo
>C2
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
IIMLFIGLNMFTMTLDRYDASETYNAVLDYLNAIFVVIFSSECLLKIFAL
RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGGSFEPDTDQGDGGDP
DAGDPAPDEQTDGDAPAGGDGSVNGTAEGAADADESNVNSPGEDAAAASA
AAAAAAAGTTTAGSPGAGSTGRQTAVLVESDGFVTKNGHKVVIHSRSPSI
TSRTADVoooooooooooooooo
>C3
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDFEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
GYEPVSSTLWRQREEYCARLIQHAWRKHKARGAGGGSFEPDTDGDGDGDC
DPDAVDPAPDEQADGGEAPAGGALDGSVNGTGNGTGTGEGAADADESNVN
SPGEDAAAAAVAAAAAATTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVV
IHSRSPSITSRTADVoooooooo
>C4
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGGGSFEPDTDQGDGGD
PDAADPAPGDETADGEAPAGGDGSVNGTGGNGEGAADADESNVNSPGEDA
AAAAAAAAAGTTAGTTAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHS
RSPSITSRTADVooooooooooo
>C5
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
GYEPVSSTLWRQREEYCARLIQHAWRKHKARGSGGDGGGSFEPDPEQGDH
QGGGGNGGEPEAGAPAPGDAADGEAPTDGEANGNGTGDGAAGADESNVNS
PIEDAVAAAAAAAVATAAGAVTTTTTAAGSPGAGSAGRQTAVLVESDGFV
TKNGHKVVIHSRSPSITSRTADV
>C6
MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
CWVWLKIQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
KSGNYFFTATFAIEATMKLCAMSPKYYFQEGWNIFDFIIVALSLLELGLE
GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGGSFEPDPDQGGGGDG
GDPDAAEPQLDEPTDAEGPEGDGSGVNGTGTGDGAADADENNVNSPGEDA
AAAAAAAAGTTTGTAAGSPGAGSAGRQTAVLVESDGFVTKNGHKVVIHSR
SPSITSRTADVoooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=2148 

C1              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C2              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C3              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C4              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C5              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
C6              MTEDSDSISEEERSLFRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEV
                **************************************************

C1              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C2              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C3              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C4              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C5              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
C6              PQYGRKKKQKEIRYDDEDEDEGPQPDPTLEQGVPIPVRLQGSFPPELAST
                **************************************************

C1              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRVAIYIL
C2              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C3              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C4              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C5              PLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
C6              PLEDIDPFYSNILTFVVVSKGKDIFRFSASKAMWLLDPFNPIRRVAIYIL
                *******:***:**********************:***************

C1              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C2              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C3              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C4              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C5              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
C6              VHPLFSLFIITTILVNCILMIMPTTPTVESTEVIFTGIYTFESAVKVMAR
                **************************************************

C1              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C2              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C3              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C4              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C5              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
C6              GFILCPFTYLRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKT
                **************************************************

C1              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C2              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C3              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C4              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C5              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
C6              VAIVPGLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQK
                **************************************************

C1              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C2              CIKKFPLDGSWGNLTDENWAYHNHNKSNWYSEDEGISFPLCGNISGAGQC
C3              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C4              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C5              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
C6              CIKKFPLDGSWGNLTDENWDYHNRNSSNWYSEDEGISFPLCGNISGAGQC
                ******************* ***:*.************************

C1              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C2              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C3              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C4              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C5              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
C6              DDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRA
                **************************************************

C1              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C2              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C3              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C4              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C5              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
C6              AGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAI
                **************************************************

C1              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C2              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C3              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C4              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C5              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
C6              REAEEAAAAKAAKLEERANAQAQAAADAAAAEEAALHPEMAKSPTYSCIS
                **************************************************

C1              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C2              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C3              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C4              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C5              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
C6              YELFVGGEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQATKVR
                **************************************************

C1              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C2              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C3              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C4              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C5              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
C6              KVSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTY
                **************************************************

C1              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C2              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C3              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C4              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C5              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
C6              QDAQQHLPYADDSNAVTPMSEENGAIIVPVYYGNLGSRHSSYTSHQSRIS
                **************************************************

C1              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C2              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C3              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C4              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C5              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
C6              YTSHGDLLGGMAVMGVSTMTKESKLRNRNTRNQSVGATNGGTTCLDTNHK
                **************************************************

C1              LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C2              LDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C3              LEHRDFEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C4              LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C5              LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
C6              LEHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQ
                *:***:********************************************

C1              AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
C2              AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
C3              AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
C4              AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
C5              AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
C6              AAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDC
                **************************************************

C1              CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
C2              CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
C3              CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
C4              CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
C5              CWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
C6              CWVWLKIQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVL
                ******:*******************************************

C1              KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
C2              KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
C3              KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
C4              KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
C5              KSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLE
C6              KSGNYFFTATFAIEATMKLCAMSPKYYFQEGWNIFDFIIVALSLLELGLE
                ******************* ******************************

C1              GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
C2              GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
C3              GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
C4              GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
C5              GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
C6              GVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCII
                **************************************************

C1              IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
C2              IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
C3              IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
C4              IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
C5              IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
C6              IFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE
                **************************************************

C1              WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
C2              WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
C3              WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
C4              WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
C5              WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
C6              WIESMWDCMYVGDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSA
                **************************************************

C1              PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
C2              PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
C3              PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
C4              PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
C5              PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
C6              PTADNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPSEH
                **************************************************

C1              GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
C2              GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
C3              GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
C4              GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
C5              GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
C6              GDNELELGHDEILADGLIKKGIKEQTQLEVAIGDGMEFTIHGDMKNNKPK
                **************************************************

C1              KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
C2              KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
C3              KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
C4              KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
C5              KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
C6              KSKYLNNATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKE
                **************************************************

C1              DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
C2              DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
C3              DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
C4              DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
C5              DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
C6              DLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP
                **************************************************

C1              ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
C2              ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
C3              ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
C4              ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
C5              ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
C6              ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDV
                **************************************************

C1              HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
C2              HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
C3              HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
C4              HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
C5              HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
C6              HLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFV
                **************************************************

C1              IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
C2              IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
C3              IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
C4              IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
C5              IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
C6              IVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNAL
                **************************************************

C1              VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
C2              VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
C3              VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
C4              VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
C5              VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
C6              VQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDMNGTKLSHEIIP
                **************************************************

C1              NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
C2              NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
C3              NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
C4              NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
C5              NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
C6              NRNACESENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSRE
                **************************************************

C1              VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
C2              VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
C3              VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
C4              VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
C5              VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
C6              VDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGS
                **************************************************

C1              LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
C2              LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
C3              LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
C4              LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
C5              LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
C6              LEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDI
                **************************************************

C1              IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
C2              IIMLFIGLNMFTMTLDRYDASETYNAVLDYLNAIFVVIFSSECLLKIFAL
C3              IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
C4              IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
C5              IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
C6              IIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFAL
                *********************:****************************

C1              RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
C2              RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
C3              RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
C4              RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
C5              RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
C6              RYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKVGR
                **************************************************

C1              VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
C2              VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
C3              VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
C4              VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
C5              VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
C6              VLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHV
                **************************************************

C1              KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
C2              KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
C3              KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
C4              KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
C5              KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
C6              KEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPDND
                **************************************************

C1              KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
C2              KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
C3              KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
C4              KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
C5              KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
C6              KGYPGNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEG
                **************************************************

C1              LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
C2              LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
C3              LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
C4              LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
C5              LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
C6              LTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKI
                **************************************************

C1              ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
C2              ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
C3              ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
C4              ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
C5              ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
C6              ISMDIPICRGDLMYCVDILDALTKDFFARKGNPIEETGEIGEIAARPDTE
                **************************************************

C1              GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGG---SFEPDTD----
C2              GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGG---SFEPDTD----
C3              GYEPVSSTLWRQREEYCARLIQHAWRKHKARGAGGG---SFEPDTDG---
C4              GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGGG--SFEPDTD----
C5              GYEPVSSTLWRQREEYCARLIQHAWRKHKARGSGGDGGGSFEPDPEQGDH
C6              GYEPVSSTLWRQREEYCARLIQHAWRKHKARGEGGG---SFEPDPDQ---
                ******************************** **.   *****.:    

C1              --HGDG-GDPDAGDPAP-DEATDGDAPAGG--DGSVNGT------AEGAA
C2              --QGDG-GDPDAGDPAP-DEQTDGDAPAGG--DGSVNGT------AEGAA
C3              --DGDGDCDPDAVDPAPDEQADGGEAPAGGALDGSVNGTGNGTGTGEGAA
C4              --QGDG-GDPDAADPAPGDETADGEAPAGG--DGSVNGTG---GNGEGAA
C5              QGGGGNGGEPEAGAPAPGDAADG-EAPTDG----EANGNG----TGDGAA
C6              GGGGDG-GDPDAAEPQLDEPTDAEGPEGDG---SGVNGTG----TGDGAA
                   *..  :*:*  *   :      .  .*     .**.      .:***

C1              DADESNVNSPGEDAAAAAAAAAAA-----AAAGTTTAGSPGAGSAGRQTA
C2              DADESNVNSPGEDAAAASAAAAAA-----AAG-TTTAGSPGAGSTGRQTA
C3              DADESNVNSPGEDAAAAAVAAAAA-----ATT----AGSPGAGSAGRQTA
C4              DADESNVNSPGEDAAAAAAAAAAG-----TTA-GTTAGSPGAGSAGRQTA
C5              GADESNVNSPIEDAVAAAAAAAVATAAGAVTTTTTAAGSPGAGSAGRQTA
C6              DADENNVNSPGEDAAAAAAAAAGT-----TTG--TAAGSPGAGSAGRQTA
                .***.***** ***.**:.***       .:     ********:*****

C1              VLVESDGFVTKNGHKVVIHSRSPSITSRTADVooooooooooooooo-
C2              VLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooooooooooo
C3              VLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooo--------
C4              VLVESDGFVTKNGHKVVIHSRSPSITSRTADVooooooooooo-----
C5              VLVESDGFVTKNGHKVVIHSRSPSITSRTADV----------------
C6              VLVESDGFVTKNGHKVVIHSRSPSITSRTADVoooooooooooo----
                ********************************                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68310]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68310]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [68310]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 2123 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 2123 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/340/para-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/