--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:28:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rnc/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -977.49 -980.23
2 -977.46 -980.18
--------------------------------------
TOTAL -977.48 -980.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897657 0.087234 0.348370 1.458194 0.873493 1501.00 1501.00 1.000
r(A<->C){all} 0.168382 0.020288 0.000001 0.461061 0.130394 208.75 216.96 1.000
r(A<->G){all} 0.163346 0.019383 0.000008 0.453785 0.126661 235.71 274.99 1.007
r(A<->T){all} 0.161887 0.019331 0.000024 0.445972 0.124379 197.24 329.80 1.000
r(C<->G){all} 0.166404 0.020463 0.000093 0.448463 0.127245 199.23 209.59 1.002
r(C<->T){all} 0.167018 0.021545 0.000448 0.467162 0.125030 260.65 288.01 1.000
r(G<->T){all} 0.172962 0.022269 0.000289 0.461311 0.133254 153.90 163.25 1.001
pi(A){all} 0.196108 0.000220 0.168210 0.225227 0.196233 1179.93 1288.30 1.001
pi(C){all} 0.270185 0.000273 0.239421 0.304534 0.270198 1282.98 1329.33 1.001
pi(G){all} 0.322361 0.000292 0.292725 0.359573 0.322204 1340.99 1365.50 1.000
pi(T){all} 0.211345 0.000222 0.184655 0.243363 0.211129 1283.66 1284.73 1.000
alpha{1,2} 0.436816 0.262576 0.000293 1.438817 0.253421 1083.51 1205.99 1.000
alpha{3} 0.458607 0.236024 0.000163 1.455973 0.286676 1236.52 1274.23 1.000
pinvar{all} 0.997842 0.000007 0.993204 0.999999 0.998648 890.86 1038.83 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -945.950965
Model 2: PositiveSelection -945.95114
Model 0: one-ratio -945.951232
Model 7: beta -945.950965
Model 8: beta&w>1 -945.951143
Model 0 vs 1 5.340000000160217E-4
Model 2 vs 1 3.5000000002582965E-4
Model 8 vs 7 3.560000000106811E-4
>C1
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C2
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C3
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C4
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C5
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C6
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238
C1 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C2 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C3 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C4 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C5 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C6 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
**************************************************
C1 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C2 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C3 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C4 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C5 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C6 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
**************************************************
C1 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C2 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C3 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C4 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C5 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C6 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
**************************************************
C1 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C2 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C3 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C4 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C5 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C6 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
**************************************************
C1 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C2 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C3 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C4 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C5 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C6 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7140]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7140]--->[7140]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.778 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C2 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C3 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C4 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C5 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C6 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
**************************************************
C1 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C2 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C3 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C4 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C5 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C6 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
**************************************************
C1 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C2 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C3 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C4 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C5 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C6 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
**************************************************
C1 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C2 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C3 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C4 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C5 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C6 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
**************************************************
C1 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C2 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C3 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C4 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C5 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C6 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C2 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C3 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C4 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C5 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C6 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
**************************************************
C1 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C2 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C3 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C4 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C5 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C6 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
**************************************************
C1 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C2 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C3 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C4 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C5 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C6 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
**************************************************
C1 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C2 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C3 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C4 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C5 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C6 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
**************************************************
C1 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C2 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C3 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C4 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C5 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C6 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
**************************************************
C1 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C2 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C3 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C4 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C5 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C6 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
**************************************************
C1 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C2 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C3 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C4 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C5 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C6 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
**************************************************
C1 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C2 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C3 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C4 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C5 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C6 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
**************************************************
C1 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C2 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C3 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C4 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C5 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C6 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
**************************************************
C1 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C2 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C3 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C4 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C5 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C6 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
**************************************************
C1 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C2 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C3 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C4 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C5 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C6 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
**************************************************
C1 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C2 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C3 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C4 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C5 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C6 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
**************************************************
C1 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C2 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C3 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C4 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C5 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C6 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
**************************************************
C1 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C2 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C3 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C4 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C5 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C6 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
**************************************************
C1 GGAAAACGTCCGTG
C2 GGAAAACGTCCGTG
C3 GGAAAACGTCCGTG
C4 GGAAAACGTCCGTG
C5 GGAAAACGTCCGTG
C6 GGAAAACGTCCGTG
**************
>C1
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C2
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C3
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C4
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C5
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C6
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C1
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C2
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C3
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C4
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C5
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C6
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 714 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789616
Setting output file names to "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1542864648
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0877481311
Seed = 2124774355
Swapseed = 1579789616
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1597.966227 -- -24.965149
Chain 2 -- -1597.966227 -- -24.965149
Chain 3 -- -1597.966227 -- -24.965149
Chain 4 -- -1597.966227 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1597.965984 -- -24.965149
Chain 2 -- -1597.966227 -- -24.965149
Chain 3 -- -1597.966227 -- -24.965149
Chain 4 -- -1597.966135 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1597.966] (-1597.966) (-1597.966) (-1597.966) * [-1597.966] (-1597.966) (-1597.966) (-1597.966)
500 -- [-983.479] (-990.836) (-992.443) (-996.162) * [-984.510] (-990.855) (-989.435) (-997.868) -- 0:00:00
1000 -- [-990.041] (-998.017) (-992.318) (-989.953) * (-992.763) (-1002.319) [-983.810] (-993.125) -- 0:00:00
1500 -- (-987.457) [-988.160] (-991.411) (-988.918) * (-985.487) (-991.314) (-986.522) [-986.711] -- 0:00:00
2000 -- (-989.989) (-995.993) (-989.842) [-982.073] * (-987.829) (-994.215) [-981.997] (-989.329) -- 0:00:00
2500 -- (-982.845) (-985.236) [-985.579] (-986.841) * [-986.938] (-980.847) (-983.605) (-993.266) -- 0:00:00
3000 -- (-982.966) (-987.917) [-987.707] (-986.749) * (-990.000) (-986.558) [-988.949] (-986.878) -- 0:00:00
3500 -- [-986.794] (-986.019) (-983.972) (-986.286) * (-985.211) (-984.047) (-992.172) [-983.580] -- 0:00:00
4000 -- (-989.249) (-992.427) [-987.003] (-985.213) * (-981.244) (-995.273) (-984.376) [-985.732] -- 0:00:00
4500 -- (-995.513) (-991.472) (-988.957) [-981.570] * (-989.542) (-985.261) [-989.610] (-989.492) -- 0:00:00
5000 -- (-985.234) (-980.918) [-984.681] (-992.729) * (-986.286) [-994.634] (-996.135) (-989.061) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-986.577) (-993.840) [-987.718] (-990.170) * (-982.649) (-988.382) (-980.734) [-985.283] -- 0:00:00
6000 -- (-989.908) (-989.046) [-986.679] (-986.429) * (-985.952) (-984.342) (-989.539) [-983.594] -- 0:00:00
6500 -- [-983.727] (-986.574) (-987.735) (-987.212) * (-982.904) (-984.025) [-985.110] (-988.268) -- 0:00:00
7000 -- (-989.564) (-989.592) (-986.480) [-982.707] * (-985.159) (-983.225) [-986.555] (-984.272) -- 0:00:00
7500 -- (-987.009) (-988.937) (-985.382) [-992.108] * (-982.828) [-984.934] (-983.704) (-993.261) -- 0:00:00
8000 -- (-982.520) (-986.090) (-984.980) [-982.972] * (-984.209) (-990.470) (-988.417) [-984.302] -- 0:00:00
8500 -- (-990.348) (-983.312) [-989.489] (-985.810) * (-987.337) [-991.118] (-987.640) (-981.983) -- 0:00:00
9000 -- (-992.822) [-983.957] (-986.336) (-989.944) * [-982.961] (-986.531) (-989.867) (-983.429) -- 0:00:00
9500 -- (-993.219) (-980.958) (-982.141) [-985.571] * [-986.291] (-995.934) (-993.600) (-989.625) -- 0:00:00
10000 -- (-985.872) (-987.053) (-986.635) [-993.138] * (-990.227) (-985.977) [-986.834] (-988.382) -- 0:00:00
Average standard deviation of split frequencies: 0.081410
10500 -- (-986.784) (-996.504) [-988.853] (-995.302) * (-982.553) (-984.022) (-989.291) [-990.910] -- 0:00:00
11000 -- [-989.622] (-987.646) (-987.674) (-990.246) * (-989.104) (-987.758) (-987.435) [-985.531] -- 0:00:00
11500 -- [-982.674] (-983.570) (-989.332) (-983.785) * (-983.890) [-985.879] (-986.027) (-987.753) -- 0:00:00
12000 -- [-985.582] (-992.413) (-986.988) (-993.027) * (-982.633) (-993.384) [-987.232] (-985.411) -- 0:01:22
12500 -- (-983.971) (-986.202) (-984.314) [-985.580] * [-981.353] (-988.068) (-987.752) (-985.413) -- 0:01:19
13000 -- [-983.980] (-986.693) (-996.044) (-980.619) * [-983.541] (-985.818) (-988.032) (-993.338) -- 0:01:15
13500 -- (-985.777) (-989.431) [-984.379] (-986.200) * [-988.996] (-985.266) (-993.396) (-984.265) -- 0:01:13
14000 -- (-997.665) (-988.319) (-1004.091) [-988.297] * [-987.198] (-991.851) (-986.445) (-989.116) -- 0:01:10
14500 -- [-992.239] (-991.221) (-990.489) (-992.067) * [-986.275] (-989.102) (-984.881) (-990.525) -- 0:01:07
15000 -- (-992.990) (-989.262) [-983.181] (-989.173) * [-983.653] (-988.164) (-987.246) (-984.920) -- 0:01:05
Average standard deviation of split frequencies: 0.062854
15500 -- [-991.014] (-999.951) (-988.840) (-982.701) * (-986.153) [-984.154] (-984.726) (-985.165) -- 0:01:03
16000 -- (-994.367) (-990.912) [-990.370] (-992.409) * [-986.020] (-986.993) (-984.072) (-990.787) -- 0:01:01
16500 -- (-994.306) (-980.869) [-993.121] (-992.612) * (-986.985) [-983.611] (-993.657) (-990.022) -- 0:00:59
17000 -- [-988.672] (-982.789) (-990.142) (-988.445) * (-987.832) (-984.612) [-988.575] (-994.616) -- 0:00:57
17500 -- (-985.766) [-989.641] (-986.759) (-998.864) * (-986.936) (-985.619) (-984.785) [-982.480] -- 0:00:56
18000 -- (-989.163) (-990.439) [-987.332] (-991.643) * (-983.948) [-986.149] (-985.077) (-990.394) -- 0:00:54
18500 -- [-985.544] (-988.435) (-988.505) (-989.954) * [-986.932] (-983.247) (-988.725) (-988.198) -- 0:00:53
19000 -- [-986.762] (-988.126) (-992.973) (-1000.272) * (-994.212) (-985.819) (-991.002) [-983.194] -- 0:00:51
19500 -- [-981.407] (-987.748) (-986.534) (-990.841) * (-984.675) (-981.473) [-986.715] (-991.672) -- 0:00:50
20000 -- [-987.122] (-996.790) (-991.836) (-1003.677) * (-986.743) [-976.379] (-989.293) (-995.018) -- 0:00:49
Average standard deviation of split frequencies: 0.065388
20500 -- [-981.109] (-992.258) (-993.123) (-981.185) * (-986.931) [-978.566] (-989.488) (-987.138) -- 0:00:47
21000 -- (-989.773) (-988.471) (-991.770) [-978.701] * (-986.765) [-978.914] (-989.018) (-989.193) -- 0:00:46
21500 -- (-986.591) [-979.295] (-986.914) (-980.165) * (-997.053) (-976.841) [-985.630] (-990.142) -- 0:00:45
22000 -- (-985.264) [-976.505] (-994.640) (-977.649) * (-991.322) (-977.813) (-996.641) [-988.518] -- 0:00:44
22500 -- (-977.784) (-976.976) (-987.197) [-979.811] * (-984.085) (-980.049) [-988.535] (-984.253) -- 0:00:43
23000 -- (-979.074) [-976.357] (-986.679) (-977.217) * (-993.392) [-977.338] (-983.274) (-976.283) -- 0:00:42
23500 -- (-976.959) [-976.730] (-981.230) (-977.743) * [-982.990] (-977.802) (-991.306) (-979.242) -- 0:00:41
24000 -- (-979.403) [-977.094] (-981.291) (-977.680) * (-990.037) (-981.356) (-994.078) [-979.182] -- 0:00:40
24500 -- (-978.246) (-976.692) [-983.837] (-976.046) * (-999.570) (-976.414) (-996.376) [-980.822] -- 0:00:39
25000 -- [-978.921] (-979.101) (-983.618) (-978.239) * (-988.492) [-976.683] (-986.168) (-979.257) -- 0:00:39
Average standard deviation of split frequencies: 0.062981
25500 -- (-978.178) (-979.263) (-996.744) [-976.811] * (-990.149) [-977.253] (-990.842) (-981.448) -- 0:00:38
26000 -- [-979.440] (-979.792) (-986.385) (-978.132) * (-994.373) [-980.014] (-985.513) (-980.895) -- 0:00:37
26500 -- (-979.996) [-976.991] (-985.038) (-978.255) * (-1003.150) [-983.200] (-988.862) (-978.179) -- 0:00:36
27000 -- (-979.556) [-978.293] (-985.311) (-977.368) * (-987.863) (-981.462) (-991.629) [-977.606] -- 0:00:36
27500 -- (-980.786) (-977.550) [-984.324] (-976.179) * [-992.925] (-977.032) (-985.148) (-977.766) -- 0:01:10
28000 -- (-977.218) (-977.286) (-989.898) [-976.190] * (-987.861) (-978.072) (-987.841) [-977.131] -- 0:01:09
28500 -- [-976.270] (-977.738) (-988.925) (-978.107) * (-989.150) (-976.877) [-985.244] (-977.153) -- 0:01:08
29000 -- (-977.027) (-982.427) (-989.407) [-980.368] * (-991.915) (-977.696) (-981.857) [-976.454] -- 0:01:06
29500 -- (-976.975) (-985.656) (-990.770) [-978.341] * (-984.088) (-978.122) (-987.455) [-980.187] -- 0:01:05
30000 -- (-977.825) (-976.734) [-988.994] (-977.470) * (-989.471) (-978.255) [-987.509] (-976.430) -- 0:01:04
Average standard deviation of split frequencies: 0.053397
30500 -- (-977.762) (-976.581) (-990.220) [-979.393] * (-991.929) (-978.635) [-984.936] (-976.771) -- 0:01:03
31000 -- [-977.811] (-979.377) (-997.593) (-982.868) * (-988.264) (-976.846) [-987.456] (-978.268) -- 0:01:02
31500 -- (-978.352) [-980.204] (-989.523) (-976.621) * (-989.944) [-977.159] (-986.915) (-979.613) -- 0:01:01
32000 -- [-978.427] (-979.389) (-989.025) (-976.067) * (-987.718) (-978.295) [-985.141] (-979.319) -- 0:01:00
32500 -- [-977.322] (-977.423) (-991.535) (-978.480) * (-986.890) (-976.893) [-986.383] (-979.023) -- 0:00:59
33000 -- [-976.663] (-978.282) (-991.017) (-976.972) * (-986.543) (-979.091) (-992.374) [-978.259] -- 0:00:58
33500 -- [-977.237] (-978.069) (-989.193) (-976.501) * (-994.691) [-978.816] (-990.234) (-978.293) -- 0:00:57
34000 -- (-981.643) (-983.115) [-985.199] (-977.059) * (-990.646) (-977.715) [-991.938] (-978.352) -- 0:00:56
34500 -- [-976.810] (-980.829) (-995.607) (-976.223) * (-987.427) [-977.767] (-994.088) (-977.740) -- 0:00:55
35000 -- [-976.768] (-976.721) (-994.437) (-977.542) * [-982.857] (-980.977) (-983.868) (-980.444) -- 0:00:55
Average standard deviation of split frequencies: 0.048243
35500 -- (-978.100) (-977.288) (-984.219) [-977.628] * (-989.084) (-983.099) [-981.109] (-979.282) -- 0:00:54
36000 -- (-976.647) (-978.582) [-985.651] (-979.867) * (-988.987) (-977.554) (-981.267) [-976.916] -- 0:00:53
36500 -- (-976.997) [-978.355] (-981.575) (-980.128) * [-985.176] (-977.569) (-996.117) (-978.902) -- 0:00:52
37000 -- (-977.114) (-983.565) (-1001.095) [-978.650] * (-984.723) [-977.242] (-985.547) (-980.163) -- 0:00:52
37500 -- (-976.250) (-979.771) [-990.276] (-976.920) * (-990.429) (-979.661) (-987.795) [-978.234] -- 0:00:51
38000 -- (-982.562) (-976.715) (-992.129) [-977.353] * (-983.254) [-980.120] (-985.374) (-978.103) -- 0:00:50
38500 -- (-978.883) [-977.426] (-986.663) (-979.357) * [-991.786] (-978.060) (-983.146) (-978.918) -- 0:00:49
39000 -- [-978.682] (-978.326) (-986.532) (-979.509) * (-991.756) (-980.290) [-993.577] (-979.895) -- 0:00:49
39500 -- (-979.969) (-980.156) [-993.149] (-977.219) * (-991.332) (-980.544) [-984.891] (-976.531) -- 0:00:48
40000 -- (-979.079) [-978.941] (-988.079) (-977.765) * (-990.875) [-980.580] (-985.446) (-980.660) -- 0:00:48
Average standard deviation of split frequencies: 0.034094
40500 -- (-976.873) [-977.707] (-987.781) (-979.793) * (-985.139) (-980.029) [-986.864] (-981.084) -- 0:00:47
41000 -- (-979.027) (-977.301) (-985.262) [-979.841] * (-983.181) [-980.712] (-989.518) (-979.308) -- 0:00:46
41500 -- (-978.948) (-977.315) (-988.360) [-977.247] * (-989.247) (-978.496) (-985.573) [-978.212] -- 0:00:46
42000 -- (-980.892) [-980.352] (-988.333) (-976.819) * (-983.613) [-976.582] (-991.444) (-978.103) -- 0:00:45
42500 -- (-978.141) (-979.895) (-989.124) [-976.216] * [-982.264] (-977.416) (-987.714) (-978.190) -- 0:00:45
43000 -- (-978.790) (-985.256) (-983.911) [-977.567] * [-994.191] (-979.145) (-983.409) (-980.804) -- 0:00:44
43500 -- (-976.448) (-980.907) [-984.684] (-977.338) * [-987.877] (-980.096) (-989.159) (-977.508) -- 0:00:43
44000 -- (-976.466) (-977.396) [-983.232] (-976.442) * (-994.173) [-976.689] (-983.934) (-977.509) -- 0:01:05
44500 -- (-980.410) (-978.721) [-986.031] (-976.368) * (-989.813) (-976.977) [-987.279] (-980.539) -- 0:01:04
45000 -- (-978.954) [-978.512] (-984.421) (-977.261) * (-988.720) [-975.843] (-985.236) (-977.275) -- 0:01:03
Average standard deviation of split frequencies: 0.028304
45500 -- (-980.328) [-977.702] (-982.616) (-978.370) * [-984.199] (-976.904) (-991.351) (-977.920) -- 0:01:02
46000 -- (-980.257) (-976.863) [-978.272] (-979.544) * (-991.894) (-980.022) [-977.956] (-976.732) -- 0:01:02
46500 -- (-979.489) (-979.845) (-977.181) [-980.094] * (-982.342) [-978.434] (-978.070) (-976.580) -- 0:01:01
47000 -- (-981.621) (-983.616) (-978.201) [-981.099] * (-985.297) [-978.702] (-980.503) (-976.963) -- 0:01:00
47500 -- (-981.523) [-978.640] (-977.905) (-979.665) * [-987.018] (-979.654) (-979.946) (-980.476) -- 0:01:00
48000 -- (-982.024) (-980.247) (-977.147) [-981.299] * (-988.263) (-977.541) (-984.349) [-977.968] -- 0:00:59
48500 -- (-983.069) [-981.746] (-975.992) (-981.041) * [-983.639] (-979.034) (-980.473) (-979.288) -- 0:00:58
49000 -- (-977.621) (-978.456) [-976.932] (-977.977) * (-992.463) (-980.616) (-980.067) [-980.132] -- 0:00:58
49500 -- (-978.943) (-977.093) [-977.686] (-980.155) * (-982.194) [-978.094] (-978.214) (-977.819) -- 0:00:57
50000 -- [-976.709] (-976.955) (-980.807) (-976.495) * (-980.109) [-981.002] (-977.375) (-977.758) -- 0:00:57
Average standard deviation of split frequencies: 0.029684
50500 -- (-976.176) [-977.417] (-978.047) (-976.534) * (-979.806) (-978.000) [-976.776] (-977.768) -- 0:00:56
51000 -- (-978.552) [-977.464] (-978.666) (-979.139) * (-978.458) (-977.736) [-977.857] (-977.738) -- 0:00:55
51500 -- (-977.945) (-976.809) (-979.586) [-978.048] * (-976.460) (-979.482) [-977.699] (-978.973) -- 0:00:55
52000 -- (-976.939) (-980.101) [-978.778] (-978.211) * [-978.349] (-977.621) (-979.604) (-980.442) -- 0:00:54
52500 -- (-976.008) (-984.230) (-977.151) [-977.311] * (-976.627) [-978.586] (-977.311) (-976.892) -- 0:00:54
53000 -- [-977.213] (-982.000) (-976.438) (-977.915) * (-978.200) [-977.382] (-976.999) (-975.947) -- 0:00:53
53500 -- (-977.377) (-978.553) [-978.072] (-982.001) * [-975.901] (-977.329) (-976.760) (-976.561) -- 0:00:53
54000 -- (-977.580) (-978.751) [-977.905] (-985.031) * (-976.456) (-977.386) (-977.271) [-977.306] -- 0:00:52
54500 -- (-978.426) [-977.152] (-978.092) (-977.399) * (-980.468) [-979.216] (-977.548) (-976.406) -- 0:00:52
55000 -- [-977.423] (-978.224) (-979.058) (-978.107) * (-977.830) (-979.557) (-977.816) [-979.179] -- 0:00:51
Average standard deviation of split frequencies: 0.027469
55500 -- [-976.895] (-978.810) (-978.314) (-978.372) * [-978.220] (-977.444) (-978.802) (-979.113) -- 0:00:51
56000 -- (-977.727) (-979.167) (-977.861) [-977.616] * (-982.144) (-977.544) (-977.089) [-979.204] -- 0:00:50
56500 -- [-978.373] (-977.366) (-979.844) (-978.698) * (-980.342) (-977.419) (-978.400) [-977.372] -- 0:00:50
57000 -- (-979.556) [-978.308] (-978.199) (-976.184) * (-979.629) [-977.505] (-976.766) (-980.403) -- 0:00:49
57500 -- (-976.936) (-979.160) [-976.851] (-978.233) * (-981.250) (-978.666) [-978.872] (-980.110) -- 0:00:49
58000 -- (-978.248) (-979.677) [-977.628] (-978.914) * [-978.376] (-980.052) (-980.242) (-979.152) -- 0:00:48
58500 -- (-976.266) (-979.824) [-976.512] (-979.207) * (-977.941) (-978.400) [-983.474] (-976.736) -- 0:00:48
59000 -- [-976.596] (-978.748) (-976.829) (-977.579) * (-980.593) [-976.448] (-981.362) (-977.094) -- 0:00:47
59500 -- (-977.512) [-978.989] (-976.668) (-976.153) * (-979.061) (-977.437) [-978.547] (-982.951) -- 0:00:47
60000 -- (-978.022) (-978.153) (-978.298) [-976.270] * (-978.713) (-976.974) [-977.105] (-977.867) -- 0:01:02
Average standard deviation of split frequencies: 0.031491
60500 -- (-978.429) (-981.969) [-980.723] (-976.270) * (-980.581) [-976.695] (-976.837) (-976.720) -- 0:01:02
61000 -- [-976.979] (-979.344) (-977.606) (-977.110) * (-979.492) [-978.654] (-978.910) (-979.777) -- 0:01:01
61500 -- (-977.850) (-976.955) (-979.233) [-977.083] * (-980.492) (-979.242) (-979.716) [-976.271] -- 0:01:01
62000 -- (-979.180) (-976.125) [-980.035] (-979.027) * (-977.312) (-981.394) (-976.783) [-978.893] -- 0:01:00
62500 -- (-979.956) [-976.411] (-977.698) (-981.666) * [-977.460] (-977.558) (-976.783) (-981.067) -- 0:01:00
63000 -- (-977.224) (-976.488) [-977.054] (-978.978) * (-977.704) [-982.542] (-977.303) (-977.395) -- 0:00:59
63500 -- (-977.701) (-979.430) (-980.625) [-978.806] * (-977.249) [-976.979] (-977.365) (-977.720) -- 0:00:58
64000 -- (-977.523) (-977.603) (-980.596) [-978.525] * [-976.611] (-977.009) (-978.182) (-976.567) -- 0:00:58
64500 -- (-977.593) [-977.472] (-980.194) (-976.921) * (-977.298) (-977.453) [-978.393] (-977.207) -- 0:00:58
65000 -- (-978.450) (-977.517) [-978.526] (-977.407) * (-977.564) (-976.893) (-978.101) [-977.144] -- 0:00:57
Average standard deviation of split frequencies: 0.032855
65500 -- [-976.934] (-977.979) (-978.380) (-980.094) * (-978.856) (-978.120) [-979.296] (-976.492) -- 0:00:57
66000 -- (-978.251) (-978.260) [-978.235] (-978.737) * (-977.285) (-976.780) [-978.065] (-978.955) -- 0:00:56
66500 -- [-979.061] (-977.475) (-978.033) (-977.149) * (-979.626) [-976.734] (-978.361) (-976.987) -- 0:00:56
67000 -- [-977.308] (-977.187) (-976.327) (-977.625) * (-981.425) (-976.300) (-977.255) [-976.945] -- 0:00:55
67500 -- (-978.503) (-976.610) (-976.988) [-977.929] * (-978.352) (-976.256) [-978.117] (-989.031) -- 0:00:55
68000 -- (-977.762) (-977.066) (-976.307) [-982.201] * [-981.101] (-977.435) (-977.241) (-985.804) -- 0:00:54
68500 -- (-979.489) (-978.085) [-977.366] (-981.940) * (-977.740) (-980.051) (-976.551) [-979.590] -- 0:00:54
69000 -- (-979.221) [-977.912] (-978.248) (-984.410) * [-977.830] (-980.162) (-976.838) (-979.885) -- 0:00:53
69500 -- (-978.129) (-979.018) (-977.171) [-980.422] * (-977.459) [-978.508] (-982.507) (-980.511) -- 0:00:53
70000 -- [-976.906] (-977.150) (-977.523) (-980.538) * (-980.343) (-977.053) [-979.902] (-976.373) -- 0:00:53
Average standard deviation of split frequencies: 0.032020
70500 -- (-976.412) (-979.492) (-978.665) [-978.390] * (-979.876) (-976.318) (-982.558) [-978.657] -- 0:00:52
71000 -- (-977.407) [-977.684] (-978.875) (-978.983) * [-977.562] (-979.370) (-980.241) (-978.710) -- 0:00:52
71500 -- (-976.726) (-979.043) (-977.363) [-976.557] * (-980.539) (-978.590) (-977.631) [-976.974] -- 0:00:51
72000 -- (-976.152) (-978.814) (-976.086) [-976.859] * (-976.262) (-977.038) [-976.099] (-978.857) -- 0:00:51
72500 -- [-979.053] (-979.407) (-976.736) (-978.096) * (-978.741) (-976.941) [-976.081] (-976.262) -- 0:00:51
73000 -- (-980.951) (-976.098) [-979.353] (-978.535) * (-977.037) (-978.436) (-976.088) [-980.160] -- 0:00:50
73500 -- (-976.612) (-976.854) (-979.215) [-979.612] * (-976.888) [-976.838] (-979.964) (-980.057) -- 0:00:50
74000 -- [-977.225] (-977.910) (-979.874) (-976.139) * (-977.799) [-976.406] (-979.038) (-978.297) -- 0:00:50
74500 -- (-976.616) [-977.010] (-978.120) (-977.803) * [-978.213] (-977.236) (-978.807) (-980.259) -- 0:00:49
75000 -- (-981.629) (-977.767) (-977.853) [-976.912] * [-977.608] (-977.084) (-979.169) (-977.040) -- 0:00:49
Average standard deviation of split frequencies: 0.030703
75500 -- (-978.500) [-977.398] (-981.433) (-977.196) * [-979.254] (-977.086) (-980.003) (-976.979) -- 0:00:48
76000 -- (-977.887) [-977.386] (-979.922) (-976.256) * (-978.675) (-977.718) (-983.178) [-981.050] -- 0:01:00
76500 -- (-980.064) [-976.621] (-978.456) (-976.932) * (-981.083) (-977.536) (-976.161) [-979.505] -- 0:01:00
77000 -- (-979.802) [-978.891] (-978.630) (-980.143) * [-980.924] (-981.499) (-978.973) (-976.293) -- 0:00:59
77500 -- (-980.209) (-978.219) (-979.239) [-979.249] * (-982.569) [-977.258] (-980.521) (-976.293) -- 0:00:59
78000 -- (-981.686) [-977.234] (-980.309) (-977.835) * (-979.809) (-978.609) (-979.378) [-980.656] -- 0:00:59
78500 -- (-981.535) [-977.088] (-978.054) (-977.829) * (-980.033) [-977.734] (-978.324) (-979.310) -- 0:00:58
79000 -- [-977.059] (-976.900) (-977.404) (-979.145) * (-978.999) [-976.396] (-977.733) (-977.188) -- 0:00:58
79500 -- (-977.368) (-976.694) (-978.071) [-976.678] * (-978.887) (-977.163) [-978.939] (-979.046) -- 0:00:57
80000 -- [-976.757] (-976.959) (-977.913) (-976.490) * [-976.765] (-978.647) (-978.125) (-981.764) -- 0:00:57
Average standard deviation of split frequencies: 0.027596
80500 -- [-976.596] (-976.470) (-976.304) (-976.754) * (-981.442) [-976.903] (-978.204) (-977.209) -- 0:00:57
81000 -- [-976.130] (-977.401) (-978.522) (-979.055) * (-977.818) (-977.343) [-978.452] (-980.823) -- 0:00:56
81500 -- (-976.381) (-978.453) (-977.089) [-980.275] * (-976.344) (-979.363) [-978.084] (-978.669) -- 0:00:56
82000 -- (-976.849) (-977.057) (-979.465) [-976.489] * [-977.549] (-982.365) (-978.487) (-977.740) -- 0:00:55
82500 -- (-976.538) (-979.350) (-978.546) [-979.017] * [-977.252] (-977.730) (-979.725) (-977.835) -- 0:00:55
83000 -- (-980.156) [-978.470] (-978.321) (-975.901) * (-977.077) (-977.906) [-981.860] (-977.808) -- 0:00:55
83500 -- (-977.360) [-977.164] (-978.780) (-975.829) * (-978.081) (-977.721) (-978.090) [-977.337] -- 0:00:54
84000 -- (-979.835) [-978.001] (-978.013) (-977.990) * (-977.981) (-980.767) [-978.710] (-979.394) -- 0:00:54
84500 -- [-977.606] (-978.148) (-977.936) (-977.945) * (-979.279) [-978.209] (-982.589) (-982.191) -- 0:00:54
85000 -- (-978.170) (-979.271) [-982.407] (-981.895) * [-976.573] (-978.628) (-979.357) (-979.020) -- 0:00:53
Average standard deviation of split frequencies: 0.028930
85500 -- (-977.668) (-978.205) (-986.455) [-978.882] * (-976.432) [-976.899] (-977.139) (-979.624) -- 0:00:53
86000 -- (-980.116) (-977.857) (-983.313) [-981.095] * [-977.476] (-976.568) (-982.414) (-977.952) -- 0:00:53
86500 -- (-980.289) [-977.598] (-977.781) (-982.510) * (-976.975) (-977.075) [-979.504] (-976.723) -- 0:00:52
87000 -- [-981.248] (-977.706) (-977.779) (-979.044) * (-979.183) [-977.764] (-977.818) (-977.785) -- 0:00:52
87500 -- (-976.923) (-976.654) (-979.309) [-980.862] * (-978.789) (-980.201) (-978.019) [-976.618] -- 0:00:52
88000 -- (-976.211) [-976.386] (-981.293) (-979.338) * (-977.389) (-978.927) [-977.738] (-977.333) -- 0:00:51
88500 -- (-976.893) (-978.359) [-977.554] (-978.621) * (-980.852) [-977.764] (-977.281) (-977.350) -- 0:00:51
89000 -- (-978.722) (-981.130) (-977.652) [-977.368] * (-981.883) (-982.275) [-976.756] (-977.336) -- 0:00:51
89500 -- [-978.995] (-979.723) (-979.756) (-979.876) * (-977.572) [-979.355] (-980.710) (-981.998) -- 0:00:50
90000 -- (-977.145) [-978.171] (-978.770) (-980.755) * (-985.133) [-980.195] (-976.445) (-976.909) -- 0:00:50
Average standard deviation of split frequencies: 0.027730
90500 -- (-982.929) [-977.679] (-980.257) (-981.481) * (-982.267) (-983.452) [-976.941] (-978.739) -- 0:00:50
91000 -- (-978.918) (-980.879) [-978.920] (-981.256) * [-976.682] (-982.251) (-976.615) (-977.205) -- 0:00:49
91500 -- (-982.517) (-977.010) (-976.558) [-976.891] * [-981.156] (-985.304) (-980.264) (-978.014) -- 0:00:49
92000 -- (-978.158) (-976.976) [-976.941] (-978.629) * (-976.718) (-980.120) (-978.050) [-979.342] -- 0:00:49
92500 -- (-977.457) (-977.897) [-976.938] (-977.036) * (-983.166) (-982.076) (-977.091) [-982.286] -- 0:00:58
93000 -- (-984.267) [-977.082] (-976.937) (-976.134) * [-977.498] (-976.298) (-977.763) (-977.933) -- 0:00:58
93500 -- (-982.581) (-976.689) [-977.678] (-976.379) * (-980.282) (-976.525) [-976.791] (-976.923) -- 0:00:58
94000 -- (-979.370) (-976.689) [-976.915] (-977.502) * (-978.303) [-976.429] (-980.232) (-977.782) -- 0:00:57
94500 -- (-979.021) [-977.326] (-978.203) (-977.171) * (-977.085) (-977.499) (-977.576) [-977.553] -- 0:00:57
95000 -- (-979.540) [-977.064] (-981.456) (-978.128) * [-977.793] (-978.763) (-979.779) (-976.791) -- 0:00:57
Average standard deviation of split frequencies: 0.025644
95500 -- (-981.579) [-977.974] (-979.040) (-980.030) * (-977.206) (-976.389) (-978.632) [-977.069] -- 0:00:56
96000 -- (-980.122) (-982.790) [-978.535] (-976.536) * (-976.209) (-977.188) (-978.342) [-977.063] -- 0:00:56
96500 -- (-980.384) [-977.798] (-976.916) (-975.902) * [-978.471] (-981.141) (-977.073) (-978.382) -- 0:00:56
97000 -- [-977.107] (-981.404) (-977.130) (-976.185) * (-978.966) [-978.004] (-976.779) (-978.224) -- 0:00:55
97500 -- [-976.839] (-981.808) (-976.571) (-977.708) * (-978.603) (-977.738) [-982.140] (-979.393) -- 0:00:55
98000 -- (-976.877) (-981.327) (-979.354) [-978.986] * [-976.708] (-980.997) (-982.222) (-977.365) -- 0:00:55
98500 -- (-979.006) (-983.315) (-978.252) [-979.223] * (-978.058) (-979.075) (-981.450) [-979.264] -- 0:00:54
99000 -- (-978.261) (-981.523) (-976.555) [-977.341] * (-978.066) [-976.956] (-978.217) (-983.331) -- 0:00:54
99500 -- [-977.222] (-976.615) (-976.630) (-978.249) * (-978.798) [-977.516] (-983.882) (-983.049) -- 0:00:54
100000 -- (-976.349) (-978.899) (-976.847) [-978.355] * [-976.989] (-977.612) (-978.108) (-982.027) -- 0:00:54
Average standard deviation of split frequencies: 0.024975
100500 -- [-976.769] (-978.635) (-977.123) (-979.030) * (-983.685) [-976.523] (-979.989) (-980.872) -- 0:00:53
101000 -- (-975.829) (-979.903) (-976.590) [-978.949] * (-977.603) (-976.999) (-979.836) [-980.112] -- 0:00:53
101500 -- (-977.868) [-977.865] (-976.576) (-981.812) * (-980.161) (-978.787) [-976.820] (-979.976) -- 0:00:53
102000 -- (-977.616) (-979.602) [-978.211] (-978.246) * (-979.999) [-977.938] (-978.526) (-976.371) -- 0:00:52
102500 -- [-978.744] (-979.315) (-976.416) (-979.851) * (-979.635) (-977.128) [-977.406] (-976.988) -- 0:00:52
103000 -- [-979.595] (-979.300) (-977.037) (-981.147) * (-978.102) [-979.250] (-979.334) (-977.688) -- 0:00:52
103500 -- (-978.397) [-977.232] (-977.052) (-978.774) * (-979.872) [-976.421] (-981.718) (-979.126) -- 0:00:51
104000 -- (-976.207) [-977.225] (-978.917) (-979.416) * (-977.618) [-976.549] (-979.126) (-980.873) -- 0:00:51
104500 -- (-979.480) (-976.553) [-977.784] (-978.012) * [-979.823] (-978.256) (-980.092) (-981.212) -- 0:00:51
105000 -- (-978.747) [-977.251] (-978.667) (-976.276) * (-976.798) [-977.671] (-977.268) (-981.064) -- 0:00:51
Average standard deviation of split frequencies: 0.024109
105500 -- (-980.235) (-979.653) [-976.483] (-979.142) * (-980.445) [-977.196] (-978.530) (-980.632) -- 0:00:50
106000 -- (-979.427) (-979.951) (-983.504) [-978.048] * (-976.861) [-979.381] (-978.890) (-977.252) -- 0:00:50
106500 -- (-976.858) (-977.678) (-976.115) [-976.138] * (-976.971) [-977.714] (-977.184) (-977.750) -- 0:00:50
107000 -- [-979.905] (-978.204) (-984.257) (-980.439) * (-977.799) (-980.671) (-977.091) [-978.461] -- 0:00:50
107500 -- (-984.379) (-979.343) [-978.835] (-978.523) * [-977.297] (-977.905) (-977.945) (-979.891) -- 0:00:49
108000 -- [-981.478] (-977.003) (-978.798) (-979.794) * (-976.479) [-979.952] (-977.959) (-976.745) -- 0:00:49
108500 -- (-986.879) [-979.324] (-977.588) (-982.489) * [-977.238] (-981.867) (-978.583) (-976.838) -- 0:00:57
109000 -- [-979.044] (-978.150) (-979.777) (-979.336) * (-977.855) (-979.818) [-979.228] (-977.717) -- 0:00:57
109500 -- (-978.106) [-976.887] (-978.169) (-977.783) * [-977.730] (-980.719) (-978.131) (-987.535) -- 0:00:56
110000 -- [-976.304] (-980.154) (-979.455) (-977.121) * (-976.873) [-977.174] (-977.301) (-983.687) -- 0:00:56
Average standard deviation of split frequencies: 0.024661
110500 -- (-982.447) [-978.754] (-982.838) (-976.259) * [-977.906] (-976.735) (-976.571) (-976.948) -- 0:00:56
111000 -- [-977.885] (-981.044) (-978.334) (-977.581) * [-978.093] (-977.972) (-976.879) (-978.099) -- 0:00:56
111500 -- (-977.132) [-978.113] (-979.103) (-979.272) * (-979.039) [-976.816] (-978.413) (-979.344) -- 0:00:55
112000 -- (-977.240) (-978.048) (-977.345) [-978.052] * [-979.447] (-976.541) (-979.748) (-982.434) -- 0:00:55
112500 -- [-976.991] (-977.424) (-979.034) (-979.590) * (-977.356) (-979.213) [-982.808] (-979.101) -- 0:00:55
113000 -- (-981.171) [-977.760] (-983.227) (-978.348) * (-979.502) (-978.890) (-977.470) [-980.267] -- 0:00:54
113500 -- [-978.292] (-979.559) (-977.768) (-978.231) * (-977.481) (-981.385) [-976.759] (-978.145) -- 0:00:54
114000 -- (-982.917) (-978.764) [-981.569] (-980.477) * (-978.136) [-979.236] (-976.903) (-978.932) -- 0:00:54
114500 -- (-979.025) [-978.442] (-978.518) (-979.662) * (-976.809) [-979.003] (-979.166) (-980.354) -- 0:00:54
115000 -- (-978.234) (-979.855) [-977.758] (-982.184) * (-978.026) (-976.749) (-976.161) [-977.388] -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- [-977.181] (-980.294) (-978.053) (-981.322) * (-977.856) [-977.186] (-976.794) (-978.122) -- 0:00:53
116000 -- (-979.168) (-976.640) [-977.489] (-977.512) * (-979.853) (-978.908) (-977.229) [-979.623] -- 0:00:53
116500 -- (-978.509) (-978.182) [-977.496] (-977.024) * [-976.895] (-977.413) (-977.016) (-981.152) -- 0:00:53
117000 -- (-978.346) [-980.598] (-977.905) (-977.371) * (-976.951) (-977.114) [-977.402] (-978.663) -- 0:00:52
117500 -- [-976.667] (-977.515) (-980.351) (-976.741) * [-976.945] (-976.100) (-978.435) (-977.339) -- 0:00:52
118000 -- [-977.318] (-977.241) (-978.861) (-978.803) * (-977.037) [-975.901] (-979.026) (-979.145) -- 0:00:52
118500 -- [-981.099] (-977.661) (-980.509) (-978.039) * (-978.896) (-976.907) (-977.727) [-979.365] -- 0:00:52
119000 -- [-978.481] (-978.839) (-983.057) (-979.321) * (-976.741) (-977.168) [-978.513] (-977.379) -- 0:00:51
119500 -- [-978.008] (-979.489) (-982.594) (-978.312) * [-977.131] (-978.696) (-977.464) (-980.428) -- 0:00:51
120000 -- [-977.430] (-980.122) (-978.479) (-978.877) * (-978.638) [-977.711] (-981.248) (-982.051) -- 0:00:51
Average standard deviation of split frequencies: 0.024742
120500 -- (-977.156) (-978.165) [-979.824] (-980.885) * (-978.853) (-977.125) (-978.784) [-977.700] -- 0:00:51
121000 -- [-977.789] (-981.170) (-978.333) (-980.234) * [-978.487] (-976.578) (-977.034) (-978.510) -- 0:00:50
121500 -- (-980.099) (-978.750) (-977.952) [-978.988] * (-976.570) (-977.038) [-978.997] (-980.085) -- 0:00:50
122000 -- (-977.886) (-977.271) (-978.653) [-978.527] * (-977.678) (-976.425) (-979.165) [-981.139] -- 0:00:50
122500 -- (-977.059) [-977.932] (-981.254) (-979.258) * (-987.851) (-976.357) (-978.754) [-981.171] -- 0:00:50
123000 -- (-977.413) (-978.967) (-976.724) [-979.625] * (-982.970) (-976.357) [-978.983] (-981.375) -- 0:00:49
123500 -- [-977.176] (-978.682) (-977.981) (-976.969) * [-977.849] (-978.822) (-979.908) (-982.185) -- 0:00:49
124000 -- (-980.028) (-980.967) (-980.093) [-980.586] * (-978.647) [-980.506] (-979.009) (-983.059) -- 0:00:49
124500 -- (-981.353) (-977.900) (-978.918) [-980.550] * (-978.933) [-976.349] (-979.118) (-983.110) -- 0:00:56
125000 -- [-978.261] (-977.276) (-980.177) (-979.434) * (-982.057) (-977.663) [-977.321] (-980.316) -- 0:00:56
Average standard deviation of split frequencies: 0.025401
125500 -- (-977.640) (-982.726) [-977.069] (-979.977) * (-979.393) (-977.061) [-977.583] (-979.326) -- 0:00:55
126000 -- (-976.096) (-980.163) (-978.204) [-978.434] * (-976.970) (-978.350) (-977.661) [-981.476] -- 0:00:55
126500 -- (-976.427) (-978.015) [-977.496] (-980.891) * [-978.924] (-978.537) (-977.469) (-979.163) -- 0:00:55
127000 -- (-977.495) (-978.139) [-977.769] (-980.374) * [-977.697] (-977.142) (-976.116) (-979.115) -- 0:00:54
127500 -- (-979.353) [-976.465] (-981.268) (-977.939) * (-978.322) (-979.728) (-975.943) [-976.672] -- 0:00:54
128000 -- (-978.230) (-977.251) (-981.283) [-977.252] * (-979.246) (-978.413) [-977.755] (-976.811) -- 0:00:54
128500 -- [-978.621] (-978.280) (-977.695) (-977.311) * (-978.242) [-980.034] (-979.327) (-978.983) -- 0:00:54
129000 -- [-978.902] (-977.913) (-977.293) (-978.569) * (-978.417) (-979.630) (-980.826) [-976.834] -- 0:00:54
129500 -- (-976.944) (-978.461) [-978.428] (-978.136) * (-979.412) (-978.036) (-979.312) [-979.168] -- 0:00:53
130000 -- [-979.996] (-978.204) (-978.062) (-978.828) * (-980.056) (-981.672) (-981.020) [-978.095] -- 0:00:53
Average standard deviation of split frequencies: 0.026456
130500 -- (-980.368) (-978.496) (-979.109) [-981.722] * (-979.231) (-977.598) (-977.073) [-977.832] -- 0:00:53
131000 -- (-975.864) (-977.782) (-977.138) [-981.000] * (-980.341) [-976.746] (-979.296) (-978.967) -- 0:00:53
131500 -- (-979.947) (-978.414) [-976.157] (-983.697) * [-976.975] (-977.161) (-976.635) (-980.736) -- 0:00:52
132000 -- (-979.814) (-978.318) (-977.589) [-977.239] * [-977.250] (-976.573) (-976.810) (-977.536) -- 0:00:52
132500 -- (-976.651) (-980.260) (-976.815) [-978.329] * (-978.112) [-976.148] (-976.813) (-977.519) -- 0:00:52
133000 -- [-976.633] (-977.715) (-976.525) (-979.366) * (-979.150) (-977.559) [-976.811] (-978.185) -- 0:00:52
133500 -- (-979.464) [-977.093] (-979.492) (-978.061) * (-982.008) (-977.384) [-976.570] (-977.878) -- 0:00:51
134000 -- (-978.653) (-976.271) (-978.486) [-976.917] * (-977.638) (-976.738) (-977.999) [-978.645] -- 0:00:51
134500 -- (-977.367) (-976.192) [-978.473] (-979.159) * (-980.473) (-978.999) [-979.329] (-982.727) -- 0:00:51
135000 -- (-977.333) [-980.113] (-978.103) (-984.166) * (-979.785) [-976.932] (-977.099) (-982.143) -- 0:00:51
Average standard deviation of split frequencies: 0.025997
135500 -- (-977.152) [-978.495] (-979.069) (-986.209) * (-977.111) (-979.099) (-978.064) [-981.669] -- 0:00:51
136000 -- (-979.048) (-978.200) (-978.699) [-978.160] * (-979.872) [-975.907] (-978.132) (-976.366) -- 0:00:50
136500 -- (-976.125) (-978.043) (-977.824) [-976.861] * [-978.552] (-977.823) (-977.198) (-977.723) -- 0:00:50
137000 -- (-981.288) (-977.391) [-977.938] (-980.567) * (-977.720) (-983.448) (-977.238) [-977.866] -- 0:00:50
137500 -- [-981.182] (-976.786) (-977.796) (-979.418) * [-977.869] (-978.471) (-976.435) (-977.050) -- 0:00:50
138000 -- (-977.537) (-980.497) [-979.227] (-977.230) * (-977.537) (-981.047) [-978.590] (-978.523) -- 0:00:49
138500 -- [-977.041] (-979.345) (-977.414) (-977.430) * (-977.835) (-979.883) [-979.304] (-977.802) -- 0:00:49
139000 -- (-977.376) (-978.443) [-977.317] (-977.735) * [-979.727] (-981.050) (-977.790) (-977.558) -- 0:00:49
139500 -- (-979.849) (-979.452) (-981.149) [-979.229] * (-977.557) (-980.975) (-981.066) [-977.602] -- 0:00:49
140000 -- (-981.101) [-980.745] (-978.758) (-978.188) * (-978.626) [-978.009] (-981.188) (-981.893) -- 0:00:49
Average standard deviation of split frequencies: 0.025036
140500 -- [-984.864] (-979.853) (-978.435) (-978.360) * (-978.794) (-977.057) [-978.582] (-983.102) -- 0:00:55
141000 -- [-979.303] (-986.124) (-976.795) (-980.388) * [-980.512] (-976.606) (-985.322) (-979.815) -- 0:00:54
141500 -- (-978.271) (-980.087) [-979.077] (-977.116) * (-978.934) (-978.469) (-977.650) [-978.009] -- 0:00:54
142000 -- (-978.794) [-977.667] (-979.565) (-977.356) * (-977.893) (-979.048) [-978.433] (-978.350) -- 0:00:54
142500 -- (-976.887) (-977.243) (-979.122) [-976.571] * (-979.227) [-977.536] (-979.373) (-977.871) -- 0:00:54
143000 -- (-976.921) (-978.333) (-979.902) [-977.860] * [-981.224] (-981.330) (-981.674) (-978.988) -- 0:00:53
143500 -- (-978.306) (-979.131) [-978.055] (-977.498) * [-977.810] (-982.027) (-978.143) (-979.617) -- 0:00:53
144000 -- [-976.071] (-977.721) (-979.384) (-976.053) * [-976.965] (-980.824) (-979.039) (-977.910) -- 0:00:53
144500 -- [-977.754] (-980.826) (-980.340) (-980.999) * (-978.302) (-979.550) (-979.988) [-979.540] -- 0:00:53
145000 -- (-977.341) (-977.823) [-980.152] (-980.020) * (-978.885) (-977.945) (-981.193) [-977.945] -- 0:00:53
Average standard deviation of split frequencies: 0.024754
145500 -- (-976.878) (-979.430) [-981.374] (-976.916) * [-977.571] (-978.921) (-978.417) (-979.149) -- 0:00:52
146000 -- (-977.750) [-979.169] (-977.471) (-978.015) * (-977.196) [-978.641] (-979.405) (-978.310) -- 0:00:52
146500 -- (-976.982) (-978.838) (-977.130) [-976.914] * (-979.858) (-978.631) (-977.021) [-978.651] -- 0:00:52
147000 -- (-978.091) (-978.003) [-976.353] (-976.852) * (-981.755) [-979.579] (-977.373) (-980.957) -- 0:00:52
147500 -- [-981.295] (-977.821) (-977.200) (-976.138) * [-976.190] (-976.854) (-975.995) (-980.243) -- 0:00:52
148000 -- (-978.892) (-979.157) [-977.329] (-978.106) * [-976.542] (-979.389) (-975.982) (-981.773) -- 0:00:51
148500 -- (-977.891) (-980.826) (-979.674) [-977.691] * (-978.674) [-978.880] (-976.786) (-978.320) -- 0:00:51
149000 -- [-980.047] (-979.935) (-980.529) (-979.344) * (-978.368) (-977.600) (-979.402) [-979.744] -- 0:00:51
149500 -- (-979.797) [-976.964] (-980.791) (-978.782) * (-977.385) [-977.661] (-981.573) (-981.323) -- 0:00:51
150000 -- (-978.012) (-976.679) (-982.800) [-977.686] * [-976.104] (-978.676) (-983.606) (-983.067) -- 0:00:51
Average standard deviation of split frequencies: 0.024536
150500 -- [-980.513] (-976.259) (-983.075) (-978.595) * (-978.557) (-976.999) (-980.123) [-978.163] -- 0:00:50
151000 -- (-975.924) [-976.942] (-979.139) (-977.859) * (-978.449) [-976.750] (-977.149) (-979.278) -- 0:00:50
151500 -- (-976.180) [-979.659] (-979.180) (-978.141) * (-979.795) (-979.206) [-978.166] (-978.469) -- 0:00:50
152000 -- (-976.977) [-980.539] (-984.206) (-977.862) * (-985.528) [-976.614] (-978.326) (-976.553) -- 0:00:50
152500 -- (-977.655) [-978.235] (-978.381) (-978.891) * (-979.195) (-980.133) (-980.753) [-976.358] -- 0:00:50
153000 -- (-979.302) [-975.793] (-977.400) (-978.843) * (-979.161) [-976.414] (-978.411) (-976.846) -- 0:00:49
153500 -- (-978.252) (-977.419) [-977.442] (-977.244) * (-980.324) (-978.166) [-977.613] (-978.773) -- 0:00:49
154000 -- (-976.630) (-977.726) [-976.511] (-976.648) * (-977.958) (-976.006) [-976.370] (-982.841) -- 0:00:49
154500 -- (-976.130) [-977.232] (-977.240) (-980.575) * (-978.010) [-978.536] (-977.106) (-978.081) -- 0:00:49
155000 -- (-977.832) (-976.902) [-983.020] (-977.451) * (-980.769) [-976.710] (-980.011) (-977.553) -- 0:00:49
Average standard deviation of split frequencies: 0.022743
155500 -- (-976.277) (-981.813) (-978.707) [-978.215] * (-977.914) (-979.281) [-979.029] (-978.547) -- 0:00:48
156000 -- (-979.207) (-977.027) [-978.731] (-981.059) * (-977.021) (-976.391) (-979.768) [-979.426] -- 0:00:48
156500 -- [-980.951] (-978.549) (-978.494) (-977.797) * (-976.534) [-982.542] (-982.913) (-977.330) -- 0:00:53
157000 -- [-980.877] (-979.765) (-980.384) (-977.067) * (-976.037) (-976.605) [-976.662] (-979.275) -- 0:00:53
157500 -- (-978.693) (-977.102) (-980.347) [-976.068] * (-976.918) [-978.037] (-981.806) (-978.424) -- 0:00:53
158000 -- [-977.821] (-978.248) (-980.263) (-979.060) * (-976.887) [-978.625] (-977.644) (-981.219) -- 0:00:53
158500 -- (-980.123) (-978.358) (-979.175) [-977.798] * [-977.671] (-976.761) (-976.966) (-982.877) -- 0:00:53
159000 -- (-978.473) [-977.849] (-981.887) (-977.312) * (-978.008) (-976.955) [-978.520] (-982.397) -- 0:00:52
159500 -- (-979.382) (-983.507) [-976.624] (-978.661) * (-977.984) (-979.484) (-978.277) [-982.679] -- 0:00:52
160000 -- [-980.430] (-977.456) (-978.434) (-976.083) * (-976.688) (-982.232) [-977.286] (-981.619) -- 0:00:52
Average standard deviation of split frequencies: 0.022739
160500 -- [-977.871] (-980.205) (-979.311) (-976.145) * (-979.567) (-978.034) (-979.982) [-978.051] -- 0:00:52
161000 -- [-979.161] (-979.794) (-979.067) (-976.326) * (-979.571) (-977.258) (-977.523) [-978.323] -- 0:00:52
161500 -- (-977.580) [-976.496] (-976.838) (-976.249) * (-977.835) [-976.809] (-977.523) (-981.023) -- 0:00:51
162000 -- [-977.951] (-980.685) (-976.242) (-978.876) * [-978.121] (-978.371) (-978.376) (-981.863) -- 0:00:51
162500 -- (-980.693) (-981.476) [-977.501] (-979.694) * (-976.572) (-981.008) [-976.982] (-980.600) -- 0:00:51
163000 -- (-984.528) [-978.022] (-976.606) (-977.009) * [-978.083] (-978.925) (-977.721) (-979.867) -- 0:00:51
163500 -- [-977.375] (-977.336) (-977.346) (-980.265) * [-978.754] (-978.089) (-977.481) (-976.781) -- 0:00:51
164000 -- (-977.568) [-978.871] (-977.160) (-981.648) * (-978.013) (-977.035) [-976.508] (-980.451) -- 0:00:50
164500 -- (-988.233) (-978.349) (-977.947) [-981.001] * (-976.933) (-977.383) [-976.189] (-978.078) -- 0:00:50
165000 -- (-976.802) [-982.331] (-978.072) (-977.633) * (-979.878) (-980.586) [-976.507] (-976.552) -- 0:00:50
Average standard deviation of split frequencies: 0.022313
165500 -- (-982.230) [-980.183] (-977.805) (-977.977) * [-981.067] (-979.127) (-978.174) (-979.346) -- 0:00:50
166000 -- [-980.071] (-980.191) (-977.846) (-977.496) * (-983.137) (-977.302) [-977.710] (-979.145) -- 0:00:50
166500 -- (-979.167) (-981.176) [-979.398] (-976.819) * (-980.337) [-977.226] (-979.090) (-976.963) -- 0:00:50
167000 -- [-979.167] (-978.599) (-978.248) (-976.305) * (-980.977) (-979.369) (-978.564) [-978.928] -- 0:00:49
167500 -- (-981.623) (-978.306) [-976.383] (-977.456) * [-981.400] (-981.313) (-978.392) (-983.061) -- 0:00:49
168000 -- (-980.634) (-980.682) (-977.784) [-978.874] * (-976.723) [-977.430] (-977.720) (-982.229) -- 0:00:49
168500 -- (-982.303) (-978.205) [-976.264] (-976.828) * [-978.682] (-979.082) (-978.262) (-977.162) -- 0:00:49
169000 -- (-981.412) [-977.961] (-976.829) (-976.676) * (-980.863) (-979.711) (-980.787) [-977.702] -- 0:00:49
169500 -- (-977.419) [-976.960] (-976.967) (-977.244) * (-978.472) (-977.889) (-979.924) [-977.078] -- 0:00:48
170000 -- (-977.001) (-977.878) (-978.367) [-979.010] * [-978.930] (-976.681) (-981.889) (-977.108) -- 0:00:48
Average standard deviation of split frequencies: 0.022755
170500 -- (-980.466) [-976.112] (-979.271) (-976.704) * (-978.520) (-978.749) (-978.817) [-977.229] -- 0:00:48
171000 -- (-979.972) (-978.801) [-980.553] (-978.134) * (-977.705) (-978.803) (-978.897) [-979.146] -- 0:00:48
171500 -- (-978.149) (-977.387) [-977.682] (-978.446) * (-979.725) (-981.379) (-979.869) [-979.219] -- 0:00:48
172000 -- [-978.944] (-979.758) (-981.004) (-976.313) * (-979.847) (-976.936) (-978.444) [-976.047] -- 0:00:52
172500 -- (-976.627) [-978.638] (-979.093) (-976.867) * (-983.570) (-976.898) (-977.946) [-977.138] -- 0:00:52
173000 -- (-976.720) (-980.367) (-977.981) [-976.563] * (-978.967) (-985.910) [-976.805] (-976.516) -- 0:00:52
173500 -- (-977.043) (-978.062) (-976.612) [-980.150] * (-976.741) (-981.316) (-976.534) [-978.641] -- 0:00:52
174000 -- (-977.960) (-978.179) (-977.645) [-978.573] * (-978.984) (-981.787) [-977.476] (-977.960) -- 0:00:52
174500 -- [-976.824] (-977.873) (-977.023) (-977.710) * (-977.973) (-977.416) (-977.924) [-977.613] -- 0:00:52
175000 -- (-977.474) (-977.096) (-976.644) [-977.760] * (-979.971) (-978.335) (-978.075) [-978.394] -- 0:00:51
Average standard deviation of split frequencies: 0.024701
175500 -- (-978.909) [-978.606] (-977.479) (-977.546) * [-981.532] (-979.730) (-977.312) (-978.921) -- 0:00:51
176000 -- [-977.910] (-979.470) (-978.608) (-978.311) * (-983.222) (-980.909) (-977.542) [-976.476] -- 0:00:51
176500 -- [-977.834] (-976.989) (-977.527) (-976.744) * (-979.313) (-978.193) [-977.638] (-978.907) -- 0:00:51
177000 -- [-978.909] (-978.502) (-978.067) (-976.444) * (-976.561) (-977.819) [-976.741] (-977.010) -- 0:00:51
177500 -- (-977.575) (-979.311) (-977.145) [-977.472] * (-977.685) (-978.148) [-979.931] (-977.526) -- 0:00:50
178000 -- (-976.632) [-977.920] (-977.962) (-976.802) * (-986.488) (-977.053) (-978.198) [-977.939] -- 0:00:50
178500 -- (-976.875) (-977.411) (-977.546) [-975.966] * (-979.928) (-975.919) (-980.317) [-977.059] -- 0:00:50
179000 -- (-977.727) (-976.918) [-978.296] (-977.143) * [-977.393] (-976.733) (-979.643) (-977.890) -- 0:00:50
179500 -- (-978.643) (-977.639) (-977.863) [-977.352] * (-977.641) [-977.395] (-976.860) (-978.628) -- 0:00:50
180000 -- (-977.710) (-977.672) [-976.046] (-975.990) * (-979.143) (-977.563) [-976.749] (-979.541) -- 0:00:50
Average standard deviation of split frequencies: 0.024643
180500 -- (-979.616) (-982.760) [-978.731] (-980.856) * (-978.319) (-978.691) [-976.530] (-976.960) -- 0:00:49
181000 -- (-976.867) (-978.538) (-977.372) [-982.029] * (-981.781) [-977.953] (-977.714) (-976.646) -- 0:00:49
181500 -- [-978.726] (-978.779) (-979.604) (-978.373) * (-975.998) (-979.692) (-977.978) [-976.937] -- 0:00:49
182000 -- [-979.921] (-976.876) (-980.200) (-977.190) * (-976.396) [-977.816] (-976.045) (-980.463) -- 0:00:49
182500 -- (-981.708) (-978.811) (-981.477) [-977.952] * (-978.781) [-977.255] (-976.432) (-978.402) -- 0:00:49
183000 -- (-982.766) [-978.080] (-979.236) (-976.697) * (-978.794) (-976.961) (-977.462) [-976.888] -- 0:00:49
183500 -- (-980.407) (-976.925) (-980.113) [-977.835] * (-977.719) (-976.167) [-976.005] (-977.618) -- 0:00:48
184000 -- (-981.954) (-978.913) (-980.960) [-978.054] * (-977.153) [-978.110] (-977.182) (-979.767) -- 0:00:48
184500 -- [-979.615] (-977.894) (-978.703) (-980.433) * (-976.526) (-981.796) (-979.460) [-978.447] -- 0:00:48
185000 -- (-977.325) (-981.802) (-976.562) [-979.127] * (-976.148) (-981.302) (-980.789) [-977.917] -- 0:00:48
Average standard deviation of split frequencies: 0.025626
185500 -- (-979.349) (-980.334) [-976.731] (-980.347) * [-978.175] (-980.508) (-979.736) (-978.831) -- 0:00:48
186000 -- (-977.324) (-977.564) [-980.416] (-978.446) * (-980.472) (-977.388) (-978.875) [-977.863] -- 0:00:48
186500 -- (-978.660) (-978.678) (-977.970) [-979.335] * (-980.282) [-978.441] (-978.303) (-978.200) -- 0:00:47
187000 -- [-982.237] (-982.451) (-978.995) (-980.850) * (-979.324) (-977.239) (-977.890) [-977.392] -- 0:00:47
187500 -- (-979.162) (-979.522) (-979.141) [-978.017] * (-978.936) (-979.254) [-976.802] (-978.632) -- 0:00:47
188000 -- (-977.340) [-979.215] (-980.558) (-979.126) * (-978.484) (-979.648) [-976.596] (-977.426) -- 0:00:51
188500 -- (-977.098) (-977.758) [-978.058] (-980.115) * (-977.246) (-978.371) [-975.952] (-977.291) -- 0:00:51
189000 -- [-976.104] (-978.546) (-977.562) (-976.855) * (-977.181) (-977.113) [-976.254] (-978.965) -- 0:00:51
189500 -- (-979.279) [-978.383] (-977.606) (-976.806) * [-976.141] (-976.554) (-977.377) (-982.750) -- 0:00:51
190000 -- (-978.893) [-983.065] (-979.004) (-977.028) * [-976.178] (-977.571) (-976.946) (-978.493) -- 0:00:51
Average standard deviation of split frequencies: 0.024037
190500 -- [-976.737] (-981.763) (-979.031) (-978.938) * (-981.534) [-978.024] (-977.483) (-977.406) -- 0:00:50
191000 -- (-978.164) (-977.180) [-976.769] (-979.457) * (-977.315) (-979.174) [-979.373] (-977.700) -- 0:00:50
191500 -- (-978.711) (-976.696) [-977.953] (-977.543) * [-976.755] (-978.051) (-976.857) (-978.464) -- 0:00:50
192000 -- (-980.786) [-976.936] (-977.953) (-978.695) * (-978.489) (-980.051) (-977.694) [-981.935] -- 0:00:50
192500 -- (-977.411) (-977.178) (-977.933) [-977.209] * (-978.164) [-979.128] (-977.505) (-977.522) -- 0:00:50
193000 -- (-986.509) (-976.936) [-981.525] (-979.989) * (-979.484) (-978.296) (-977.150) [-977.305] -- 0:00:50
193500 -- (-985.541) [-977.452] (-977.648) (-976.844) * [-976.790] (-980.289) (-983.372) (-978.269) -- 0:00:50
194000 -- (-981.584) [-977.411] (-977.356) (-977.627) * [-980.290] (-981.142) (-981.334) (-976.941) -- 0:00:49
194500 -- (-976.762) (-978.294) (-978.114) [-978.316] * (-977.833) [-980.586] (-982.196) (-976.325) -- 0:00:49
195000 -- [-978.319] (-977.983) (-978.880) (-976.822) * (-978.415) (-981.080) [-978.341] (-977.342) -- 0:00:49
Average standard deviation of split frequencies: 0.020254
195500 -- (-976.743) (-977.410) [-978.653] (-976.922) * (-978.140) (-979.390) [-977.764] (-980.549) -- 0:00:49
196000 -- (-977.189) (-976.264) (-976.798) [-977.668] * (-980.876) [-977.341] (-980.136) (-978.846) -- 0:00:49
196500 -- [-977.055] (-976.140) (-979.150) (-981.627) * [-976.155] (-981.549) (-979.280) (-979.738) -- 0:00:49
197000 -- (-978.959) (-979.609) (-980.639) [-980.466] * [-977.624] (-980.364) (-976.071) (-980.555) -- 0:00:48
197500 -- [-979.218] (-978.645) (-978.918) (-979.964) * (-976.948) [-976.959] (-977.465) (-979.839) -- 0:00:48
198000 -- (-977.761) (-976.917) [-977.524] (-977.785) * (-977.474) [-976.246] (-978.367) (-978.000) -- 0:00:48
198500 -- [-977.488] (-979.722) (-977.658) (-977.425) * [-976.916] (-978.259) (-984.006) (-977.677) -- 0:00:48
199000 -- [-976.227] (-976.764) (-977.641) (-977.881) * (-976.373) [-978.289] (-981.848) (-979.160) -- 0:00:48
199500 -- (-975.857) (-982.155) [-977.561] (-977.420) * [-978.746] (-978.896) (-979.176) (-977.228) -- 0:00:48
200000 -- (-978.814) (-977.036) (-976.868) [-979.027] * [-977.012] (-977.481) (-977.804) (-976.283) -- 0:00:48
Average standard deviation of split frequencies: 0.022056
200500 -- [-981.057] (-978.309) (-976.410) (-981.748) * [-977.156] (-977.646) (-978.263) (-983.355) -- 0:00:47
201000 -- (-983.827) (-978.799) [-979.669] (-978.999) * (-977.972) [-977.171] (-978.079) (-978.676) -- 0:00:47
201500 -- (-985.175) (-977.888) [-980.887] (-979.702) * (-978.984) [-977.266] (-979.797) (-980.399) -- 0:00:47
202000 -- (-977.486) [-976.822] (-978.185) (-979.803) * [-978.080] (-978.376) (-977.719) (-985.155) -- 0:00:47
202500 -- [-976.663] (-977.907) (-977.806) (-976.650) * (-976.876) [-979.341] (-977.249) (-977.520) -- 0:00:47
203000 -- (-979.124) (-978.714) [-979.386] (-975.874) * [-976.829] (-978.623) (-977.388) (-977.467) -- 0:00:47
203500 -- (-982.131) (-976.957) (-978.942) [-977.257] * [-979.261] (-977.386) (-977.753) (-977.531) -- 0:00:46
204000 -- (-984.308) [-978.981] (-979.342) (-978.014) * (-979.599) (-978.303) [-980.933] (-976.675) -- 0:00:50
204500 -- (-977.117) (-981.351) (-980.816) [-980.591] * (-977.660) (-979.171) (-976.926) [-976.154] -- 0:00:50
205000 -- (-977.792) (-977.478) [-977.379] (-976.977) * (-976.922) (-978.901) [-976.048] (-976.155) -- 0:00:50
Average standard deviation of split frequencies: 0.022248
205500 -- [-976.756] (-977.330) (-977.636) (-978.597) * (-976.649) (-979.984) (-978.166) [-977.683] -- 0:00:50
206000 -- (-979.867) [-979.507] (-980.843) (-977.031) * (-976.909) (-979.837) [-977.388] (-981.655) -- 0:00:50
206500 -- (-979.688) (-978.037) (-977.262) [-980.936] * (-977.523) (-980.620) [-977.257] (-983.297) -- 0:00:49
207000 -- (-976.876) (-978.743) (-978.252) [-976.793] * (-978.269) (-978.048) [-977.141] (-980.560) -- 0:00:49
207500 -- [-976.981] (-980.149) (-978.563) (-980.330) * (-979.145) [-977.258] (-976.860) (-976.720) -- 0:00:49
208000 -- (-977.005) [-978.929] (-980.856) (-980.065) * (-976.980) (-979.780) (-981.003) [-979.899] -- 0:00:49
208500 -- [-978.012] (-980.109) (-979.781) (-980.328) * (-977.105) (-976.055) [-977.141] (-981.394) -- 0:00:49
209000 -- (-980.428) (-977.918) (-977.603) [-979.684] * (-979.674) [-976.545] (-977.907) (-978.045) -- 0:00:49
209500 -- (-987.933) (-979.880) [-977.621] (-977.680) * (-979.731) [-977.260] (-979.130) (-977.004) -- 0:00:49
210000 -- (-984.657) [-976.542] (-981.908) (-977.837) * [-977.393] (-978.051) (-981.135) (-978.084) -- 0:00:48
Average standard deviation of split frequencies: 0.019315
210500 -- (-983.396) [-978.137] (-979.614) (-978.257) * (-978.750) (-977.144) (-977.156) [-976.854] -- 0:00:48
211000 -- (-980.465) [-977.702] (-979.863) (-978.840) * (-978.748) [-976.461] (-977.421) (-977.299) -- 0:00:48
211500 -- [-977.636] (-976.518) (-980.957) (-978.631) * (-978.219) [-978.165] (-978.443) (-979.079) -- 0:00:48
212000 -- [-979.962] (-976.992) (-980.101) (-976.076) * (-978.537) (-981.166) (-978.750) [-976.437] -- 0:00:48
212500 -- (-979.477) (-977.331) (-981.156) [-975.930] * (-977.272) (-984.711) [-977.664] (-976.976) -- 0:00:48
213000 -- (-980.400) (-976.255) (-981.731) [-975.844] * (-979.311) (-977.862) [-978.142] (-980.690) -- 0:00:48
213500 -- (-979.751) [-976.796] (-975.964) (-980.885) * [-978.415] (-976.542) (-977.096) (-981.003) -- 0:00:47
214000 -- (-977.338) (-979.534) [-977.057] (-980.832) * (-979.835) (-976.478) [-979.677] (-983.824) -- 0:00:47
214500 -- (-977.858) [-978.201] (-978.465) (-977.456) * (-984.977) (-977.332) (-981.160) [-978.597] -- 0:00:47
215000 -- [-977.908] (-977.091) (-979.021) (-978.262) * (-980.015) (-977.265) (-979.630) [-976.099] -- 0:00:47
Average standard deviation of split frequencies: 0.019297
215500 -- (-984.559) [-977.619] (-982.979) (-976.591) * (-979.171) (-978.027) (-981.621) [-976.996] -- 0:00:47
216000 -- (-978.843) (-982.605) (-976.702) [-976.830] * (-980.695) (-978.244) (-980.927) [-977.929] -- 0:00:47
216500 -- [-983.720] (-980.535) (-981.403) (-978.395) * [-976.488] (-977.089) (-977.659) (-977.856) -- 0:00:47
217000 -- (-976.806) (-977.304) [-976.379] (-977.216) * [-977.055] (-980.666) (-977.338) (-981.917) -- 0:00:46
217500 -- (-977.407) (-977.910) (-978.494) [-976.932] * (-981.103) (-979.454) [-976.718] (-980.653) -- 0:00:46
218000 -- (-978.883) [-976.487] (-981.437) (-977.025) * [-977.892] (-977.679) (-977.520) (-978.646) -- 0:00:46
218500 -- [-978.744] (-977.969) (-979.133) (-976.263) * (-977.673) (-977.324) [-977.224] (-979.842) -- 0:00:46
219000 -- (-976.571) (-977.826) (-977.631) [-976.087] * [-977.168] (-976.807) (-976.901) (-980.102) -- 0:00:46
219500 -- (-976.168) (-977.166) (-976.810) [-976.290] * [-977.023] (-976.303) (-976.953) (-979.696) -- 0:00:46
220000 -- (-976.764) (-977.131) [-980.473] (-976.356) * (-979.035) (-979.437) (-977.467) [-979.107] -- 0:00:49
Average standard deviation of split frequencies: 0.019226
220500 -- (-976.866) (-977.598) [-977.647] (-978.167) * [-979.959] (-978.418) (-977.376) (-977.823) -- 0:00:49
221000 -- (-978.055) (-979.432) (-983.171) [-979.636] * [-976.495] (-976.780) (-979.744) (-978.358) -- 0:00:49
221500 -- (-976.666) (-983.490) (-980.027) [-980.649] * (-978.376) [-976.645] (-976.908) (-978.745) -- 0:00:49
222000 -- (-976.449) (-979.561) (-981.239) [-980.747] * (-976.695) (-977.241) [-977.536] (-976.870) -- 0:00:49
222500 -- [-977.446] (-980.724) (-982.772) (-976.504) * (-977.412) (-977.242) (-978.109) [-977.545] -- 0:00:48
223000 -- (-977.064) (-976.751) [-983.007] (-978.514) * (-980.883) (-979.321) [-981.736] (-978.414) -- 0:00:48
223500 -- (-976.687) (-977.667) (-980.783) [-976.066] * (-977.418) [-978.001] (-980.557) (-979.147) -- 0:00:48
224000 -- (-976.360) (-977.544) (-977.386) [-976.462] * [-976.848] (-977.246) (-981.590) (-977.874) -- 0:00:48
224500 -- (-976.729) (-977.544) (-977.254) [-976.462] * [-976.435] (-977.256) (-981.124) (-977.522) -- 0:00:48
225000 -- (-977.656) (-979.913) (-976.717) [-976.622] * (-979.759) (-979.096) (-981.074) [-977.531] -- 0:00:48
Average standard deviation of split frequencies: 0.018251
225500 -- (-977.504) (-977.406) [-976.653] (-978.394) * (-979.456) [-976.811] (-979.568) (-978.502) -- 0:00:48
226000 -- [-978.301] (-977.583) (-977.047) (-977.445) * (-977.997) (-976.906) (-978.222) [-977.794] -- 0:00:47
226500 -- (-977.192) [-977.519] (-978.334) (-978.756) * (-977.058) (-976.864) [-977.321] (-979.139) -- 0:00:47
227000 -- (-978.638) (-983.214) (-977.094) [-982.618] * (-976.901) (-976.716) [-978.302] (-976.800) -- 0:00:47
227500 -- [-977.013] (-977.906) (-977.609) (-977.905) * (-981.099) (-976.094) (-978.978) [-978.768] -- 0:00:47
228000 -- [-977.817] (-976.972) (-981.790) (-977.836) * (-978.284) [-976.470] (-977.494) (-980.238) -- 0:00:47
228500 -- [-977.005] (-976.926) (-976.794) (-977.756) * [-980.612] (-976.368) (-976.706) (-982.138) -- 0:00:47
229000 -- (-980.197) [-976.903] (-977.766) (-977.908) * [-977.932] (-978.081) (-976.108) (-980.918) -- 0:00:47
229500 -- [-978.178] (-981.788) (-977.946) (-981.320) * [-980.176] (-977.620) (-975.987) (-980.341) -- 0:00:47
230000 -- (-977.370) (-980.430) [-977.350] (-981.095) * (-975.886) [-978.653] (-976.712) (-982.157) -- 0:00:46
Average standard deviation of split frequencies: 0.018802
230500 -- (-979.084) (-976.751) [-977.814] (-978.497) * (-976.951) (-977.681) (-980.420) [-977.448] -- 0:00:46
231000 -- (-979.408) (-976.402) (-977.141) [-977.059] * (-983.575) (-976.989) (-977.160) [-977.369] -- 0:00:46
231500 -- (-977.676) (-977.037) [-977.538] (-977.617) * (-980.118) (-977.994) [-976.977] (-978.832) -- 0:00:46
232000 -- (-977.682) (-977.052) [-976.773] (-977.035) * [-977.885] (-978.534) (-976.159) (-978.199) -- 0:00:46
232500 -- (-980.498) [-977.261] (-984.616) (-976.951) * [-977.848] (-976.084) (-976.047) (-976.287) -- 0:00:46
233000 -- (-977.211) (-980.784) (-980.330) [-977.632] * (-979.118) (-976.393) (-976.935) [-981.866] -- 0:00:46
233500 -- [-976.862] (-977.128) (-976.724) (-982.676) * (-977.687) [-978.190] (-979.499) (-977.415) -- 0:00:45
234000 -- (-978.740) (-977.230) [-980.236] (-986.491) * (-979.563) (-982.432) (-979.038) [-977.145] -- 0:00:45
234500 -- [-976.246] (-981.029) (-977.616) (-978.294) * (-976.956) (-977.253) [-978.981] (-977.415) -- 0:00:45
235000 -- (-978.758) [-976.731] (-977.655) (-978.751) * [-976.139] (-976.433) (-976.887) (-978.262) -- 0:00:45
Average standard deviation of split frequencies: 0.018177
235500 -- (-981.937) [-977.439] (-977.557) (-977.367) * (-978.303) (-979.091) [-978.881] (-975.843) -- 0:00:45
236000 -- (-979.079) [-980.267] (-982.327) (-977.465) * (-977.680) [-976.509] (-980.323) (-977.781) -- 0:00:45
236500 -- (-980.736) (-978.166) (-984.635) [-977.381] * (-979.072) [-977.234] (-978.001) (-977.435) -- 0:00:48
237000 -- (-980.733) (-977.774) [-976.554] (-979.101) * (-979.369) (-976.020) [-977.075] (-978.049) -- 0:00:48
237500 -- [-977.745] (-978.408) (-976.700) (-978.334) * (-979.698) (-977.355) [-977.201] (-978.984) -- 0:00:48
238000 -- [-977.266] (-978.381) (-978.154) (-978.129) * (-976.894) (-977.046) [-980.141] (-979.034) -- 0:00:48
238500 -- (-977.612) (-981.187) [-978.420] (-976.706) * (-976.656) [-976.695] (-977.522) (-977.093) -- 0:00:47
239000 -- (-976.668) (-980.905) [-976.174] (-979.160) * (-981.803) (-978.398) (-980.310) [-978.364] -- 0:00:47
239500 -- (-976.346) [-976.946] (-976.897) (-977.711) * (-978.417) (-979.043) (-980.559) [-976.880] -- 0:00:47
240000 -- (-978.788) (-976.675) (-982.656) [-977.232] * (-979.580) (-977.223) (-977.583) [-977.132] -- 0:00:47
Average standard deviation of split frequencies: 0.019484
240500 -- (-981.125) [-976.994] (-980.565) (-977.316) * (-977.388) (-978.486) [-977.241] (-976.831) -- 0:00:47
241000 -- [-977.066] (-977.514) (-977.012) (-976.632) * (-981.553) (-977.708) [-978.514] (-981.336) -- 0:00:47
241500 -- (-979.167) (-979.403) [-979.149] (-976.940) * (-981.047) (-978.897) (-979.028) [-980.014] -- 0:00:47
242000 -- (-978.023) (-980.760) [-977.970] (-976.940) * (-981.121) (-977.167) [-977.310] (-979.396) -- 0:00:46
242500 -- (-977.222) (-979.319) (-979.499) [-978.360] * (-978.871) (-978.278) [-977.650] (-981.036) -- 0:00:46
243000 -- [-977.719] (-977.401) (-978.019) (-977.830) * (-985.574) (-977.139) (-977.248) [-978.861] -- 0:00:46
243500 -- [-979.257] (-976.762) (-979.764) (-980.646) * (-983.267) (-976.725) [-976.558] (-976.986) -- 0:00:46
244000 -- [-976.643] (-985.010) (-981.948) (-978.203) * (-980.830) [-977.493] (-977.704) (-976.136) -- 0:00:46
244500 -- (-976.563) [-985.653] (-980.494) (-978.234) * (-980.980) (-976.494) (-977.664) [-978.335] -- 0:00:46
245000 -- [-976.518] (-983.553) (-983.140) (-978.967) * [-986.776] (-977.025) (-977.510) (-976.317) -- 0:00:46
Average standard deviation of split frequencies: 0.019264
245500 -- (-976.587) (-977.932) [-978.035] (-979.732) * (-983.231) (-976.372) (-977.580) [-982.528] -- 0:00:46
246000 -- [-980.535] (-977.549) (-979.394) (-978.711) * (-978.046) [-976.346] (-977.611) (-979.022) -- 0:00:45
246500 -- (-975.925) (-978.023) [-977.596] (-977.751) * (-978.490) [-976.170] (-977.724) (-980.957) -- 0:00:45
247000 -- [-977.121] (-978.441) (-976.012) (-978.190) * [-976.433] (-976.547) (-977.213) (-980.004) -- 0:00:45
247500 -- [-976.748] (-979.594) (-976.904) (-976.741) * [-979.126] (-975.981) (-980.243) (-976.846) -- 0:00:45
248000 -- (-977.863) (-979.422) (-976.788) [-979.497] * (-977.393) [-979.317] (-978.345) (-976.738) -- 0:00:45
248500 -- (-977.296) (-978.337) (-978.389) [-978.600] * (-978.379) [-977.169] (-980.399) (-980.024) -- 0:00:45
249000 -- (-978.055) [-978.158] (-980.069) (-976.493) * (-978.284) (-980.165) [-980.880] (-978.243) -- 0:00:45
249500 -- [-978.171] (-978.157) (-981.590) (-979.257) * (-982.458) (-979.846) (-981.052) [-981.975] -- 0:00:45
250000 -- [-978.429] (-978.236) (-979.473) (-977.455) * (-977.739) (-980.696) (-977.078) [-980.902] -- 0:00:45
Average standard deviation of split frequencies: 0.019103
250500 -- [-982.380] (-978.377) (-978.642) (-977.400) * (-978.898) [-981.047] (-978.218) (-976.207) -- 0:00:44
251000 -- (-979.364) (-978.797) (-981.843) [-979.644] * (-980.154) (-986.231) (-977.279) [-976.795] -- 0:00:44
251500 -- [-976.583] (-977.578) (-979.447) (-978.537) * (-985.719) (-980.423) [-978.746] (-975.949) -- 0:00:44
252000 -- [-978.415] (-978.629) (-978.264) (-979.723) * (-982.174) [-980.763] (-977.368) (-975.919) -- 0:00:44
252500 -- (-977.512) [-981.505] (-977.481) (-976.860) * (-978.769) [-978.470] (-978.148) (-978.036) -- 0:00:47
253000 -- (-978.343) [-977.697] (-977.050) (-978.992) * (-979.254) [-977.264] (-977.874) (-980.912) -- 0:00:47
253500 -- (-981.255) (-976.545) [-978.500] (-979.867) * (-977.508) [-980.188] (-977.705) (-977.871) -- 0:00:47
254000 -- [-976.113] (-980.706) (-979.283) (-976.958) * [-976.635] (-976.943) (-981.120) (-979.292) -- 0:00:46
254500 -- (-976.613) [-978.161] (-978.289) (-977.506) * [-977.151] (-979.030) (-980.125) (-976.123) -- 0:00:46
255000 -- [-976.502] (-978.443) (-982.156) (-976.922) * (-976.290) (-976.785) (-979.657) [-977.593] -- 0:00:46
Average standard deviation of split frequencies: 0.019822
255500 -- (-978.949) [-979.561] (-979.205) (-977.207) * (-976.169) [-976.551] (-977.713) (-978.249) -- 0:00:46
256000 -- [-976.263] (-978.543) (-978.546) (-980.130) * [-977.907] (-977.337) (-980.375) (-978.178) -- 0:00:46
256500 -- (-977.742) (-978.641) [-977.722] (-979.112) * (-977.480) [-979.183] (-976.768) (-984.615) -- 0:00:46
257000 -- [-979.088] (-977.695) (-977.428) (-977.521) * (-976.501) (-980.945) (-977.982) [-979.498] -- 0:00:46
257500 -- [-977.709] (-976.906) (-976.652) (-978.202) * (-977.183) (-982.458) (-980.417) [-978.283] -- 0:00:46
258000 -- (-977.925) (-978.052) [-976.617] (-979.647) * [-978.461] (-982.464) (-976.969) (-978.229) -- 0:00:46
258500 -- [-976.796] (-977.852) (-977.156) (-977.859) * [-977.892] (-980.359) (-978.757) (-978.692) -- 0:00:45
259000 -- (-978.340) (-978.411) (-977.639) [-976.725] * (-978.576) (-983.315) (-980.025) [-976.912] -- 0:00:45
259500 -- [-977.184] (-978.258) (-976.266) (-979.472) * [-976.683] (-977.615) (-981.595) (-980.464) -- 0:00:45
260000 -- [-976.794] (-977.781) (-977.067) (-978.169) * [-976.792] (-978.501) (-987.209) (-977.924) -- 0:00:45
Average standard deviation of split frequencies: 0.021099
260500 -- (-979.446) (-977.194) [-979.003] (-977.880) * (-977.708) [-977.600] (-988.735) (-976.679) -- 0:00:45
261000 -- (-978.540) (-978.554) (-978.992) [-977.795] * (-981.076) [-976.854] (-984.720) (-977.913) -- 0:00:45
261500 -- [-978.665] (-977.690) (-976.797) (-982.178) * (-975.891) (-987.389) (-979.685) [-977.543] -- 0:00:45
262000 -- (-979.129) (-977.428) (-978.108) [-979.006] * (-978.591) (-982.259) (-979.673) [-977.637] -- 0:00:45
262500 -- (-979.088) (-977.435) [-977.523] (-984.460) * (-977.912) (-982.691) [-978.357] (-978.148) -- 0:00:44
263000 -- (-979.940) (-975.841) (-977.110) [-979.119] * (-984.802) (-979.004) (-978.010) [-979.120] -- 0:00:44
263500 -- (-978.747) (-979.180) (-976.765) [-978.029] * (-977.853) [-978.763] (-977.857) (-977.914) -- 0:00:44
264000 -- (-981.922) [-977.353] (-979.818) (-978.340) * (-975.994) [-978.474] (-977.054) (-979.277) -- 0:00:44
264500 -- (-979.985) [-980.337] (-978.890) (-978.765) * [-979.085] (-976.074) (-981.660) (-976.736) -- 0:00:44
265000 -- (-980.927) (-977.469) [-976.054] (-976.496) * (-979.412) (-978.972) [-977.087] (-978.247) -- 0:00:44
Average standard deviation of split frequencies: 0.021168
265500 -- (-982.919) (-976.479) [-979.514] (-977.250) * (-979.737) [-978.406] (-976.702) (-979.575) -- 0:00:44
266000 -- (-980.304) (-977.456) [-978.513] (-977.115) * (-978.808) [-977.936] (-978.111) (-980.148) -- 0:00:44
266500 -- [-978.259] (-977.913) (-978.521) (-980.040) * [-976.783] (-978.732) (-978.078) (-980.134) -- 0:00:44
267000 -- [-979.067] (-977.920) (-978.107) (-979.242) * (-976.526) (-977.254) (-978.736) [-979.367] -- 0:00:43
267500 -- (-979.298) [-980.395] (-988.303) (-979.738) * (-980.639) (-981.071) (-979.717) [-979.033] -- 0:00:43
268000 -- (-979.585) (-979.898) (-981.606) [-978.129] * [-983.181] (-977.555) (-979.835) (-978.892) -- 0:00:43
268500 -- (-981.112) [-976.835] (-980.140) (-977.344) * (-981.688) (-976.576) (-980.726) [-978.280] -- 0:00:43
269000 -- (-977.922) [-978.809] (-977.812) (-978.870) * (-980.749) (-977.635) (-978.410) [-979.295] -- 0:00:46
269500 -- (-977.008) (-976.363) (-977.146) [-976.915] * (-976.413) (-983.548) (-978.391) [-977.039] -- 0:00:46
270000 -- [-976.991] (-979.034) (-977.183) (-976.360) * (-976.836) (-979.320) [-978.031] (-977.413) -- 0:00:45
Average standard deviation of split frequencies: 0.021383
270500 -- (-977.184) (-976.475) (-976.948) [-977.702] * [-978.245] (-978.712) (-980.388) (-976.825) -- 0:00:45
271000 -- (-977.095) (-978.737) (-976.751) [-981.347] * (-981.263) (-978.442) (-977.958) [-976.308] -- 0:00:45
271500 -- [-979.488] (-979.645) (-977.183) (-979.670) * [-977.834] (-978.795) (-977.865) (-977.790) -- 0:00:45
272000 -- (-978.048) (-979.230) [-978.066] (-977.782) * (-977.789) (-976.897) (-977.578) [-978.122] -- 0:00:45
272500 -- (-978.393) [-975.954] (-979.699) (-979.625) * (-978.131) (-975.857) (-978.009) [-977.010] -- 0:00:45
273000 -- (-979.626) (-975.954) (-977.687) [-977.208] * (-976.327) [-976.401] (-977.321) (-977.201) -- 0:00:45
273500 -- [-978.096] (-976.769) (-981.399) (-979.967) * [-977.480] (-976.125) (-976.626) (-977.042) -- 0:00:45
274000 -- [-976.860] (-982.092) (-979.433) (-978.626) * (-977.474) [-977.033] (-976.123) (-977.152) -- 0:00:45
274500 -- [-976.122] (-976.956) (-978.059) (-977.941) * (-976.183) (-978.641) (-976.341) [-976.624] -- 0:00:44
275000 -- (-975.968) (-979.025) (-981.838) [-977.540] * (-977.335) (-979.226) (-978.067) [-976.620] -- 0:00:44
Average standard deviation of split frequencies: 0.020686
275500 -- [-975.905] (-981.754) (-977.453) (-977.945) * [-978.978] (-976.705) (-978.227) (-977.307) -- 0:00:44
276000 -- (-977.382) (-982.200) [-979.200] (-977.199) * [-977.705] (-976.344) (-979.899) (-978.614) -- 0:00:44
276500 -- [-977.559] (-978.034) (-979.739) (-980.304) * [-978.717] (-980.091) (-979.803) (-979.339) -- 0:00:44
277000 -- [-980.726] (-980.130) (-978.589) (-978.780) * (-977.931) (-982.232) [-980.093] (-978.595) -- 0:00:44
277500 -- (-980.726) [-978.001] (-977.945) (-978.980) * (-977.708) (-979.927) (-979.489) [-977.731] -- 0:00:44
278000 -- (-982.938) [-978.860] (-978.055) (-981.066) * (-979.602) [-980.131] (-976.778) (-982.856) -- 0:00:44
278500 -- (-977.421) (-976.916) (-977.116) [-976.433] * (-982.887) (-979.274) (-977.372) [-979.583] -- 0:00:44
279000 -- (-977.783) [-977.091] (-978.087) (-976.597) * (-979.874) (-979.752) [-977.558] (-979.702) -- 0:00:43
279500 -- [-977.608] (-978.824) (-979.451) (-977.961) * (-978.257) [-978.472] (-976.336) (-979.299) -- 0:00:43
280000 -- (-976.216) [-978.185] (-979.135) (-981.800) * (-979.449) (-979.733) (-976.334) [-976.609] -- 0:00:43
Average standard deviation of split frequencies: 0.019875
280500 -- [-976.925] (-977.817) (-980.880) (-981.188) * (-978.093) (-978.777) [-977.427] (-978.525) -- 0:00:43
281000 -- (-979.894) [-978.911] (-979.309) (-979.463) * (-976.575) (-980.951) [-978.810] (-978.012) -- 0:00:43
281500 -- (-980.127) (-977.492) (-976.952) [-976.366] * (-976.834) [-979.231] (-982.774) (-976.701) -- 0:00:43
282000 -- (-980.790) (-979.874) [-977.333] (-979.427) * (-984.507) (-979.477) [-977.678] (-977.959) -- 0:00:43
282500 -- [-976.565] (-979.372) (-980.424) (-977.021) * (-978.434) (-978.634) [-975.811] (-977.970) -- 0:00:43
283000 -- [-979.451] (-978.336) (-978.358) (-978.787) * (-976.779) [-976.385] (-977.334) (-980.012) -- 0:00:43
283500 -- (-978.317) (-979.573) (-977.369) [-979.601] * (-976.809) [-977.149] (-979.117) (-978.173) -- 0:00:42
284000 -- [-977.858] (-979.854) (-977.927) (-978.113) * (-977.172) [-978.126] (-978.128) (-976.508) -- 0:00:42
284500 -- (-977.299) (-978.929) (-983.301) [-977.557] * (-980.380) [-980.134] (-979.361) (-980.585) -- 0:00:42
285000 -- (-979.427) (-980.365) (-979.123) [-978.180] * (-977.641) (-979.588) (-977.374) [-976.603] -- 0:00:45
Average standard deviation of split frequencies: 0.018131
285500 -- (-980.197) (-978.313) (-980.506) [-979.266] * (-977.140) [-978.746] (-977.319) (-980.086) -- 0:00:45
286000 -- (-978.015) (-978.123) (-982.099) [-979.474] * (-985.007) (-980.668) [-976.831] (-978.745) -- 0:00:44
286500 -- [-976.722] (-979.269) (-978.088) (-977.881) * (-976.644) [-982.660] (-977.555) (-977.945) -- 0:00:44
287000 -- (-978.073) (-981.785) [-980.228] (-978.507) * (-977.447) [-978.117] (-979.354) (-976.236) -- 0:00:44
287500 -- (-978.670) [-976.691] (-977.639) (-978.078) * (-980.216) (-978.579) (-978.134) [-976.155] -- 0:00:44
288000 -- (-978.461) [-976.023] (-979.511) (-976.535) * (-981.594) (-978.009) (-977.455) [-977.873] -- 0:00:44
288500 -- (-978.388) (-977.869) (-977.303) [-977.401] * (-981.951) (-976.147) (-981.834) [-976.607] -- 0:00:44
289000 -- [-978.724] (-976.643) (-977.289) (-977.496) * (-978.644) (-980.532) [-976.357] (-976.954) -- 0:00:44
289500 -- (-976.584) [-977.768] (-978.219) (-980.574) * (-977.507) (-976.709) [-977.689] (-978.401) -- 0:00:44
290000 -- [-977.988] (-977.012) (-979.090) (-978.641) * (-981.212) (-977.052) [-978.317] (-978.059) -- 0:00:44
Average standard deviation of split frequencies: 0.019462
290500 -- (-982.612) [-976.863] (-979.160) (-977.040) * [-979.260] (-978.166) (-976.890) (-977.350) -- 0:00:43
291000 -- (-979.191) [-976.550] (-977.546) (-977.244) * (-981.998) [-977.194] (-977.245) (-979.626) -- 0:00:43
291500 -- (-977.817) [-976.717] (-977.088) (-977.221) * [-978.007] (-979.054) (-977.588) (-980.656) -- 0:00:43
292000 -- (-979.702) [-977.256] (-977.455) (-979.916) * (-977.892) [-977.466] (-978.258) (-978.072) -- 0:00:43
292500 -- (-980.607) [-977.189] (-978.628) (-982.223) * (-980.305) [-976.926] (-975.977) (-975.845) -- 0:00:43
293000 -- (-978.198) (-977.230) [-978.511] (-978.057) * (-980.011) [-977.675] (-976.376) (-978.168) -- 0:00:43
293500 -- (-978.768) [-977.422] (-980.521) (-977.297) * (-977.548) [-976.832] (-976.139) (-980.055) -- 0:00:43
294000 -- (-979.398) (-978.761) [-976.172] (-981.194) * (-977.475) [-977.340] (-978.020) (-977.229) -- 0:00:43
294500 -- (-986.934) (-977.570) [-976.788] (-979.758) * (-980.873) (-977.918) (-981.714) [-976.317] -- 0:00:43
295000 -- (-980.491) [-977.443] (-980.315) (-977.580) * (-978.325) (-977.032) (-979.238) [-976.351] -- 0:00:43
Average standard deviation of split frequencies: 0.018514
295500 -- (-979.219) [-979.020] (-976.834) (-978.672) * (-978.451) (-976.011) (-980.934) [-976.518] -- 0:00:42
296000 -- (-978.633) (-977.654) (-977.407) [-976.147] * (-977.377) (-976.481) (-981.592) [-978.549] -- 0:00:42
296500 -- [-979.885] (-978.244) (-978.204) (-976.266) * (-977.054) (-977.741) [-981.202] (-979.009) -- 0:00:42
297000 -- [-976.980] (-977.419) (-978.004) (-977.976) * (-980.466) [-977.866] (-978.996) (-978.794) -- 0:00:42
297500 -- (-978.129) (-980.301) [-978.376] (-978.845) * [-979.129] (-976.857) (-979.667) (-978.043) -- 0:00:42
298000 -- (-977.833) [-980.004] (-977.047) (-979.469) * (-981.380) [-977.036] (-978.727) (-976.623) -- 0:00:42
298500 -- (-979.601) [-979.226] (-977.384) (-979.153) * (-979.902) (-977.178) (-980.532) [-976.450] -- 0:00:42
299000 -- [-977.155] (-977.798) (-979.474) (-977.706) * (-979.833) (-977.545) [-977.428] (-976.865) -- 0:00:42
299500 -- (-978.236) [-977.152] (-977.645) (-978.735) * (-979.031) [-980.877] (-977.544) (-979.226) -- 0:00:42
300000 -- (-978.079) (-976.814) [-976.995] (-980.830) * (-977.956) (-977.825) [-976.401] (-979.397) -- 0:00:42
Average standard deviation of split frequencies: 0.017932
300500 -- (-976.576) (-976.353) [-977.760] (-978.285) * (-979.247) [-982.593] (-977.723) (-977.365) -- 0:00:41
301000 -- [-977.026] (-979.435) (-980.064) (-978.322) * [-978.122] (-979.674) (-976.842) (-983.200) -- 0:00:44
301500 -- (-978.833) (-977.197) (-985.058) [-979.243] * (-977.842) (-979.054) [-977.465] (-982.645) -- 0:00:44
302000 -- (-976.996) (-979.212) (-979.203) [-979.584] * (-980.275) (-977.255) (-978.764) [-979.979] -- 0:00:43
302500 -- (-977.615) (-978.482) (-978.942) [-977.714] * (-984.355) [-977.436] (-978.519) (-980.546) -- 0:00:43
303000 -- (-976.237) [-977.369] (-979.810) (-978.081) * (-980.124) (-976.979) (-977.505) [-976.095] -- 0:00:43
303500 -- [-977.643] (-980.726) (-977.579) (-976.672) * (-977.036) [-979.899] (-977.274) (-977.161) -- 0:00:43
304000 -- (-976.963) [-978.468] (-978.550) (-980.601) * (-977.418) (-978.290) [-978.548] (-977.193) -- 0:00:43
304500 -- [-980.726] (-977.381) (-979.123) (-977.456) * (-976.509) [-977.474] (-979.832) (-978.145) -- 0:00:43
305000 -- [-981.865] (-977.742) (-980.157) (-977.678) * (-980.992) [-976.396] (-979.776) (-977.171) -- 0:00:43
Average standard deviation of split frequencies: 0.017235
305500 -- [-979.881] (-977.154) (-980.784) (-977.250) * (-978.190) (-979.324) (-980.358) [-976.231] -- 0:00:43
306000 -- (-980.859) (-979.312) [-977.827] (-982.152) * [-978.247] (-978.268) (-979.411) (-976.887) -- 0:00:43
306500 -- [-977.931] (-977.827) (-980.383) (-979.304) * [-977.699] (-979.374) (-977.871) (-976.732) -- 0:00:42
307000 -- (-978.471) [-977.361] (-979.229) (-977.992) * [-981.136] (-979.499) (-977.108) (-982.946) -- 0:00:42
307500 -- [-977.814] (-979.053) (-978.840) (-978.135) * (-978.222) [-977.948] (-980.220) (-976.434) -- 0:00:42
308000 -- [-980.229] (-976.241) (-977.591) (-978.128) * (-977.438) (-980.108) [-978.831] (-977.258) -- 0:00:42
308500 -- (-979.661) (-977.012) [-978.780] (-975.886) * (-977.691) [-977.366] (-979.911) (-976.310) -- 0:00:42
309000 -- (-981.422) (-979.943) (-978.861) [-977.203] * (-977.250) (-978.248) [-978.876] (-976.606) -- 0:00:42
309500 -- [-977.584] (-978.636) (-987.496) (-976.454) * (-979.150) [-976.275] (-980.364) (-980.096) -- 0:00:42
310000 -- (-976.840) (-976.855) (-986.828) [-977.984] * (-978.050) (-976.506) (-978.458) [-977.187] -- 0:00:42
Average standard deviation of split frequencies: 0.017227
310500 -- [-980.452] (-979.434) (-981.202) (-976.615) * (-977.058) [-976.102] (-977.398) (-977.486) -- 0:00:42
311000 -- (-980.236) (-976.887) (-981.666) [-978.483] * (-976.302) [-977.790] (-977.733) (-978.309) -- 0:00:42
311500 -- (-977.163) (-976.246) (-979.092) [-981.137] * (-978.989) (-979.204) (-976.985) [-978.062] -- 0:00:41
312000 -- (-980.831) [-979.818] (-977.100) (-978.347) * (-978.675) [-976.541] (-978.096) (-981.931) -- 0:00:41
312500 -- (-979.282) [-977.095] (-977.100) (-979.164) * (-981.715) (-976.250) (-977.656) [-976.509] -- 0:00:41
313000 -- (-979.458) (-976.922) (-977.801) [-978.164] * (-980.451) (-977.339) [-977.362] (-978.384) -- 0:00:41
313500 -- [-977.711] (-981.123) (-977.885) (-983.484) * (-976.328) [-978.095] (-976.957) (-976.611) -- 0:00:41
314000 -- (-976.645) (-981.688) [-976.968] (-977.905) * (-977.845) [-979.394] (-982.146) (-977.113) -- 0:00:41
314500 -- (-979.021) (-977.283) (-976.667) [-977.219] * (-978.699) (-979.331) [-978.510] (-979.613) -- 0:00:41
315000 -- [-979.077] (-975.997) (-979.132) (-976.240) * (-979.734) (-979.322) (-978.449) [-980.065] -- 0:00:41
Average standard deviation of split frequencies: 0.016327
315500 -- (-977.407) (-976.193) [-976.284] (-976.666) * (-979.124) (-977.690) (-980.574) [-980.439] -- 0:00:41
316000 -- [-976.607] (-981.252) (-976.992) (-977.029) * [-977.980] (-980.722) (-976.793) (-982.707) -- 0:00:41
316500 -- [-976.467] (-978.429) (-976.498) (-978.227) * (-979.421) (-978.957) (-977.079) [-977.365] -- 0:00:41
317000 -- [-977.428] (-981.663) (-977.035) (-977.659) * (-978.727) [-976.879] (-976.292) (-979.071) -- 0:00:43
317500 -- [-976.911] (-980.889) (-980.730) (-977.519) * (-978.927) (-977.894) (-978.028) [-979.203] -- 0:00:42
318000 -- (-977.407) (-981.014) (-980.224) [-978.902] * (-981.444) (-976.748) [-978.521] (-979.076) -- 0:00:42
318500 -- [-976.934] (-976.733) (-979.624) (-978.312) * (-980.147) [-976.608] (-978.770) (-981.784) -- 0:00:42
319000 -- (-977.769) [-976.393] (-978.338) (-981.137) * (-982.064) (-979.177) [-979.769] (-980.693) -- 0:00:42
319500 -- [-976.484] (-976.381) (-979.451) (-981.755) * (-979.403) (-976.836) [-980.367] (-978.395) -- 0:00:42
320000 -- [-977.003] (-977.785) (-977.623) (-984.673) * [-979.050] (-977.442) (-978.830) (-980.017) -- 0:00:42
Average standard deviation of split frequencies: 0.015436
320500 -- (-977.168) [-978.375] (-977.874) (-981.575) * (-980.920) [-976.970] (-977.147) (-980.568) -- 0:00:42
321000 -- (-977.378) (-978.656) [-977.873] (-977.916) * (-976.563) (-979.042) [-978.982] (-980.025) -- 0:00:42
321500 -- (-977.631) (-977.463) (-977.553) [-976.806] * (-977.024) [-976.562] (-978.592) (-977.601) -- 0:00:42
322000 -- (-979.028) [-977.065] (-976.674) (-976.808) * (-976.680) (-976.741) (-980.583) [-980.014] -- 0:00:42
322500 -- [-980.898] (-977.046) (-976.563) (-976.185) * [-976.495] (-979.563) (-977.540) (-980.720) -- 0:00:42
323000 -- (-982.685) [-976.495] (-977.408) (-976.774) * (-977.576) (-983.457) [-976.034] (-977.669) -- 0:00:41
323500 -- (-976.571) (-976.479) (-977.306) [-977.845] * (-976.292) [-977.529] (-976.368) (-983.194) -- 0:00:41
324000 -- [-976.715] (-978.675) (-976.625) (-976.800) * (-979.570) (-976.352) (-977.265) [-978.625] -- 0:00:41
324500 -- (-976.742) (-978.260) [-976.401] (-978.799) * (-978.184) (-976.039) (-976.455) [-976.707] -- 0:00:41
325000 -- (-976.578) [-978.644] (-976.051) (-980.831) * (-979.029) [-978.628] (-978.155) (-976.513) -- 0:00:41
Average standard deviation of split frequencies: 0.014942
325500 -- (-981.731) [-977.233] (-976.103) (-977.073) * (-979.274) [-978.513] (-977.006) (-977.475) -- 0:00:41
326000 -- (-978.839) (-978.166) [-976.277] (-976.548) * (-976.363) (-977.637) (-977.384) [-977.001] -- 0:00:41
326500 -- (-979.925) [-976.406] (-976.324) (-977.852) * (-976.456) [-977.453] (-977.884) (-976.676) -- 0:00:41
327000 -- (-979.166) (-976.346) [-980.809] (-979.408) * (-978.254) [-980.341] (-978.889) (-981.096) -- 0:00:41
327500 -- (-979.322) [-976.570] (-978.513) (-978.282) * (-978.107) [-977.288] (-977.635) (-980.959) -- 0:00:41
328000 -- (-977.053) (-979.906) [-980.069] (-976.883) * (-980.860) (-980.219) [-978.946] (-977.164) -- 0:00:40
328500 -- (-976.362) (-977.212) [-978.312] (-976.511) * (-981.038) (-980.162) [-979.780] (-977.651) -- 0:00:40
329000 -- [-978.202] (-977.058) (-979.432) (-975.934) * (-981.040) [-976.827] (-976.501) (-979.366) -- 0:00:40
329500 -- [-976.694] (-979.600) (-978.904) (-981.391) * [-977.119] (-976.251) (-980.454) (-980.301) -- 0:00:40
330000 -- (-976.683) (-980.924) [-980.272] (-981.032) * (-977.254) (-979.979) (-977.763) [-979.258] -- 0:00:40
Average standard deviation of split frequencies: 0.013939
330500 -- (-977.463) (-978.447) [-978.313] (-980.039) * (-977.092) [-978.282] (-976.969) (-981.371) -- 0:00:40
331000 -- (-976.684) (-981.267) [-977.972] (-979.005) * [-980.001] (-978.790) (-978.071) (-977.549) -- 0:00:40
331500 -- (-977.589) (-979.407) (-977.281) [-977.053] * (-977.689) (-978.235) [-976.688] (-979.316) -- 0:00:40
332000 -- (-976.749) (-977.981) (-978.160) [-976.628] * (-977.603) (-978.279) [-976.773] (-979.689) -- 0:00:40
332500 -- (-977.851) (-979.084) (-981.428) [-977.115] * (-979.460) [-977.567] (-977.170) (-984.034) -- 0:00:40
333000 -- (-977.995) (-980.916) (-980.033) [-978.050] * (-979.705) [-976.826] (-978.189) (-978.201) -- 0:00:42
333500 -- (-980.800) (-978.347) [-978.988] (-981.719) * (-980.971) (-978.912) (-979.902) [-978.093] -- 0:00:41
334000 -- (-978.792) [-977.076] (-978.793) (-981.659) * (-977.664) (-979.330) (-977.174) [-979.450] -- 0:00:41
334500 -- (-987.292) (-979.563) [-978.992] (-977.863) * (-977.032) (-981.212) (-977.760) [-978.520] -- 0:00:41
335000 -- (-981.574) (-978.431) [-979.147] (-978.363) * [-977.179] (-982.752) (-979.463) (-978.834) -- 0:00:41
Average standard deviation of split frequencies: 0.014773
335500 -- (-976.658) [-978.286] (-982.178) (-977.415) * [-976.957] (-979.098) (-980.760) (-980.689) -- 0:00:41
336000 -- [-978.448] (-977.477) (-980.177) (-977.209) * (-978.805) (-978.958) (-978.234) [-980.908] -- 0:00:41
336500 -- (-978.972) [-980.344] (-979.512) (-979.546) * (-980.290) (-981.684) (-977.006) [-979.054] -- 0:00:41
337000 -- (-977.554) (-980.742) (-980.834) [-977.120] * (-979.868) [-979.877] (-979.057) (-976.968) -- 0:00:41
337500 -- [-976.097] (-980.289) (-977.086) (-976.897) * [-978.259] (-976.765) (-980.386) (-983.027) -- 0:00:41
338000 -- (-976.949) [-977.357] (-978.483) (-976.221) * (-977.505) [-979.162] (-978.940) (-978.082) -- 0:00:41
338500 -- (-977.172) (-977.613) [-979.291] (-982.010) * (-977.937) (-978.781) [-977.938] (-985.863) -- 0:00:41
339000 -- [-978.179] (-979.998) (-979.632) (-976.755) * (-977.242) (-980.667) (-979.031) [-979.021] -- 0:00:40
339500 -- [-976.868] (-979.440) (-977.629) (-977.554) * (-977.044) [-980.197] (-977.656) (-979.721) -- 0:00:40
340000 -- (-980.844) (-982.605) (-977.869) [-979.386] * (-976.606) (-980.575) [-979.670] (-978.793) -- 0:00:40
Average standard deviation of split frequencies: 0.016086
340500 -- (-977.551) (-979.677) [-980.961] (-977.633) * (-977.973) [-976.550] (-978.864) (-978.302) -- 0:00:40
341000 -- (-976.972) (-977.283) [-977.012] (-977.125) * (-977.082) [-977.766] (-976.411) (-979.724) -- 0:00:40
341500 -- (-980.981) (-978.314) [-976.960] (-979.813) * [-977.603] (-976.949) (-976.861) (-976.463) -- 0:00:40
342000 -- [-978.525] (-980.585) (-978.197) (-981.314) * [-977.956] (-977.806) (-979.538) (-976.999) -- 0:00:40
342500 -- (-978.175) (-978.367) [-978.644] (-980.223) * (-979.346) [-979.088] (-978.034) (-977.170) -- 0:00:40
343000 -- (-979.902) (-978.978) [-980.860] (-978.985) * (-981.136) [-977.092] (-977.298) (-983.016) -- 0:00:40
343500 -- (-978.037) (-977.511) (-979.899) [-978.422] * (-981.372) (-980.040) (-977.460) [-979.313] -- 0:00:40
344000 -- [-979.250] (-977.741) (-982.419) (-979.166) * (-980.430) (-980.187) (-976.884) [-976.967] -- 0:00:40
344500 -- [-979.638] (-977.682) (-976.205) (-977.349) * (-978.082) (-980.377) [-976.613] (-982.844) -- 0:00:39
345000 -- (-982.675) (-978.214) [-977.386] (-977.507) * (-978.900) (-979.814) [-978.184] (-979.076) -- 0:00:39
Average standard deviation of split frequencies: 0.014628
345500 -- (-977.613) (-978.778) [-977.191] (-978.037) * (-979.193) (-978.033) (-977.351) [-977.158] -- 0:00:39
346000 -- (-978.692) [-977.644] (-975.890) (-976.270) * (-977.044) (-978.358) (-977.897) [-978.903] -- 0:00:39
346500 -- (-977.823) [-977.029] (-977.819) (-976.231) * (-976.807) [-979.572] (-977.899) (-980.968) -- 0:00:39
347000 -- (-981.145) (-976.913) [-979.707] (-976.770) * [-977.913] (-977.038) (-977.251) (-978.496) -- 0:00:39
347500 -- [-978.853] (-976.098) (-980.116) (-978.675) * (-979.396) [-981.070] (-978.115) (-977.450) -- 0:00:39
348000 -- (-978.692) (-977.786) (-976.978) [-980.562] * (-978.235) (-978.833) (-979.820) [-977.899] -- 0:00:39
348500 -- (-979.359) [-977.785] (-981.029) (-979.880) * (-979.062) [-979.147] (-979.348) (-977.473) -- 0:00:39
349000 -- (-980.682) (-981.535) [-976.544] (-977.110) * [-982.833] (-978.348) (-978.471) (-982.001) -- 0:00:39
349500 -- (-981.503) (-976.750) (-977.245) [-979.717] * (-977.289) [-977.787] (-978.137) (-976.722) -- 0:00:40
350000 -- (-980.678) (-976.817) [-976.515] (-976.316) * (-977.637) [-976.303] (-976.945) (-978.346) -- 0:00:40
Average standard deviation of split frequencies: 0.015636
350500 -- (-984.243) (-976.662) [-978.694] (-977.103) * [-978.092] (-981.476) (-976.968) (-979.642) -- 0:00:40
351000 -- (-979.690) (-977.305) (-980.919) [-977.702] * [-978.492] (-979.670) (-976.693) (-978.996) -- 0:00:40
351500 -- (-978.665) [-978.773] (-977.541) (-977.976) * (-979.802) (-979.214) [-976.048] (-977.340) -- 0:00:40
352000 -- (-978.498) (-980.874) (-977.560) [-977.246] * (-977.941) (-983.561) [-979.376] (-978.126) -- 0:00:40
352500 -- (-977.397) (-980.564) (-976.382) [-977.090] * (-979.769) (-982.885) [-978.418] (-976.766) -- 0:00:40
353000 -- (-977.418) (-982.672) (-977.142) [-979.072] * (-976.736) [-978.211] (-977.043) (-983.322) -- 0:00:40
353500 -- (-976.410) (-976.726) [-976.122] (-981.525) * (-976.931) (-978.444) [-979.213] (-977.251) -- 0:00:40
354000 -- (-976.761) (-980.494) [-977.128] (-977.810) * (-976.507) (-978.419) (-981.097) [-978.369] -- 0:00:40
354500 -- (-977.409) (-979.047) [-981.272] (-977.670) * (-976.894) (-979.313) (-978.502) [-980.432] -- 0:00:40
355000 -- [-977.712] (-980.401) (-981.487) (-980.681) * (-981.060) (-979.896) (-980.062) [-978.064] -- 0:00:39
Average standard deviation of split frequencies: 0.016202
355500 -- (-982.184) [-980.261] (-979.009) (-978.872) * [-976.919] (-985.450) (-976.153) (-976.983) -- 0:00:39
356000 -- [-976.935] (-977.885) (-977.880) (-979.690) * (-982.038) (-980.117) [-977.738] (-977.250) -- 0:00:39
356500 -- [-979.144] (-978.033) (-977.640) (-984.212) * (-982.058) (-983.478) [-980.718] (-979.180) -- 0:00:39
357000 -- [-978.778] (-976.846) (-977.811) (-978.990) * (-979.153) [-981.446] (-977.096) (-978.079) -- 0:00:39
357500 -- (-979.049) (-976.801) (-980.184) [-979.531] * [-977.849] (-980.573) (-976.822) (-979.684) -- 0:00:39
358000 -- (-976.330) [-976.324] (-979.714) (-978.306) * (-977.616) (-984.337) [-976.570] (-978.832) -- 0:00:39
358500 -- (-976.876) (-978.139) [-977.948] (-978.718) * (-979.532) (-979.031) [-978.643] (-977.935) -- 0:00:39
359000 -- (-976.964) (-978.058) [-976.704] (-978.202) * (-978.087) [-978.816] (-977.494) (-978.273) -- 0:00:39
359500 -- (-977.446) [-977.823] (-979.073) (-978.203) * (-982.504) (-981.402) [-978.822] (-979.025) -- 0:00:39
360000 -- [-979.253] (-979.251) (-983.786) (-977.336) * (-976.473) (-978.186) [-976.453] (-977.239) -- 0:00:39
Average standard deviation of split frequencies: 0.014916
360500 -- [-982.606] (-978.302) (-979.312) (-981.301) * [-978.224] (-976.918) (-979.253) (-979.989) -- 0:00:39
361000 -- (-978.327) (-978.190) (-977.338) [-980.335] * (-977.484) [-977.193] (-976.824) (-976.321) -- 0:00:38
361500 -- (-977.496) (-978.073) (-978.586) [-976.995] * (-977.644) [-978.305] (-977.937) (-980.362) -- 0:00:38
362000 -- [-977.953] (-984.613) (-981.061) (-976.340) * [-979.085] (-976.940) (-976.910) (-982.465) -- 0:00:38
362500 -- (-977.530) (-979.440) [-977.947] (-976.380) * (-979.408) (-975.859) (-981.080) [-978.091] -- 0:00:38
363000 -- (-976.373) [-976.581] (-977.862) (-977.565) * [-979.682] (-980.348) (-978.366) (-978.141) -- 0:00:38
363500 -- (-976.974) [-976.714] (-980.642) (-987.180) * (-981.130) (-977.536) (-982.763) [-978.774] -- 0:00:38
364000 -- (-976.082) [-977.201] (-978.681) (-981.820) * (-981.013) (-977.172) (-976.942) [-978.850] -- 0:00:38
364500 -- (-977.696) [-978.481] (-976.343) (-977.321) * (-983.315) (-978.048) (-977.487) [-979.699] -- 0:00:38
365000 -- (-978.648) (-976.982) (-978.063) [-978.235] * (-979.345) (-977.917) [-978.699] (-977.474) -- 0:00:38
Average standard deviation of split frequencies: 0.014395
365500 -- (-977.432) (-979.835) [-980.107] (-976.657) * (-977.017) (-977.636) (-977.977) [-979.303] -- 0:00:39
366000 -- (-976.209) [-978.722] (-977.476) (-976.473) * (-976.430) (-977.373) (-976.482) [-980.100] -- 0:00:39
366500 -- (-978.048) (-978.666) [-977.975] (-981.119) * [-978.805] (-981.510) (-976.168) (-979.558) -- 0:00:39
367000 -- (-978.048) (-979.234) (-979.163) [-978.149] * [-979.084] (-978.395) (-976.168) (-979.933) -- 0:00:39
367500 -- [-977.941] (-979.958) (-979.632) (-980.740) * (-979.303) (-978.986) (-979.106) [-976.232] -- 0:00:39
368000 -- (-981.743) (-981.625) (-978.385) [-979.282] * (-977.741) (-977.042) (-977.601) [-983.900] -- 0:00:39
368500 -- (-981.896) [-981.093] (-977.797) (-979.312) * [-977.966] (-978.983) (-977.055) (-981.335) -- 0:00:39
369000 -- (-978.308) (-979.769) (-976.750) [-977.186] * (-976.292) (-983.150) [-979.442] (-979.275) -- 0:00:39
369500 -- [-977.976] (-980.699) (-977.344) (-979.794) * [-977.129] (-977.611) (-977.397) (-976.918) -- 0:00:39
370000 -- [-976.770] (-977.829) (-978.283) (-981.273) * (-979.487) (-979.377) (-980.148) [-976.993] -- 0:00:39
Average standard deviation of split frequencies: 0.013566
370500 -- [-977.009] (-976.862) (-978.336) (-978.136) * [-978.962] (-978.114) (-977.701) (-977.213) -- 0:00:39
371000 -- (-979.383) (-979.215) [-981.077] (-978.300) * (-977.387) (-977.524) [-981.168] (-976.945) -- 0:00:38
371500 -- (-976.631) (-979.088) (-980.965) [-979.158] * (-979.953) (-981.492) (-978.366) [-979.487] -- 0:00:38
372000 -- (-979.650) (-977.273) (-980.735) [-978.093] * (-979.749) (-983.966) (-979.977) [-977.773] -- 0:00:38
372500 -- [-977.162] (-976.393) (-979.347) (-976.841) * [-976.223] (-981.033) (-976.046) (-977.662) -- 0:00:38
373000 -- (-980.713) [-979.860] (-977.587) (-977.760) * (-976.708) (-980.074) (-978.038) [-976.678] -- 0:00:38
373500 -- (-978.466) (-983.429) (-982.779) [-977.643] * [-977.863] (-978.134) (-976.994) (-976.250) -- 0:00:38
374000 -- [-977.543] (-977.029) (-976.245) (-981.068) * (-976.490) [-977.246] (-977.416) (-976.289) -- 0:00:38
374500 -- [-978.634] (-978.172) (-977.737) (-980.638) * (-979.520) (-978.169) (-976.774) [-976.536] -- 0:00:38
375000 -- (-980.669) [-976.131] (-977.330) (-981.119) * (-977.420) (-976.281) [-976.559] (-977.409) -- 0:00:38
Average standard deviation of split frequencies: 0.014627
375500 -- [-981.505] (-976.426) (-980.161) (-980.797) * (-978.108) (-976.129) [-978.190] (-979.394) -- 0:00:38
376000 -- (-979.552) [-976.541] (-979.465) (-978.580) * [-977.568] (-977.412) (-982.605) (-978.534) -- 0:00:38
376500 -- (-978.419) (-976.620) [-977.802] (-977.341) * (-976.401) (-976.375) (-983.721) [-978.466] -- 0:00:38
377000 -- (-980.518) (-979.761) [-981.200] (-977.988) * (-978.591) [-977.628] (-978.183) (-978.677) -- 0:00:38
377500 -- (-979.277) (-979.531) (-979.812) [-976.628] * [-977.418] (-976.881) (-983.609) (-980.600) -- 0:00:37
378000 -- (-979.184) (-981.442) (-980.110) [-976.785] * (-977.926) (-982.686) [-977.211] (-979.144) -- 0:00:37
378500 -- [-979.294] (-982.724) (-982.856) (-976.387) * (-979.547) [-982.054] (-983.288) (-978.876) -- 0:00:37
379000 -- (-980.527) (-980.573) [-977.784] (-977.440) * (-978.020) (-980.047) (-979.078) [-978.976] -- 0:00:37
379500 -- [-980.856] (-979.343) (-976.989) (-979.646) * (-978.333) [-977.970] (-976.934) (-979.168) -- 0:00:37
380000 -- (-979.612) [-977.506] (-976.567) (-982.003) * (-978.627) (-977.213) [-978.916] (-977.237) -- 0:00:37
Average standard deviation of split frequencies: 0.014516
380500 -- (-978.554) (-979.182) [-976.324] (-979.808) * (-978.507) (-978.832) [-978.616] (-977.479) -- 0:00:37
381000 -- [-980.293] (-981.124) (-978.190) (-980.617) * (-980.173) [-977.739] (-981.946) (-980.202) -- 0:00:37
381500 -- [-977.251] (-976.914) (-976.668) (-978.919) * [-976.764] (-977.786) (-978.024) (-980.081) -- 0:00:38
382000 -- [-978.026] (-980.789) (-978.377) (-979.215) * (-979.540) [-978.634] (-980.354) (-977.711) -- 0:00:38
382500 -- [-977.411] (-977.470) (-977.321) (-977.560) * (-979.583) (-979.076) [-976.563] (-983.063) -- 0:00:38
383000 -- (-981.931) [-976.289] (-976.479) (-986.654) * (-978.224) (-979.747) [-976.589] (-982.139) -- 0:00:38
383500 -- (-985.226) (-976.901) (-977.032) [-979.186] * [-978.187] (-978.927) (-976.146) (-978.824) -- 0:00:38
384000 -- (-980.363) [-978.007] (-976.402) (-978.385) * [-979.372] (-978.141) (-980.323) (-978.061) -- 0:00:38
384500 -- (-978.720) (-977.270) [-976.856] (-978.279) * (-977.486) (-979.121) (-978.806) [-980.667] -- 0:00:38
385000 -- [-977.592] (-977.350) (-977.718) (-978.433) * (-977.173) (-979.453) (-979.242) [-977.221] -- 0:00:38
Average standard deviation of split frequencies: 0.014859
385500 -- [-978.007] (-976.781) (-979.274) (-979.018) * (-978.724) (-977.352) (-976.496) [-977.094] -- 0:00:38
386000 -- (-979.779) (-976.663) (-978.942) [-978.458] * (-981.022) (-977.094) [-977.206] (-978.264) -- 0:00:38
386500 -- (-980.200) (-977.240) (-980.514) [-978.215] * (-981.105) (-978.707) (-979.260) [-980.503] -- 0:00:38
387000 -- [-980.287] (-979.393) (-977.572) (-976.788) * [-976.927] (-981.091) (-978.542) (-979.488) -- 0:00:38
387500 -- (-985.604) [-977.849] (-976.847) (-977.759) * (-978.657) [-978.559] (-976.950) (-979.096) -- 0:00:37
388000 -- [-977.235] (-979.840) (-978.902) (-977.596) * [-978.837] (-980.334) (-977.832) (-977.114) -- 0:00:37
388500 -- (-976.672) (-979.201) (-980.109) [-981.000] * (-978.004) [-976.629] (-983.088) (-981.804) -- 0:00:37
389000 -- [-977.903] (-980.524) (-980.628) (-976.563) * (-980.462) (-978.740) [-977.363] (-977.683) -- 0:00:37
389500 -- [-979.314] (-983.776) (-977.946) (-979.985) * (-978.595) (-978.824) (-978.717) [-977.341] -- 0:00:37
390000 -- [-977.578] (-980.737) (-976.856) (-980.375) * (-977.049) [-977.834] (-977.913) (-982.528) -- 0:00:37
Average standard deviation of split frequencies: 0.013609
390500 -- (-978.430) (-977.448) (-978.206) [-979.076] * [-976.889] (-978.449) (-977.012) (-978.335) -- 0:00:37
391000 -- (-978.426) [-979.413] (-978.417) (-978.081) * (-977.673) (-980.717) (-977.600) [-978.749] -- 0:00:37
391500 -- (-979.990) (-978.948) (-981.348) [-978.948] * (-978.759) [-977.160] (-978.473) (-982.634) -- 0:00:37
392000 -- (-977.553) [-979.392] (-977.113) (-977.033) * (-978.244) (-979.267) (-981.578) [-977.467] -- 0:00:37
392500 -- [-980.850] (-978.265) (-979.131) (-978.779) * (-978.513) (-978.753) (-977.801) [-979.239] -- 0:00:37
393000 -- [-978.093] (-978.118) (-979.133) (-982.874) * [-980.454] (-980.533) (-979.968) (-977.616) -- 0:00:37
393500 -- [-982.209] (-980.377) (-978.750) (-976.985) * (-981.283) [-980.017] (-979.007) (-980.045) -- 0:00:36
394000 -- [-977.942] (-977.779) (-977.863) (-976.622) * (-977.332) [-977.021] (-976.942) (-982.339) -- 0:00:36
394500 -- (-982.018) (-976.953) [-979.215] (-978.400) * (-980.532) [-977.760] (-979.120) (-977.284) -- 0:00:36
395000 -- [-977.747] (-977.714) (-984.210) (-979.294) * (-981.568) (-977.719) (-979.628) [-977.285] -- 0:00:36
Average standard deviation of split frequencies: 0.014550
395500 -- (-980.626) (-979.640) (-981.043) [-977.214] * [-979.535] (-976.922) (-979.316) (-977.285) -- 0:00:36
396000 -- (-981.622) (-977.584) [-977.800] (-979.237) * (-981.605) [-976.841] (-980.172) (-977.562) -- 0:00:36
396500 -- (-983.397) (-978.747) [-976.627] (-978.745) * [-976.319] (-978.218) (-982.230) (-976.761) -- 0:00:36
397000 -- (-979.772) (-978.755) [-978.457] (-980.834) * (-980.824) [-981.139] (-979.434) (-980.442) -- 0:00:36
397500 -- (-977.498) (-980.253) (-977.952) [-978.294] * (-979.705) (-979.293) [-980.181] (-976.582) -- 0:00:37
398000 -- (-979.736) (-977.066) [-977.657] (-979.502) * (-979.586) [-976.541] (-981.579) (-981.100) -- 0:00:37
398500 -- (-980.499) (-977.315) (-977.632) [-977.625] * (-982.728) (-977.186) (-977.856) [-977.994] -- 0:00:37
399000 -- (-977.736) (-978.545) (-975.954) [-980.878] * (-979.742) (-984.948) (-976.555) [-976.932] -- 0:00:37
399500 -- (-976.499) (-978.166) (-977.992) [-980.713] * [-977.554] (-981.403) (-976.622) (-976.738) -- 0:00:37
400000 -- [-976.092] (-979.525) (-980.719) (-977.399) * [-977.493] (-979.829) (-980.743) (-978.103) -- 0:00:37
Average standard deviation of split frequencies: 0.014184
400500 -- (-977.405) (-976.830) [-976.689] (-976.300) * (-979.532) (-978.225) (-977.753) [-977.994] -- 0:00:37
401000 -- (-979.617) (-978.432) [-977.153] (-977.406) * [-978.821] (-979.421) (-976.723) (-977.888) -- 0:00:37
401500 -- (-979.384) (-979.872) [-977.991] (-978.468) * [-979.089] (-978.614) (-977.927) (-976.445) -- 0:00:37
402000 -- (-978.771) [-978.150] (-978.606) (-976.237) * (-975.789) (-977.382) [-978.275] (-978.651) -- 0:00:37
402500 -- (-978.990) (-980.059) (-978.208) [-976.267] * [-975.789] (-978.230) (-977.593) (-979.331) -- 0:00:37
403000 -- (-977.047) (-980.438) (-978.956) [-976.858] * (-983.230) [-978.627] (-979.883) (-977.042) -- 0:00:37
403500 -- [-981.663] (-978.792) (-981.492) (-982.586) * (-982.431) (-976.880) (-981.008) [-977.621] -- 0:00:36
404000 -- (-983.781) (-978.478) (-977.223) [-976.797] * (-981.022) (-977.150) (-979.498) [-979.616] -- 0:00:36
404500 -- (-984.135) (-979.452) (-977.972) [-976.904] * (-977.949) [-977.311] (-979.035) (-981.317) -- 0:00:36
405000 -- (-976.981) (-979.292) (-977.671) [-976.977] * (-977.555) (-976.916) (-978.659) [-979.818] -- 0:00:36
Average standard deviation of split frequencies: 0.015033
405500 -- (-976.776) (-981.261) [-978.973] (-978.905) * (-977.938) [-979.846] (-983.457) (-978.770) -- 0:00:36
406000 -- (-976.230) (-980.138) [-981.248] (-978.326) * [-977.400] (-976.281) (-978.939) (-978.707) -- 0:00:36
406500 -- (-977.185) [-977.170] (-979.323) (-977.163) * [-977.581] (-977.365) (-978.814) (-979.608) -- 0:00:36
407000 -- (-977.032) (-977.515) (-978.661) [-976.558] * (-977.677) [-976.471] (-976.075) (-978.326) -- 0:00:36
407500 -- [-978.872] (-976.865) (-979.074) (-977.570) * (-981.211) [-977.625] (-976.556) (-976.761) -- 0:00:36
408000 -- (-977.071) (-977.293) [-977.264] (-977.099) * [-977.695] (-978.449) (-979.472) (-976.339) -- 0:00:36
408500 -- (-977.311) (-977.286) (-977.264) [-976.433] * (-977.259) (-982.726) [-978.778] (-976.566) -- 0:00:36
409000 -- (-984.326) [-976.238] (-975.755) (-976.724) * (-978.604) [-977.252] (-977.637) (-978.005) -- 0:00:36
409500 -- (-979.497) [-976.617] (-976.360) (-977.038) * (-979.052) [-977.456] (-977.942) (-979.703) -- 0:00:36
410000 -- (-980.547) (-976.409) [-978.733] (-978.363) * (-977.488) [-976.304] (-980.610) (-978.272) -- 0:00:35
Average standard deviation of split frequencies: 0.013966
410500 -- (-978.910) (-981.783) (-978.576) [-978.798] * (-981.953) (-976.931) [-978.447] (-977.277) -- 0:00:35
411000 -- (-978.822) [-981.981] (-979.728) (-979.997) * (-978.230) (-980.256) (-977.241) [-977.294] -- 0:00:35
411500 -- (-977.817) (-982.417) [-976.530] (-977.043) * (-976.721) (-978.681) (-977.240) [-978.143] -- 0:00:35
412000 -- (-976.935) [-979.960] (-978.430) (-977.148) * (-979.556) (-977.265) [-978.718] (-976.484) -- 0:00:35
412500 -- (-978.476) [-978.703] (-979.382) (-978.552) * (-977.004) [-977.781] (-977.247) (-976.332) -- 0:00:35
413000 -- (-977.080) (-977.468) [-979.195] (-977.445) * (-976.994) [-976.825] (-979.491) (-977.122) -- 0:00:35
413500 -- (-978.676) (-979.147) (-979.040) [-979.862] * (-977.156) (-977.612) (-981.210) [-978.092] -- 0:00:36
414000 -- (-977.182) (-979.706) [-978.104] (-976.057) * (-978.400) (-979.781) (-981.116) [-978.533] -- 0:00:36
414500 -- (-977.375) (-977.864) [-977.326] (-979.988) * (-983.518) (-978.767) (-976.617) [-977.907] -- 0:00:36
415000 -- (-978.129) (-978.622) [-978.258] (-983.290) * (-981.455) (-984.080) [-976.535] (-977.660) -- 0:00:36
Average standard deviation of split frequencies: 0.014102
415500 -- (-978.965) (-976.577) [-976.728] (-976.720) * (-977.419) (-979.871) [-976.515] (-976.653) -- 0:00:36
416000 -- (-978.313) (-976.032) (-979.588) [-976.645] * (-979.312) [-977.794] (-978.222) (-978.689) -- 0:00:36
416500 -- (-978.786) (-977.512) [-981.147] (-976.622) * (-979.436) (-978.001) (-979.449) [-977.812] -- 0:00:36
417000 -- (-978.938) (-978.851) (-978.872) [-976.499] * (-978.401) (-981.706) [-977.541] (-981.237) -- 0:00:36
417500 -- (-977.810) [-978.081] (-982.824) (-979.615) * [-976.858] (-984.979) (-978.304) (-984.229) -- 0:00:36
418000 -- (-987.149) (-977.073) [-976.255] (-981.311) * (-976.196) (-989.510) [-977.651] (-979.645) -- 0:00:36
418500 -- (-981.902) [-977.109] (-976.352) (-976.847) * (-976.238) (-981.483) [-976.795] (-982.656) -- 0:00:36
419000 -- (-980.725) (-980.036) (-976.430) [-976.287] * [-977.934] (-979.603) (-978.790) (-977.028) -- 0:00:36
419500 -- (-977.169) (-977.266) (-976.979) [-976.888] * [-976.805] (-976.803) (-979.763) (-978.056) -- 0:00:35
420000 -- (-980.811) [-978.059] (-983.083) (-978.565) * (-980.840) (-976.979) (-984.010) [-980.381] -- 0:00:35
Average standard deviation of split frequencies: 0.014988
420500 -- (-977.386) [-979.099] (-977.962) (-980.066) * (-979.782) [-980.630] (-985.726) (-978.332) -- 0:00:35
421000 -- (-981.198) [-979.661] (-977.354) (-982.324) * [-979.610] (-979.436) (-982.207) (-980.786) -- 0:00:35
421500 -- (-979.594) (-979.950) [-977.208] (-978.895) * (-979.497) (-980.153) (-982.958) [-976.963] -- 0:00:35
422000 -- [-976.201] (-983.015) (-976.962) (-977.692) * (-977.450) (-977.497) [-980.741] (-978.401) -- 0:00:35
422500 -- (-977.060) (-978.473) [-977.936] (-977.142) * (-976.253) [-978.088] (-981.135) (-977.720) -- 0:00:35
423000 -- [-979.134] (-977.328) (-980.057) (-977.862) * (-975.946) (-977.890) (-980.285) [-977.860] -- 0:00:35
423500 -- (-982.382) (-977.349) (-976.968) [-977.492] * [-977.082] (-978.491) (-979.007) (-978.272) -- 0:00:35
424000 -- (-979.488) [-976.629] (-982.320) (-980.087) * [-977.624] (-980.299) (-978.899) (-978.289) -- 0:00:35
424500 -- [-979.709] (-980.318) (-981.708) (-978.748) * (-978.273) (-983.600) (-978.326) [-977.962] -- 0:00:35
425000 -- (-977.057) (-976.816) (-977.408) [-978.018] * [-980.682] (-976.892) (-977.661) (-978.635) -- 0:00:35
Average standard deviation of split frequencies: 0.014125
425500 -- (-979.461) [-976.602] (-977.137) (-978.454) * [-978.949] (-976.849) (-978.092) (-980.724) -- 0:00:35
426000 -- [-977.424] (-977.668) (-977.050) (-977.711) * (-982.436) (-977.219) [-976.870] (-980.411) -- 0:00:35
426500 -- (-978.657) (-977.159) [-976.890] (-979.657) * (-978.045) (-977.239) [-976.570] (-980.458) -- 0:00:34
427000 -- (-981.731) [-977.408] (-981.104) (-981.459) * (-978.560) (-977.087) [-977.249] (-979.896) -- 0:00:34
427500 -- (-977.589) (-979.278) (-975.928) [-978.385] * (-978.616) (-978.203) (-977.084) [-977.679] -- 0:00:34
428000 -- (-979.045) (-977.509) (-979.677) [-977.705] * (-979.404) [-975.966] (-979.338) (-980.821) -- 0:00:34
428500 -- (-976.818) (-979.054) (-984.182) [-979.828] * (-978.552) [-976.386] (-976.420) (-981.112) -- 0:00:34
429000 -- (-977.092) (-978.362) [-977.919] (-977.979) * [-976.978] (-980.830) (-977.138) (-980.567) -- 0:00:34
429500 -- [-976.300] (-978.096) (-976.323) (-977.638) * (-977.615) (-979.275) (-982.452) [-978.175] -- 0:00:34
430000 -- [-977.650] (-980.650) (-978.419) (-979.278) * (-978.535) (-977.086) (-977.508) [-981.085] -- 0:00:35
Average standard deviation of split frequencies: 0.015393
430500 -- (-978.380) [-976.619] (-978.367) (-977.481) * (-978.987) [-976.913] (-979.522) (-980.630) -- 0:00:35
431000 -- (-977.273) [-978.150] (-978.343) (-977.610) * (-978.039) [-976.488] (-977.173) (-985.877) -- 0:00:35
431500 -- (-978.450) [-977.634] (-980.931) (-978.621) * (-977.016) [-976.494] (-980.205) (-981.710) -- 0:00:35
432000 -- (-976.602) (-976.847) (-979.769) [-976.202] * (-976.778) (-982.181) [-976.810] (-978.365) -- 0:00:35
432500 -- (-976.910) [-976.510] (-981.633) (-976.223) * (-976.778) (-980.092) [-977.010] (-978.890) -- 0:00:35
433000 -- [-977.548] (-979.423) (-979.168) (-976.939) * [-978.030] (-978.710) (-978.867) (-978.211) -- 0:00:35
433500 -- (-976.924) [-978.420] (-976.812) (-976.871) * (-978.807) (-982.967) (-976.880) [-978.934] -- 0:00:35
434000 -- (-980.614) [-977.505] (-977.281) (-979.506) * (-979.714) (-982.492) [-978.723] (-977.872) -- 0:00:35
434500 -- (-979.482) [-978.433] (-979.200) (-978.142) * (-979.952) (-976.728) [-978.585] (-978.449) -- 0:00:35
435000 -- [-977.474] (-979.260) (-978.999) (-979.760) * (-977.212) (-979.010) (-985.406) [-977.283] -- 0:00:35
Average standard deviation of split frequencies: 0.015073
435500 -- (-977.969) (-978.349) (-978.956) [-979.316] * (-978.884) (-976.959) [-983.346] (-978.797) -- 0:00:34
436000 -- [-977.587] (-978.353) (-980.199) (-977.831) * (-978.802) (-978.573) [-979.818] (-978.142) -- 0:00:34
436500 -- (-978.626) [-976.959] (-978.900) (-977.628) * [-978.932] (-980.649) (-976.743) (-980.230) -- 0:00:34
437000 -- (-979.385) [-976.711] (-978.285) (-977.993) * (-979.213) [-980.248] (-978.553) (-977.089) -- 0:00:34
437500 -- (-978.470) (-979.343) [-978.039] (-977.684) * [-977.285] (-976.709) (-980.238) (-976.289) -- 0:00:34
438000 -- [-982.084] (-978.015) (-976.486) (-978.296) * [-976.468] (-981.176) (-979.160) (-977.550) -- 0:00:34
438500 -- (-978.141) (-980.546) (-976.743) [-977.755] * (-978.914) [-980.534] (-979.451) (-977.148) -- 0:00:34
439000 -- (-977.739) (-979.133) [-977.812] (-979.628) * (-976.966) (-978.466) [-976.679] (-975.808) -- 0:00:34
439500 -- (-976.942) [-979.081] (-976.805) (-977.007) * (-978.314) [-978.448] (-978.476) (-975.920) -- 0:00:34
440000 -- (-976.622) (-978.069) (-980.197) [-977.330] * [-976.554] (-979.711) (-978.334) (-976.817) -- 0:00:34
Average standard deviation of split frequencies: 0.014033
440500 -- (-977.668) [-977.687] (-979.343) (-976.901) * [-977.377] (-977.098) (-975.989) (-981.045) -- 0:00:34
441000 -- (-977.555) (-981.180) (-977.742) [-976.909] * (-977.484) (-976.902) (-983.027) [-978.783] -- 0:00:34
441500 -- (-977.691) [-978.298] (-980.802) (-977.480) * (-981.107) [-977.330] (-979.869) (-980.505) -- 0:00:34
442000 -- [-976.435] (-977.689) (-982.248) (-979.457) * (-977.581) (-981.407) (-982.497) [-978.837] -- 0:00:34
442500 -- (-979.097) [-978.165] (-980.494) (-978.992) * (-982.161) (-977.830) (-983.324) [-978.652] -- 0:00:34
443000 -- (-979.592) (-980.110) (-980.948) [-976.300] * (-979.585) [-976.461] (-979.569) (-978.708) -- 0:00:33
443500 -- [-979.503] (-977.086) (-985.089) (-978.220) * [-979.230] (-976.803) (-978.856) (-978.210) -- 0:00:33
444000 -- (-977.730) [-978.386] (-981.452) (-977.907) * (-981.392) (-976.718) [-977.931] (-976.012) -- 0:00:33
444500 -- (-979.235) (-976.680) (-985.035) [-978.197] * (-978.745) [-978.299] (-976.407) (-976.043) -- 0:00:33
445000 -- (-977.964) (-976.856) (-978.408) [-977.803] * [-978.497] (-980.059) (-981.625) (-976.093) -- 0:00:33
Average standard deviation of split frequencies: 0.013181
445500 -- (-981.622) [-976.797] (-984.239) (-980.225) * (-977.203) (-976.241) [-977.922] (-977.422) -- 0:00:33
446000 -- (-978.155) [-976.646] (-978.401) (-978.224) * (-978.403) (-976.564) (-980.748) [-979.623] -- 0:00:34
446500 -- [-979.421] (-976.630) (-976.654) (-978.911) * (-979.194) (-976.239) (-981.796) [-980.421] -- 0:00:34
447000 -- (-982.327) (-976.481) [-977.563] (-980.746) * (-979.699) [-976.239] (-978.597) (-979.258) -- 0:00:34
447500 -- (-978.011) (-976.645) (-980.681) [-981.239] * (-977.377) [-976.234] (-981.315) (-976.852) -- 0:00:34
448000 -- (-976.706) (-977.012) (-978.927) [-977.563] * (-978.897) (-978.018) [-982.615] (-979.814) -- 0:00:34
448500 -- (-978.068) (-976.399) [-980.343] (-985.725) * (-976.391) (-976.566) (-980.589) [-976.273] -- 0:00:34
449000 -- (-978.832) (-976.904) (-984.647) [-981.772] * [-976.666] (-980.902) (-977.006) (-977.934) -- 0:00:34
449500 -- (-978.392) [-979.847] (-983.514) (-977.857) * (-978.831) [-977.324] (-977.006) (-978.832) -- 0:00:34
450000 -- (-980.090) (-977.364) (-976.716) [-976.888] * (-979.236) [-978.137] (-976.840) (-980.345) -- 0:00:34
Average standard deviation of split frequencies: 0.012491
450500 -- (-977.025) [-976.336] (-980.933) (-978.846) * [-980.642] (-977.976) (-979.403) (-978.640) -- 0:00:34
451000 -- (-976.709) (-978.084) (-978.891) [-978.082] * (-981.283) [-976.950] (-982.505) (-978.803) -- 0:00:34
451500 -- (-980.410) (-977.445) (-977.303) [-979.393] * (-980.699) [-978.123] (-981.516) (-977.357) -- 0:00:34
452000 -- (-976.831) (-978.748) [-977.897] (-977.840) * (-979.394) (-978.869) (-976.408) [-976.014] -- 0:00:33
452500 -- (-978.571) [-978.192] (-977.924) (-976.338) * (-982.663) (-976.939) (-976.387) [-975.965] -- 0:00:33
453000 -- (-978.414) (-978.499) [-976.728] (-977.440) * (-978.035) (-976.756) [-979.836] (-977.761) -- 0:00:33
453500 -- (-976.353) (-979.822) [-979.237] (-979.155) * [-978.417] (-977.301) (-980.295) (-977.357) -- 0:00:33
454000 -- (-978.122) (-977.473) (-976.424) [-979.199] * (-980.855) [-977.001] (-978.663) (-979.975) -- 0:00:33
454500 -- (-980.574) (-976.525) [-977.293] (-976.810) * [-980.130] (-976.574) (-979.885) (-980.624) -- 0:00:33
455000 -- (-978.787) [-976.109] (-977.293) (-978.009) * (-977.016) (-978.336) (-979.123) [-982.414] -- 0:00:33
Average standard deviation of split frequencies: 0.012284
455500 -- (-977.275) (-978.704) [-978.159] (-978.663) * [-977.679] (-981.026) (-983.266) (-977.673) -- 0:00:33
456000 -- (-979.007) (-976.994) (-977.815) [-977.274] * (-977.825) (-978.572) [-977.940] (-976.759) -- 0:00:33
456500 -- (-978.526) [-978.853] (-980.322) (-977.862) * [-979.799] (-978.566) (-979.259) (-977.485) -- 0:00:33
457000 -- (-978.777) (-978.523) (-979.262) [-978.409] * (-976.983) (-980.415) (-979.685) [-979.919] -- 0:00:33
457500 -- [-978.739] (-978.637) (-979.098) (-978.064) * (-976.656) [-978.255] (-978.803) (-981.550) -- 0:00:33
458000 -- (-980.629) [-981.276] (-983.228) (-978.370) * (-976.838) [-979.062] (-979.837) (-982.303) -- 0:00:33
458500 -- (-979.504) [-978.442] (-980.053) (-976.749) * (-980.602) [-977.235] (-979.438) (-977.878) -- 0:00:33
459000 -- (-976.938) (-977.097) [-978.259] (-977.843) * (-983.202) (-980.916) (-977.697) [-977.019] -- 0:00:33
459500 -- [-980.185] (-978.887) (-979.225) (-976.376) * (-977.566) [-977.675] (-978.160) (-976.392) -- 0:00:32
460000 -- (-978.199) (-977.386) [-979.905] (-976.796) * (-977.187) (-981.517) (-977.531) [-977.087] -- 0:00:32
Average standard deviation of split frequencies: 0.013062
460500 -- [-978.311] (-978.884) (-980.055) (-979.576) * [-977.778] (-980.336) (-977.827) (-976.785) -- 0:00:32
461000 -- [-977.417] (-981.234) (-984.930) (-982.358) * (-978.739) (-982.324) [-976.820] (-977.293) -- 0:00:32
461500 -- (-979.055) [-978.690] (-987.686) (-976.320) * (-980.434) [-979.182] (-980.894) (-977.127) -- 0:00:32
462000 -- (-978.004) (-977.913) [-977.554] (-978.482) * (-977.094) [-977.705] (-980.531) (-978.311) -- 0:00:33
462500 -- (-978.698) [-977.984] (-976.822) (-979.144) * (-976.920) (-980.212) [-981.076] (-978.768) -- 0:00:33
463000 -- (-980.214) (-976.541) (-976.474) [-977.158] * [-977.519] (-978.499) (-979.464) (-978.625) -- 0:00:33
463500 -- (-978.346) [-981.089] (-980.053) (-979.197) * (-977.448) (-975.992) (-979.201) [-977.522] -- 0:00:33
464000 -- (-976.679) (-980.190) (-979.214) [-978.582] * (-978.277) (-979.413) (-979.591) [-976.905] -- 0:00:33
464500 -- (-977.521) (-981.771) [-978.556] (-980.931) * (-978.611) (-981.589) (-979.696) [-976.793] -- 0:00:33
465000 -- (-977.753) (-983.356) [-978.147] (-982.509) * (-980.278) [-979.704] (-979.590) (-975.919) -- 0:00:33
Average standard deviation of split frequencies: 0.012757
465500 -- [-977.059] (-978.361) (-977.585) (-978.114) * (-976.890) (-980.846) (-979.941) [-977.137] -- 0:00:33
466000 -- (-977.501) (-979.249) [-980.327] (-980.231) * (-978.653) [-980.861] (-979.481) (-977.437) -- 0:00:33
466500 -- (-980.429) [-977.008] (-979.025) (-980.307) * [-982.336] (-977.327) (-977.821) (-977.053) -- 0:00:33
467000 -- [-978.396] (-980.791) (-978.174) (-977.847) * (-981.773) (-976.777) [-977.380] (-979.566) -- 0:00:33
467500 -- (-977.785) [-981.238] (-976.425) (-977.610) * [-979.713] (-977.094) (-978.442) (-977.348) -- 0:00:33
468000 -- (-979.471) (-977.597) (-977.132) [-978.262] * (-979.960) (-978.553) (-978.502) [-977.565] -- 0:00:32
468500 -- (-977.571) (-978.722) [-976.908] (-980.061) * (-980.175) (-977.506) [-978.353] (-980.251) -- 0:00:32
469000 -- (-977.048) (-978.251) [-978.295] (-983.183) * (-979.665) [-978.465] (-977.685) (-978.022) -- 0:00:32
469500 -- (-976.480) (-981.395) [-981.540] (-980.899) * (-980.705) (-979.094) [-976.695] (-978.151) -- 0:00:32
470000 -- (-977.315) (-978.702) [-978.699] (-984.244) * [-977.974] (-979.880) (-978.770) (-980.639) -- 0:00:32
Average standard deviation of split frequencies: 0.013197
470500 -- (-977.424) (-978.165) [-978.274] (-977.517) * (-979.614) [-978.055] (-976.964) (-980.401) -- 0:00:32
471000 -- (-978.483) (-979.415) (-980.046) [-981.084] * [-977.404] (-978.889) (-983.492) (-975.930) -- 0:00:32
471500 -- [-976.270] (-981.162) (-981.981) (-979.070) * (-976.075) (-979.891) [-978.048] (-977.320) -- 0:00:32
472000 -- (-978.000) (-982.395) (-979.380) [-977.634] * [-976.064] (-979.476) (-976.859) (-977.798) -- 0:00:32
472500 -- (-976.206) (-977.972) (-983.063) [-976.651] * (-976.378) (-978.587) (-978.045) [-976.471] -- 0:00:32
473000 -- (-976.443) [-976.343] (-984.746) (-978.105) * (-977.393) (-977.365) (-977.325) [-978.375] -- 0:00:32
473500 -- (-978.303) (-980.232) [-976.494] (-978.859) * (-977.666) (-978.027) [-976.677] (-977.541) -- 0:00:32
474000 -- (-979.813) (-979.337) (-979.150) [-980.483] * [-977.620] (-978.113) (-979.368) (-978.401) -- 0:00:32
474500 -- (-979.955) (-976.433) [-976.944] (-979.030) * [-979.960] (-977.430) (-976.933) (-979.252) -- 0:00:32
475000 -- (-977.658) [-978.557] (-977.039) (-977.609) * [-977.780] (-978.943) (-978.593) (-977.055) -- 0:00:32
Average standard deviation of split frequencies: 0.013493
475500 -- [-976.788] (-983.063) (-979.070) (-979.062) * [-977.339] (-979.510) (-977.901) (-977.088) -- 0:00:31
476000 -- (-983.783) [-980.023] (-976.280) (-977.924) * [-976.991] (-978.588) (-977.484) (-978.136) -- 0:00:31
476500 -- [-978.878] (-978.358) (-981.028) (-978.038) * (-977.982) (-980.310) (-977.927) [-979.037] -- 0:00:31
477000 -- [-977.992] (-977.020) (-976.909) (-981.659) * (-978.596) (-979.847) (-984.066) [-977.833] -- 0:00:31
477500 -- (-978.901) (-979.286) (-977.307) [-976.785] * (-978.548) (-977.839) (-979.316) [-976.541] -- 0:00:32
478000 -- (-976.989) (-978.189) (-979.424) [-976.470] * (-978.984) [-978.104] (-976.337) (-977.458) -- 0:00:32
478500 -- [-976.948] (-977.302) (-977.256) (-976.761) * (-980.561) (-978.325) (-976.726) [-977.379] -- 0:00:32
479000 -- (-976.795) (-976.390) [-979.917] (-977.858) * (-978.151) [-979.215] (-979.369) (-976.145) -- 0:00:32
479500 -- (-976.887) [-978.171] (-977.985) (-977.863) * (-979.390) (-978.755) (-978.528) [-977.457] -- 0:00:32
480000 -- (-976.826) [-977.905] (-980.552) (-977.384) * (-980.315) [-977.505] (-978.217) (-984.982) -- 0:00:32
Average standard deviation of split frequencies: 0.013599
480500 -- [-978.397] (-979.169) (-977.637) (-980.500) * (-980.306) (-977.754) [-977.982] (-980.740) -- 0:00:32
481000 -- (-980.601) (-978.736) [-977.925] (-980.806) * (-977.526) (-978.295) (-977.267) [-977.134] -- 0:00:32
481500 -- [-978.647] (-980.954) (-976.485) (-978.247) * (-982.901) (-978.893) (-977.345) [-978.134] -- 0:00:32
482000 -- (-976.287) (-981.569) [-980.730] (-978.614) * (-982.683) (-977.153) [-977.316] (-979.696) -- 0:00:32
482500 -- (-982.851) (-977.474) (-978.593) [-978.083] * (-981.304) [-978.548] (-976.661) (-980.796) -- 0:00:32
483000 -- (-978.441) (-977.983) (-977.028) [-977.855] * [-978.357] (-976.645) (-976.785) (-980.172) -- 0:00:32
483500 -- [-977.700] (-977.075) (-978.145) (-976.388) * (-977.165) [-976.326] (-978.401) (-979.440) -- 0:00:32
484000 -- (-977.180) [-977.718] (-981.817) (-977.134) * (-976.849) (-977.147) [-977.079] (-977.938) -- 0:00:31
484500 -- (-977.964) (-978.951) [-979.587] (-977.207) * (-978.577) (-977.808) [-979.106] (-979.158) -- 0:00:31
485000 -- (-977.391) (-978.824) (-979.373) [-977.281] * (-981.460) [-980.637] (-978.093) (-978.415) -- 0:00:31
Average standard deviation of split frequencies: 0.013276
485500 -- (-978.295) (-978.191) [-976.934] (-977.701) * [-984.292] (-977.340) (-978.051) (-977.424) -- 0:00:31
486000 -- (-977.468) (-979.401) [-976.960] (-977.716) * (-978.579) (-978.674) [-978.340] (-977.120) -- 0:00:31
486500 -- (-977.595) [-979.440] (-977.680) (-982.700) * (-979.094) (-979.550) [-976.477] (-980.203) -- 0:00:31
487000 -- (-976.886) (-976.960) (-980.145) [-977.759] * (-976.662) (-978.687) (-980.132) [-976.296] -- 0:00:31
487500 -- [-977.935] (-976.754) (-980.401) (-980.521) * (-980.608) (-978.866) [-977.857] (-978.166) -- 0:00:31
488000 -- [-978.849] (-977.859) (-976.683) (-977.363) * (-983.067) [-977.907] (-982.742) (-979.197) -- 0:00:31
488500 -- [-977.254] (-977.437) (-976.633) (-980.292) * (-980.407) (-977.262) (-980.692) [-977.343] -- 0:00:31
489000 -- (-982.070) [-978.554] (-977.734) (-978.942) * [-978.498] (-977.657) (-980.227) (-981.347) -- 0:00:31
489500 -- [-976.756] (-977.247) (-979.724) (-981.667) * [-977.363] (-980.386) (-979.202) (-981.878) -- 0:00:31
490000 -- [-978.042] (-977.246) (-977.914) (-983.598) * (-976.488) [-978.333] (-977.227) (-979.998) -- 0:00:31
Average standard deviation of split frequencies: 0.013090
490500 -- [-977.943] (-976.564) (-976.891) (-980.947) * [-980.378] (-978.276) (-978.118) (-978.673) -- 0:00:31
491000 -- [-977.641] (-976.666) (-975.873) (-977.408) * (-978.321) (-980.799) (-978.273) [-977.117] -- 0:00:31
491500 -- (-981.057) (-977.057) [-975.873] (-980.095) * (-976.458) (-980.440) (-978.324) [-978.886] -- 0:00:31
492000 -- (-984.313) [-977.732] (-977.951) (-981.133) * (-976.936) (-976.732) [-977.553] (-978.022) -- 0:00:30
492500 -- (-978.158) (-983.957) [-977.371] (-978.259) * (-979.544) [-978.095] (-980.344) (-981.081) -- 0:00:30
493000 -- [-978.005] (-986.049) (-976.174) (-977.299) * (-979.173) (-975.957) (-977.361) [-981.494] -- 0:00:30
493500 -- [-983.581] (-980.830) (-977.689) (-977.850) * (-976.474) (-976.534) (-977.370) [-978.137] -- 0:00:30
494000 -- (-977.836) (-977.986) [-978.114] (-980.110) * (-976.951) [-978.308] (-977.607) (-977.799) -- 0:00:31
494500 -- [-978.221] (-978.437) (-977.752) (-978.189) * (-978.673) (-978.130) (-980.000) [-978.239] -- 0:00:31
495000 -- [-979.729] (-979.139) (-976.386) (-983.273) * (-976.622) (-977.636) (-976.469) [-981.001] -- 0:00:31
Average standard deviation of split frequencies: 0.012652
495500 -- (-978.991) (-981.432) (-976.766) [-976.764] * (-980.237) (-978.420) [-978.550] (-977.843) -- 0:00:31
496000 -- (-982.964) (-981.706) (-980.225) [-976.007] * (-981.632) (-976.582) (-982.015) [-977.466] -- 0:00:31
496500 -- [-976.469] (-978.027) (-979.742) (-976.647) * [-977.225] (-976.578) (-977.328) (-977.757) -- 0:00:31
497000 -- (-978.334) [-977.467] (-978.664) (-978.496) * [-975.908] (-976.322) (-978.827) (-977.115) -- 0:00:31
497500 -- [-977.921] (-977.885) (-979.999) (-978.008) * (-978.204) (-976.709) [-978.519] (-980.647) -- 0:00:31
498000 -- (-976.767) [-977.586] (-977.060) (-977.055) * (-979.660) (-976.496) (-976.354) [-977.598] -- 0:00:31
498500 -- (-976.924) (-978.528) (-979.362) [-978.297] * (-977.250) (-976.483) [-983.101] (-980.552) -- 0:00:31
499000 -- (-978.367) (-977.948) [-976.901] (-981.312) * (-978.655) [-976.600] (-981.627) (-977.001) -- 0:00:31
499500 -- (-977.437) [-978.410] (-979.698) (-980.998) * (-978.946) [-977.014] (-977.466) (-980.013) -- 0:00:31
500000 -- (-978.131) (-983.606) (-976.335) [-977.171] * (-979.649) (-977.178) (-977.919) [-978.218] -- 0:00:31
Average standard deviation of split frequencies: 0.012742
500500 -- (-979.757) [-978.448] (-976.946) (-977.314) * [-980.905] (-977.517) (-978.198) (-978.079) -- 0:00:30
501000 -- [-979.236] (-977.156) (-979.256) (-976.245) * (-977.880) (-977.512) (-979.054) [-976.766] -- 0:00:30
501500 -- (-979.769) [-976.519] (-980.564) (-977.763) * (-976.787) (-979.911) [-978.245] (-978.676) -- 0:00:30
502000 -- [-978.193] (-978.003) (-977.208) (-976.596) * [-979.114] (-978.998) (-980.209) (-976.918) -- 0:00:30
502500 -- (-977.349) (-977.854) [-976.751] (-976.997) * [-979.462] (-978.618) (-978.985) (-978.647) -- 0:00:30
503000 -- (-977.030) (-977.792) (-977.460) [-976.868] * (-980.078) (-979.911) [-978.337] (-977.103) -- 0:00:30
503500 -- [-977.398] (-978.256) (-976.661) (-979.132) * (-979.588) (-978.880) (-979.420) [-978.702] -- 0:00:30
504000 -- (-979.872) (-979.600) [-976.795] (-981.632) * (-983.327) (-982.941) (-981.459) [-976.740] -- 0:00:30
504500 -- [-982.567] (-977.564) (-981.346) (-982.421) * [-976.521] (-980.796) (-980.624) (-978.844) -- 0:00:30
505000 -- (-980.885) (-983.676) [-976.218] (-980.853) * [-976.530] (-976.920) (-978.971) (-977.549) -- 0:00:30
Average standard deviation of split frequencies: 0.012794
505500 -- [-977.484] (-980.416) (-979.217) (-976.209) * [-976.111] (-978.648) (-977.113) (-977.384) -- 0:00:30
506000 -- (-981.322) (-978.758) (-980.827) [-977.162] * (-977.738) [-979.119] (-976.632) (-978.166) -- 0:00:30
506500 -- (-979.560) [-977.782] (-977.226) (-977.203) * (-980.702) (-979.528) [-976.460] (-981.787) -- 0:00:30
507000 -- [-977.567] (-978.016) (-977.011) (-977.338) * (-978.512) [-979.308] (-978.972) (-977.727) -- 0:00:30
507500 -- [-976.520] (-976.592) (-976.904) (-976.547) * [-978.709] (-977.109) (-981.892) (-978.447) -- 0:00:30
508000 -- (-976.444) (-979.533) (-976.807) [-976.748] * (-975.969) [-977.426] (-980.403) (-976.746) -- 0:00:30
508500 -- (-977.213) (-979.571) (-978.877) [-976.953] * [-976.730] (-978.392) (-977.224) (-976.661) -- 0:00:29
509000 -- (-977.329) [-977.962] (-976.762) (-978.453) * [-980.541] (-978.152) (-977.973) (-978.706) -- 0:00:29
509500 -- (-976.946) (-978.070) [-977.206] (-977.999) * (-978.550) (-982.343) [-977.777] (-977.243) -- 0:00:29
510000 -- (-978.664) (-978.241) [-980.154] (-978.297) * (-978.517) [-978.258] (-978.010) (-984.250) -- 0:00:30
Average standard deviation of split frequencies: 0.012801
510500 -- (-979.106) (-978.037) (-978.318) [-977.695] * [-980.811] (-977.706) (-978.442) (-980.274) -- 0:00:30
511000 -- [-980.931] (-978.774) (-977.493) (-979.195) * (-977.980) [-978.420] (-978.135) (-978.105) -- 0:00:30
511500 -- (-987.859) (-976.579) [-976.750] (-980.437) * (-978.869) (-977.304) [-980.094] (-977.106) -- 0:00:30
512000 -- (-981.266) (-979.380) [-977.349] (-982.271) * [-978.690] (-980.260) (-979.733) (-977.305) -- 0:00:30
512500 -- [-978.295] (-977.835) (-980.948) (-981.154) * (-976.959) [-977.513] (-977.648) (-978.875) -- 0:00:30
513000 -- [-978.880] (-980.455) (-977.073) (-977.837) * (-979.361) (-977.702) (-979.188) [-978.573] -- 0:00:30
513500 -- (-978.522) (-977.631) [-982.288] (-977.326) * (-980.059) (-978.633) (-980.922) [-978.253] -- 0:00:30
514000 -- (-981.000) (-977.509) (-976.397) [-978.302] * (-978.335) (-979.970) [-976.697] (-980.573) -- 0:00:30
514500 -- (-976.392) [-978.079] (-976.246) (-977.319) * (-977.451) [-976.537] (-978.885) (-977.772) -- 0:00:30
515000 -- [-976.982] (-978.945) (-978.308) (-980.030) * (-977.182) [-978.076] (-976.582) (-978.421) -- 0:00:30
Average standard deviation of split frequencies: 0.012607
515500 -- [-977.098] (-978.620) (-978.965) (-978.999) * (-977.182) (-976.287) [-976.583] (-977.087) -- 0:00:30
516000 -- [-976.240] (-980.507) (-978.241) (-978.243) * [-980.760] (-977.080) (-978.418) (-979.008) -- 0:00:30
516500 -- (-976.947) (-976.925) (-980.701) [-982.694] * (-976.461) (-981.605) [-979.071] (-982.847) -- 0:00:29
517000 -- [-978.919] (-976.474) (-980.200) (-976.717) * (-977.775) (-978.067) [-976.108] (-978.012) -- 0:00:29
517500 -- (-981.086) (-978.279) (-977.988) [-978.078] * (-979.105) [-979.162] (-980.583) (-978.186) -- 0:00:29
518000 -- [-978.467] (-978.111) (-977.116) (-978.433) * (-983.440) (-980.072) [-978.562] (-977.637) -- 0:00:29
518500 -- (-980.044) (-983.461) [-978.516] (-977.399) * (-976.489) [-978.628] (-978.700) (-978.720) -- 0:00:29
519000 -- (-980.860) (-977.915) [-978.172] (-981.782) * (-980.593) (-976.996) [-978.363] (-980.383) -- 0:00:29
519500 -- [-981.036] (-976.858) (-979.391) (-980.418) * (-980.153) (-976.876) (-979.234) [-980.499] -- 0:00:29
520000 -- (-976.256) (-975.808) (-979.892) [-978.723] * (-978.186) [-976.494] (-978.861) (-980.856) -- 0:00:29
Average standard deviation of split frequencies: 0.013339
520500 -- [-979.863] (-976.765) (-977.021) (-978.186) * (-977.296) (-976.541) (-979.414) [-977.685] -- 0:00:29
521000 -- (-980.965) (-977.546) [-978.937] (-978.193) * (-976.662) [-976.919] (-979.606) (-978.339) -- 0:00:29
521500 -- (-979.784) [-980.065] (-984.950) (-981.764) * [-977.954] (-977.872) (-976.211) (-977.312) -- 0:00:29
522000 -- (-976.035) (-976.191) [-976.939] (-981.076) * (-979.958) (-977.162) (-976.815) [-977.018] -- 0:00:29
522500 -- [-977.803] (-977.265) (-979.157) (-976.826) * (-978.408) [-977.705] (-978.979) (-979.379) -- 0:00:29
523000 -- (-978.265) [-979.620] (-977.421) (-978.685) * (-978.109) (-976.812) (-978.831) [-978.696] -- 0:00:29
523500 -- [-978.256] (-978.578) (-977.211) (-977.439) * (-980.493) [-976.705] (-979.313) (-979.381) -- 0:00:29
524000 -- [-978.257] (-976.254) (-977.460) (-979.719) * (-977.132) (-976.296) (-978.329) [-976.147] -- 0:00:29
524500 -- [-977.797] (-978.053) (-977.499) (-978.846) * (-983.139) [-976.190] (-977.892) (-977.230) -- 0:00:29
525000 -- [-979.829] (-978.368) (-979.715) (-978.132) * (-978.723) [-978.637] (-976.769) (-981.863) -- 0:00:28
Average standard deviation of split frequencies: 0.012607
525500 -- (-978.086) (-977.450) (-978.690) [-979.283] * (-977.642) [-980.254] (-978.669) (-980.154) -- 0:00:28
526000 -- (-979.020) (-977.002) (-978.854) [-979.330] * (-976.885) [-977.145] (-979.033) (-977.997) -- 0:00:29
526500 -- (-977.255) (-977.673) [-977.664] (-979.575) * (-980.675) [-977.082] (-978.221) (-980.968) -- 0:00:29
527000 -- (-978.512) (-979.676) [-978.121] (-978.689) * [-978.416] (-977.275) (-978.923) (-977.930) -- 0:00:29
527500 -- [-976.316] (-979.432) (-982.389) (-983.550) * [-978.767] (-977.352) (-978.883) (-979.034) -- 0:00:29
528000 -- [-979.219] (-978.629) (-977.716) (-981.646) * (-977.672) (-978.003) (-978.087) [-978.304] -- 0:00:29
528500 -- (-976.406) (-977.974) [-977.200] (-979.594) * [-980.104] (-978.188) (-978.398) (-977.438) -- 0:00:29
529000 -- (-976.174) [-977.259] (-984.818) (-980.251) * (-978.404) (-977.849) [-978.717] (-982.866) -- 0:00:29
529500 -- [-976.466] (-980.588) (-988.581) (-977.652) * (-977.760) (-978.384) (-979.160) [-977.361] -- 0:00:29
530000 -- (-979.083) (-976.757) (-984.883) [-978.673] * (-977.390) [-978.894] (-976.967) (-978.144) -- 0:00:29
Average standard deviation of split frequencies: 0.012673
530500 -- (-978.853) [-977.801] (-988.635) (-980.854) * (-977.513) [-978.237] (-977.585) (-977.902) -- 0:00:29
531000 -- [-979.653] (-978.033) (-984.088) (-977.149) * (-977.831) [-977.858] (-976.480) (-980.053) -- 0:00:29
531500 -- (-983.750) (-979.717) [-977.493] (-978.873) * [-983.310] (-977.352) (-978.573) (-978.164) -- 0:00:29
532000 -- (-986.210) (-978.918) (-979.160) [-979.318] * (-979.467) (-979.051) (-977.129) [-976.166] -- 0:00:29
532500 -- (-980.308) [-978.685] (-977.524) (-979.359) * (-979.617) (-977.921) [-976.921] (-976.969) -- 0:00:28
533000 -- (-980.213) [-976.729] (-976.873) (-977.717) * (-981.200) (-977.179) [-977.161] (-977.095) -- 0:00:28
533500 -- (-978.417) (-978.729) [-977.032] (-978.008) * (-978.589) (-981.065) [-977.704] (-980.069) -- 0:00:28
534000 -- [-977.430] (-981.812) (-976.735) (-981.304) * [-977.896] (-977.634) (-977.868) (-978.140) -- 0:00:28
534500 -- [-979.428] (-978.008) (-980.815) (-980.300) * (-977.510) (-977.150) (-978.466) [-977.426] -- 0:00:28
535000 -- (-978.606) [-977.626] (-979.102) (-983.223) * (-980.830) (-976.395) (-978.100) [-978.365] -- 0:00:28
Average standard deviation of split frequencies: 0.013134
535500 -- [-979.018] (-978.219) (-978.965) (-978.825) * [-978.832] (-977.012) (-976.504) (-978.297) -- 0:00:28
536000 -- (-977.018) (-978.467) [-978.806] (-979.272) * (-978.698) (-976.887) (-979.765) [-977.607] -- 0:00:28
536500 -- (-984.560) (-981.974) [-977.699] (-977.212) * (-979.630) (-977.117) [-978.971] (-979.587) -- 0:00:28
537000 -- [-976.684] (-979.070) (-977.396) (-976.930) * (-981.875) (-978.168) [-980.311] (-979.732) -- 0:00:28
537500 -- [-979.088] (-977.079) (-977.523) (-977.029) * (-977.973) (-977.937) [-982.883] (-978.013) -- 0:00:28
538000 -- (-977.849) (-977.753) (-976.601) [-979.534] * (-976.633) [-979.601] (-978.107) (-982.063) -- 0:00:28
538500 -- (-984.893) [-979.406] (-976.208) (-977.327) * (-976.158) (-978.031) (-977.117) [-979.101] -- 0:00:28
539000 -- (-977.343) [-981.605] (-976.731) (-976.933) * [-977.875] (-983.311) (-978.116) (-979.640) -- 0:00:28
539500 -- (-976.923) (-976.853) (-977.218) [-977.343] * (-978.242) (-978.181) [-976.711] (-977.945) -- 0:00:28
540000 -- (-976.457) (-976.021) [-978.185] (-977.780) * (-980.435) (-978.100) (-977.494) [-977.539] -- 0:00:28
Average standard deviation of split frequencies: 0.013137
540500 -- (-976.637) (-982.359) [-977.458] (-976.953) * (-980.843) [-977.513] (-977.449) (-981.418) -- 0:00:28
541000 -- (-983.525) [-981.723] (-977.257) (-981.499) * [-982.944] (-977.952) (-977.702) (-980.147) -- 0:00:27
541500 -- (-979.318) (-978.896) [-978.823] (-977.965) * (-976.304) (-981.584) [-978.193] (-977.428) -- 0:00:27
542000 -- [-978.210] (-976.945) (-977.701) (-981.670) * (-979.223) (-980.266) [-977.162] (-980.739) -- 0:00:28
542500 -- (-976.929) [-977.889] (-978.185) (-980.174) * (-977.550) (-979.878) (-978.066) [-979.513] -- 0:00:28
543000 -- [-978.352] (-979.057) (-980.157) (-977.550) * (-977.499) (-980.713) (-976.736) [-976.548] -- 0:00:28
543500 -- [-980.120] (-979.501) (-980.011) (-979.824) * (-979.171) (-976.665) (-977.717) [-976.647] -- 0:00:28
544000 -- (-977.193) (-978.021) (-980.485) [-976.888] * (-976.677) (-977.844) (-978.018) [-976.997] -- 0:00:28
544500 -- (-977.421) (-977.478) [-983.117] (-977.121) * (-980.514) (-981.561) (-978.617) [-976.771] -- 0:00:28
545000 -- (-978.414) (-981.851) [-976.299] (-977.052) * (-980.668) (-979.596) [-977.993] (-976.930) -- 0:00:28
Average standard deviation of split frequencies: 0.012548
545500 -- [-978.624] (-984.054) (-976.624) (-976.174) * (-978.435) (-980.157) (-982.743) [-985.000] -- 0:00:28
546000 -- (-980.448) (-979.731) (-978.075) [-975.882] * [-979.813] (-979.032) (-981.565) (-978.678) -- 0:00:28
546500 -- (-984.534) (-980.805) (-977.094) [-976.573] * (-980.334) [-978.649] (-979.727) (-981.597) -- 0:00:28
547000 -- [-980.803] (-982.562) (-977.312) (-977.578) * [-977.397] (-981.803) (-978.169) (-979.767) -- 0:00:28
547500 -- (-979.203) [-980.499] (-976.461) (-977.910) * (-981.946) (-981.509) [-977.427] (-977.220) -- 0:00:28
548000 -- [-977.740] (-979.529) (-978.929) (-979.872) * (-978.336) [-978.622] (-980.616) (-979.169) -- 0:00:28
548500 -- (-980.145) [-978.293] (-976.828) (-979.500) * (-980.811) [-977.630] (-977.773) (-979.190) -- 0:00:27
549000 -- (-977.687) [-979.008] (-982.657) (-976.399) * (-978.984) (-980.759) [-977.082] (-977.964) -- 0:00:27
549500 -- (-980.174) [-978.371] (-979.496) (-976.750) * (-978.621) (-981.054) (-978.780) [-979.054] -- 0:00:27
550000 -- (-977.433) (-978.119) (-977.695) [-977.203] * (-982.097) [-979.569] (-983.879) (-977.209) -- 0:00:27
Average standard deviation of split frequencies: 0.012156
550500 -- (-977.387) (-979.455) [-977.554] (-976.792) * (-979.294) (-980.101) (-977.939) [-984.508] -- 0:00:27
551000 -- (-978.392) (-982.964) [-977.564] (-979.868) * (-978.790) [-978.565] (-977.341) (-977.698) -- 0:00:27
551500 -- (-979.155) [-980.667] (-987.713) (-976.217) * (-979.052) (-976.792) (-977.841) [-978.546] -- 0:00:27
552000 -- (-981.225) (-976.597) (-978.411) [-976.712] * (-977.601) (-978.857) [-979.240] (-980.194) -- 0:00:27
552500 -- (-980.775) [-978.017] (-978.134) (-987.096) * (-980.094) (-979.486) [-977.268] (-979.149) -- 0:00:27
553000 -- (-977.840) (-977.254) [-978.569] (-981.234) * (-983.045) (-977.667) [-976.750] (-979.884) -- 0:00:27
553500 -- [-977.565] (-977.174) (-977.679) (-978.492) * (-978.062) (-978.327) (-979.001) [-976.805] -- 0:00:27
554000 -- [-976.721] (-978.663) (-983.199) (-978.862) * (-977.085) [-979.975] (-978.930) (-978.781) -- 0:00:27
554500 -- [-977.608] (-977.866) (-980.056) (-977.688) * (-977.598) (-976.051) (-979.354) [-977.484] -- 0:00:27
555000 -- (-978.500) (-981.169) (-978.495) [-979.148] * (-982.356) [-977.425] (-978.510) (-978.828) -- 0:00:27
Average standard deviation of split frequencies: 0.011022
555500 -- [-982.285] (-980.144) (-977.526) (-983.002) * (-977.894) (-978.591) (-977.297) [-977.813] -- 0:00:27
556000 -- (-977.923) (-979.363) [-978.969] (-978.000) * (-981.226) [-980.450] (-979.699) (-977.561) -- 0:00:27
556500 -- (-977.092) (-983.129) [-977.760] (-981.375) * (-980.949) (-978.932) (-983.504) [-977.186] -- 0:00:27
557000 -- (-977.761) [-980.791] (-977.383) (-981.784) * (-977.503) (-979.140) (-980.998) [-976.311] -- 0:00:27
557500 -- (-976.698) (-977.043) [-978.938] (-983.403) * [-977.361] (-981.350) (-976.903) (-977.691) -- 0:00:27
558000 -- (-979.000) (-978.503) [-979.670] (-979.557) * (-977.924) (-978.580) [-980.795] (-977.045) -- 0:00:27
558500 -- (-979.423) (-979.617) (-977.690) [-977.697] * (-976.220) (-976.370) [-977.796] (-981.699) -- 0:00:27
559000 -- (-979.169) (-976.872) [-977.718] (-978.793) * (-982.754) [-978.102] (-978.140) (-982.411) -- 0:00:27
559500 -- (-980.615) (-977.012) [-977.276] (-978.844) * [-977.132] (-977.746) (-978.979) (-979.552) -- 0:00:27
560000 -- [-982.833] (-979.073) (-982.496) (-978.727) * (-979.728) (-979.850) [-976.148] (-978.982) -- 0:00:27
Average standard deviation of split frequencies: 0.011715
560500 -- (-976.600) [-977.285] (-984.043) (-982.579) * (-984.602) (-980.298) [-978.145] (-977.533) -- 0:00:27
561000 -- (-976.084) (-976.689) (-977.416) [-976.006] * (-980.005) (-980.036) [-981.633] (-977.457) -- 0:00:27
561500 -- (-977.124) (-976.294) (-978.908) [-977.633] * [-977.502] (-978.784) (-978.839) (-978.494) -- 0:00:27
562000 -- (-978.048) (-980.442) (-977.810) [-980.115] * (-981.365) [-980.723] (-980.327) (-976.364) -- 0:00:27
562500 -- (-977.698) (-980.158) [-978.653] (-985.697) * (-985.033) [-976.885] (-978.242) (-978.748) -- 0:00:27
563000 -- (-977.301) (-979.623) [-977.631] (-978.758) * (-976.894) (-976.602) [-976.866] (-976.602) -- 0:00:27
563500 -- (-977.168) (-978.291) (-976.340) [-978.468] * [-979.324] (-977.483) (-976.776) (-977.484) -- 0:00:27
564000 -- (-977.244) (-977.070) [-977.417] (-976.661) * (-976.917) (-978.738) [-977.654] (-977.203) -- 0:00:27
564500 -- (-976.377) [-978.500] (-977.855) (-976.669) * (-976.630) (-976.350) [-976.222] (-979.558) -- 0:00:27
565000 -- (-976.936) (-979.503) (-976.589) [-979.515] * [-979.458] (-976.333) (-976.315) (-979.541) -- 0:00:26
Average standard deviation of split frequencies: 0.011272
565500 -- (-980.335) (-977.694) (-980.351) [-980.412] * (-976.513) [-977.044] (-976.690) (-976.376) -- 0:00:26
566000 -- (-978.498) [-978.320] (-981.124) (-977.215) * (-980.965) [-980.952] (-983.244) (-978.628) -- 0:00:26
566500 -- [-978.460] (-976.801) (-979.795) (-977.231) * [-979.219] (-979.027) (-985.030) (-978.433) -- 0:00:26
567000 -- (-978.278) (-977.098) (-978.201) [-976.195] * (-977.824) (-976.291) (-978.321) [-978.106] -- 0:00:26
567500 -- (-976.906) (-977.320) (-978.288) [-977.974] * (-976.989) (-977.530) (-979.245) [-977.119] -- 0:00:26
568000 -- (-977.802) (-979.153) [-980.008] (-978.665) * (-977.545) (-976.784) [-980.588] (-979.401) -- 0:00:26
568500 -- (-977.797) (-979.550) (-981.651) [-978.043] * (-979.931) [-976.944] (-978.425) (-981.056) -- 0:00:26
569000 -- (-979.926) [-978.494] (-982.342) (-977.872) * (-979.714) (-977.212) [-978.500] (-978.034) -- 0:00:26
569500 -- (-980.636) (-982.499) (-979.191) [-980.307] * (-977.580) (-976.342) [-980.223] (-980.122) -- 0:00:26
570000 -- (-977.710) (-977.846) (-986.906) [-978.562] * (-980.233) (-977.745) [-977.429] (-978.829) -- 0:00:26
Average standard deviation of split frequencies: 0.010849
570500 -- (-978.074) (-984.523) (-978.591) [-976.801] * (-976.906) [-980.069] (-980.139) (-976.415) -- 0:00:26
571000 -- (-978.197) (-977.764) (-979.837) [-977.640] * (-978.234) (-976.879) (-980.827) [-977.656] -- 0:00:26
571500 -- (-980.142) (-979.530) [-978.493] (-977.829) * (-981.999) (-977.158) (-980.874) [-976.205] -- 0:00:26
572000 -- [-980.368] (-976.766) (-980.057) (-978.566) * (-978.639) (-977.369) (-976.456) [-977.128] -- 0:00:26
572500 -- [-980.184] (-977.280) (-976.031) (-977.845) * (-980.094) (-979.811) [-977.471] (-980.726) -- 0:00:26
573000 -- (-978.275) (-978.067) [-976.962] (-976.197) * (-978.768) (-977.039) [-977.045] (-979.424) -- 0:00:26
573500 -- [-976.965] (-975.776) (-976.399) (-977.815) * [-979.039] (-977.615) (-976.149) (-977.843) -- 0:00:26
574000 -- [-979.018] (-977.857) (-977.004) (-976.808) * (-976.697) (-977.989) (-978.897) [-977.058] -- 0:00:26
574500 -- (-980.400) (-976.496) (-979.565) [-978.051] * (-976.947) [-977.723] (-980.847) (-977.475) -- 0:00:26
575000 -- (-977.440) (-976.401) [-979.808] (-982.257) * (-977.716) (-977.640) [-980.297] (-978.500) -- 0:00:26
Average standard deviation of split frequencies: 0.010148
575500 -- (-979.780) (-977.493) [-980.701] (-978.092) * (-979.766) [-977.726] (-977.023) (-976.568) -- 0:00:26
576000 -- (-977.660) [-979.388] (-980.893) (-978.197) * (-981.707) (-978.962) (-976.685) [-978.071] -- 0:00:26
576500 -- (-977.235) [-978.913] (-980.792) (-979.070) * (-983.842) [-979.411] (-978.700) (-983.651) -- 0:00:26
577000 -- [-978.778] (-977.801) (-981.241) (-981.059) * (-981.579) (-978.578) (-977.223) [-981.156] -- 0:00:26
577500 -- (-976.663) (-980.463) [-979.291] (-981.964) * (-978.327) [-976.893] (-978.139) (-981.438) -- 0:00:26
578000 -- (-977.179) [-978.127] (-979.226) (-983.204) * [-976.843] (-979.735) (-978.546) (-979.807) -- 0:00:26
578500 -- (-977.956) [-976.930] (-978.589) (-977.196) * (-977.958) (-978.647) (-978.450) [-978.023] -- 0:00:26
579000 -- (-979.590) (-981.708) (-976.989) [-977.237] * (-980.204) [-979.839] (-979.763) (-977.827) -- 0:00:26
579500 -- (-977.371) (-977.620) [-979.383] (-980.966) * (-977.869) [-977.205] (-977.545) (-978.043) -- 0:00:26
580000 -- (-977.618) [-976.681] (-977.896) (-980.490) * (-976.146) (-977.369) (-978.478) [-981.347] -- 0:00:26
Average standard deviation of split frequencies: 0.010283
580500 -- (-981.723) (-977.576) [-978.418] (-979.105) * (-976.105) (-978.439) [-977.341] (-981.475) -- 0:00:26
581000 -- [-976.916] (-978.622) (-979.374) (-978.966) * (-981.047) (-980.421) [-980.211] (-981.143) -- 0:00:25
581500 -- (-976.991) (-977.318) [-976.682] (-981.453) * (-976.776) [-977.243] (-978.226) (-981.363) -- 0:00:25
582000 -- [-977.610] (-976.592) (-977.042) (-981.881) * (-975.907) [-978.579] (-978.239) (-980.309) -- 0:00:25
582500 -- (-980.108) [-978.677] (-976.621) (-977.435) * (-975.900) (-980.276) [-978.174] (-979.161) -- 0:00:25
583000 -- (-977.927) (-980.213) (-977.744) [-977.933] * (-976.586) (-980.715) (-978.143) [-977.014] -- 0:00:25
583500 -- (-980.156) [-978.514] (-979.777) (-977.703) * (-977.568) [-979.210] (-979.403) (-979.883) -- 0:00:25
584000 -- (-976.925) (-978.779) [-977.370] (-979.732) * [-977.760] (-983.259) (-978.048) (-983.275) -- 0:00:25
584500 -- (-977.667) (-980.124) [-976.870] (-985.909) * (-979.923) [-977.806] (-982.101) (-981.140) -- 0:00:25
585000 -- (-976.358) [-979.060] (-977.255) (-977.397) * [-978.333] (-978.147) (-982.523) (-982.102) -- 0:00:25
Average standard deviation of split frequencies: 0.010257
585500 -- (-978.759) (-979.355) [-977.669] (-978.551) * [-980.577] (-977.168) (-978.851) (-979.277) -- 0:00:25
586000 -- (-979.192) (-978.710) (-977.774) [-978.389] * (-978.679) (-978.293) (-983.214) [-979.184] -- 0:00:25
586500 -- (-981.707) (-979.383) (-979.478) [-979.308] * (-979.885) (-978.473) [-980.276] (-980.674) -- 0:00:25
587000 -- (-980.011) (-977.867) (-977.559) [-978.436] * (-980.133) [-979.203] (-979.101) (-980.490) -- 0:00:25
587500 -- (-979.010) [-976.966] (-981.875) (-977.500) * (-976.576) (-978.656) (-979.415) [-978.913] -- 0:00:25
588000 -- [-977.473] (-980.516) (-979.504) (-978.424) * (-976.473) (-979.002) (-980.442) [-978.943] -- 0:00:25
588500 -- [-979.335] (-978.477) (-978.625) (-976.127) * (-976.504) (-978.900) [-984.196] (-977.550) -- 0:00:25
589000 -- (-976.754) [-979.687] (-976.676) (-977.840) * (-976.377) (-979.455) [-977.557] (-976.967) -- 0:00:25
589500 -- (-978.020) [-983.150] (-980.185) (-978.165) * (-979.148) (-978.178) (-978.296) [-980.586] -- 0:00:25
590000 -- [-976.472] (-979.844) (-980.912) (-979.106) * (-977.690) (-978.632) [-977.320] (-976.842) -- 0:00:25
Average standard deviation of split frequencies: 0.009417
590500 -- (-986.784) [-977.933] (-979.718) (-980.652) * [-976.823] (-979.393) (-980.468) (-979.430) -- 0:00:25
591000 -- (-985.087) [-977.042] (-977.345) (-981.840) * [-977.792] (-982.959) (-977.900) (-976.869) -- 0:00:25
591500 -- [-980.411] (-977.311) (-977.852) (-978.798) * (-977.397) [-978.021] (-977.954) (-980.223) -- 0:00:25
592000 -- [-976.923] (-978.492) (-976.362) (-976.284) * (-981.131) [-978.885] (-978.076) (-976.377) -- 0:00:25
592500 -- [-979.342] (-977.485) (-978.006) (-977.496) * (-982.604) [-977.693] (-976.642) (-982.065) -- 0:00:25
593000 -- (-977.516) (-979.953) (-979.552) [-979.256] * (-978.212) (-979.145) [-977.181] (-979.529) -- 0:00:25
593500 -- (-977.082) [-980.767] (-978.918) (-979.843) * [-976.541] (-976.320) (-979.641) (-977.631) -- 0:00:25
594000 -- (-981.031) (-978.640) [-977.682] (-976.357) * (-976.742) [-977.073] (-979.021) (-977.635) -- 0:00:25
594500 -- [-976.825] (-978.517) (-981.629) (-977.190) * [-976.422] (-976.639) (-979.516) (-977.511) -- 0:00:25
595000 -- (-976.763) (-979.040) [-977.980] (-976.502) * (-976.646) (-981.154) [-978.271] (-977.723) -- 0:00:25
Average standard deviation of split frequencies: 0.010035
595500 -- (-978.913) (-979.174) [-979.121] (-976.813) * (-980.820) (-977.582) (-978.027) [-978.668] -- 0:00:25
596000 -- (-976.960) [-976.844] (-978.328) (-977.221) * (-978.906) [-978.040] (-981.063) (-980.074) -- 0:00:25
596500 -- [-977.761] (-979.711) (-977.732) (-980.241) * (-981.734) (-977.600) (-979.990) [-982.827] -- 0:00:25
597000 -- (-978.074) (-976.269) (-977.346) [-977.241] * (-980.302) (-980.138) (-983.441) [-977.761] -- 0:00:24
597500 -- [-977.619] (-976.989) (-976.800) (-976.364) * [-977.753] (-978.159) (-978.632) (-980.435) -- 0:00:24
598000 -- (-983.103) (-980.567) (-980.908) [-978.126] * (-976.884) (-978.648) [-981.810] (-979.411) -- 0:00:24
598500 -- (-978.651) (-979.622) (-980.929) [-979.611] * (-980.032) (-981.474) (-983.018) [-976.301] -- 0:00:24
599000 -- (-978.694) (-979.676) (-982.648) [-976.333] * (-980.114) [-976.319] (-977.581) (-981.368) -- 0:00:24
599500 -- (-977.707) (-983.909) (-978.888) [-978.305] * [-981.065] (-979.295) (-977.846) (-980.181) -- 0:00:24
600000 -- (-976.848) (-978.568) [-978.076] (-982.098) * (-982.063) [-983.445] (-982.450) (-976.803) -- 0:00:24
Average standard deviation of split frequencies: 0.009261
600500 -- (-978.992) (-979.548) [-978.856] (-977.871) * (-976.811) [-978.884] (-977.444) (-985.003) -- 0:00:24
601000 -- [-979.503] (-980.566) (-979.911) (-977.793) * [-977.658] (-980.356) (-986.202) (-977.077) -- 0:00:24
601500 -- (-981.142) [-977.632] (-977.916) (-977.223) * (-983.746) [-976.807] (-979.143) (-978.165) -- 0:00:24
602000 -- [-976.736] (-978.753) (-978.115) (-978.500) * (-983.459) (-981.949) [-980.201] (-980.215) -- 0:00:24
602500 -- (-979.311) [-978.746] (-979.757) (-980.742) * [-976.786] (-978.819) (-979.830) (-978.321) -- 0:00:24
603000 -- (-979.226) (-983.144) (-979.873) [-977.676] * (-986.037) [-979.505] (-979.736) (-978.358) -- 0:00:24
603500 -- [-976.719] (-985.406) (-977.220) (-984.309) * (-977.583) (-976.510) [-976.188] (-979.450) -- 0:00:24
604000 -- (-976.452) (-987.288) (-976.674) [-978.866] * [-976.121] (-977.962) (-977.235) (-976.430) -- 0:00:24
604500 -- [-978.033] (-976.783) (-976.314) (-978.193) * (-977.197) [-980.336] (-977.375) (-978.959) -- 0:00:24
605000 -- (-976.859) [-979.327] (-977.875) (-980.593) * (-978.463) (-979.272) [-980.249] (-981.843) -- 0:00:24
Average standard deviation of split frequencies: 0.009140
605500 -- (-976.136) (-978.535) [-978.711] (-978.027) * (-976.115) (-979.916) [-976.435] (-978.886) -- 0:00:24
606000 -- (-979.986) (-977.389) [-976.383] (-976.032) * (-977.624) (-977.737) (-978.464) [-976.564] -- 0:00:24
606500 -- (-979.337) (-978.035) (-978.116) [-976.182] * (-976.971) [-977.144] (-977.211) (-981.571) -- 0:00:24
607000 -- [-980.648] (-979.191) (-978.312) (-979.948) * (-977.273) (-978.055) [-979.903] (-983.543) -- 0:00:24
607500 -- (-983.713) (-977.205) (-977.611) [-979.204] * (-977.727) (-980.172) [-980.804] (-978.752) -- 0:00:24
608000 -- (-978.974) (-982.509) (-977.624) [-980.073] * (-979.189) (-978.865) (-980.312) [-977.203] -- 0:00:24
608500 -- [-977.685] (-980.623) (-976.219) (-979.195) * (-977.589) (-977.477) (-981.644) [-976.765] -- 0:00:24
609000 -- [-981.033] (-984.896) (-980.839) (-979.827) * (-976.502) (-981.074) [-977.181] (-981.289) -- 0:00:24
609500 -- (-979.077) [-980.115] (-976.817) (-978.000) * (-978.524) (-980.385) (-977.203) [-979.036] -- 0:00:24
610000 -- (-978.150) [-977.693] (-978.779) (-981.539) * (-980.508) (-980.328) [-978.193] (-978.771) -- 0:00:24
Average standard deviation of split frequencies: 0.009006
610500 -- (-977.804) [-977.270] (-981.864) (-976.727) * (-977.201) (-981.768) [-977.120] (-980.951) -- 0:00:24
611000 -- (-979.416) [-978.092] (-980.052) (-978.302) * (-977.004) (-981.144) [-978.469] (-977.956) -- 0:00:24
611500 -- (-977.353) (-976.715) (-984.681) [-979.346] * (-979.413) [-978.528] (-977.509) (-976.299) -- 0:00:24
612000 -- [-978.311] (-979.107) (-979.258) (-978.023) * (-981.117) [-978.122] (-977.589) (-980.711) -- 0:00:24
612500 -- (-978.244) [-980.913] (-980.868) (-979.407) * (-977.727) (-980.337) (-979.541) [-977.745] -- 0:00:24
613000 -- [-978.303] (-979.904) (-979.358) (-979.593) * (-977.309) (-976.165) [-977.877] (-978.253) -- 0:00:23
613500 -- [-978.471] (-979.080) (-982.963) (-977.070) * (-978.329) (-976.942) [-976.230] (-977.597) -- 0:00:23
614000 -- [-977.550] (-978.658) (-981.061) (-979.512) * (-980.014) [-977.832] (-977.145) (-978.153) -- 0:00:23
614500 -- [-977.308] (-978.559) (-981.434) (-977.372) * (-978.483) (-978.852) (-979.887) [-976.450] -- 0:00:23
615000 -- (-979.129) (-976.403) [-977.367] (-978.278) * (-977.695) [-979.654] (-977.712) (-976.953) -- 0:00:23
Average standard deviation of split frequencies: 0.009438
615500 -- (-980.159) (-976.787) [-980.372] (-977.878) * (-976.231) (-977.543) (-979.641) [-977.110] -- 0:00:23
616000 -- (-978.421) (-977.335) (-977.998) [-978.681] * (-978.190) (-977.429) (-977.104) [-976.583] -- 0:00:23
616500 -- (-978.326) [-978.615] (-980.595) (-976.886) * (-979.545) [-978.497] (-976.483) (-979.605) -- 0:00:23
617000 -- [-979.347] (-977.019) (-979.219) (-977.986) * (-977.005) (-979.916) [-978.336] (-978.223) -- 0:00:23
617500 -- (-977.092) [-980.023] (-977.135) (-977.986) * (-977.581) [-979.666] (-977.669) (-977.914) -- 0:00:23
618000 -- (-977.929) (-977.016) (-979.922) [-976.280] * (-980.209) [-983.488] (-978.310) (-977.021) -- 0:00:23
618500 -- (-977.993) (-976.851) [-977.432] (-978.307) * [-980.831] (-978.061) (-980.905) (-978.535) -- 0:00:23
619000 -- (-984.054) (-979.637) (-976.504) [-976.278] * [-977.938] (-977.907) (-978.866) (-977.840) -- 0:00:23
619500 -- (-977.413) (-980.639) (-977.126) [-978.821] * (-977.422) [-976.506] (-978.477) (-977.150) -- 0:00:23
620000 -- (-979.950) (-978.804) (-977.084) [-977.494] * (-977.540) (-982.861) (-981.973) [-978.242] -- 0:00:23
Average standard deviation of split frequencies: 0.009367
620500 -- [-979.062] (-977.718) (-978.017) (-977.897) * (-981.371) (-979.125) [-976.800] (-978.518) -- 0:00:23
621000 -- (-977.990) (-977.160) [-977.198] (-976.771) * (-980.332) [-978.927] (-977.369) (-979.368) -- 0:00:23
621500 -- (-979.245) [-977.739] (-978.978) (-981.772) * (-979.191) [-979.095] (-977.788) (-975.997) -- 0:00:23
622000 -- (-979.357) (-980.382) (-978.441) [-978.138] * (-978.310) (-978.578) [-976.477] (-976.361) -- 0:00:23
622500 -- (-976.868) (-978.557) (-978.884) [-977.574] * [-978.585] (-977.506) (-978.200) (-979.823) -- 0:00:23
623000 -- (-978.014) (-981.262) (-987.637) [-977.028] * (-978.885) (-976.009) [-976.630] (-979.249) -- 0:00:23
623500 -- [-976.744] (-978.409) (-980.621) (-977.609) * (-980.134) (-979.799) [-977.653] (-978.933) -- 0:00:23
624000 -- (-976.808) (-978.399) [-977.510] (-979.644) * (-980.394) [-976.892] (-986.837) (-977.838) -- 0:00:23
624500 -- [-977.940] (-979.270) (-977.480) (-979.334) * [-978.113] (-976.801) (-978.548) (-978.196) -- 0:00:23
625000 -- (-977.979) (-979.089) [-978.294] (-977.067) * (-979.472) (-978.688) [-978.281] (-980.918) -- 0:00:23
Average standard deviation of split frequencies: 0.009388
625500 -- [-978.047] (-978.307) (-978.074) (-977.874) * [-977.481] (-979.890) (-977.921) (-980.425) -- 0:00:23
626000 -- (-976.293) (-979.353) [-978.965] (-977.631) * (-978.993) (-979.848) (-982.745) [-977.379] -- 0:00:23
626500 -- (-976.728) [-980.089] (-977.256) (-978.065) * (-979.692) (-976.985) [-976.631] (-977.646) -- 0:00:23
627000 -- [-978.494] (-976.385) (-979.338) (-979.985) * (-979.190) (-976.372) [-977.689] (-982.611) -- 0:00:23
627500 -- (-984.096) (-976.620) (-979.959) [-977.873] * (-977.095) [-978.423] (-986.528) (-977.390) -- 0:00:23
628000 -- [-980.580] (-978.606) (-981.231) (-984.612) * (-978.517) (-977.495) [-980.323] (-978.725) -- 0:00:23
628500 -- (-979.314) (-979.345) (-980.880) [-981.691] * [-976.644] (-976.958) (-978.512) (-982.536) -- 0:00:23
629000 -- (-982.737) [-979.933] (-979.194) (-981.036) * (-977.576) (-978.938) [-978.726] (-976.596) -- 0:00:23
629500 -- (-980.143) [-979.761] (-981.480) (-977.829) * (-977.758) (-976.885) (-978.385) [-981.313] -- 0:00:22
630000 -- (-982.578) (-977.360) [-978.607] (-976.669) * (-978.122) (-979.420) [-976.948] (-977.057) -- 0:00:22
Average standard deviation of split frequencies: 0.009219
630500 -- (-980.088) (-978.155) [-977.551] (-978.046) * (-978.342) [-979.270] (-979.739) (-979.404) -- 0:00:22
631000 -- [-976.785] (-981.314) (-978.769) (-981.525) * (-979.316) (-979.474) [-979.648] (-980.930) -- 0:00:22
631500 -- (-981.980) (-979.074) (-978.695) [-976.841] * [-977.647] (-988.067) (-978.534) (-978.360) -- 0:00:22
632000 -- (-981.185) (-976.579) (-980.757) [-976.686] * [-978.069] (-984.207) (-983.375) (-976.740) -- 0:00:22
632500 -- (-984.507) [-979.116] (-978.447) (-980.867) * (-979.284) [-979.387] (-979.518) (-977.503) -- 0:00:22
633000 -- [-978.023] (-978.312) (-979.178) (-981.022) * [-979.231] (-978.307) (-977.706) (-980.043) -- 0:00:22
633500 -- (-976.305) [-977.224] (-978.369) (-982.005) * (-976.728) [-976.843] (-976.276) (-980.944) -- 0:00:22
634000 -- [-976.092] (-976.381) (-976.615) (-978.473) * (-977.932) (-979.164) (-976.300) [-977.272] -- 0:00:22
634500 -- (-976.083) (-979.908) [-978.052] (-976.986) * (-987.305) (-980.350) (-977.697) [-976.730] -- 0:00:22
635000 -- (-977.411) (-983.657) [-977.155] (-979.431) * (-980.321) (-976.871) [-976.977] (-977.720) -- 0:00:22
Average standard deviation of split frequencies: 0.009191
635500 -- (-980.648) [-979.526] (-976.238) (-977.552) * (-981.038) (-978.075) [-978.050] (-978.124) -- 0:00:22
636000 -- (-978.378) (-978.719) [-977.950] (-976.821) * (-980.668) (-978.666) (-978.827) [-982.919] -- 0:00:22
636500 -- (-980.866) [-977.921] (-976.858) (-976.280) * [-977.617] (-982.291) (-977.220) (-977.435) -- 0:00:22
637000 -- [-980.050] (-982.118) (-980.867) (-978.295) * (-977.515) [-977.981] (-977.507) (-976.843) -- 0:00:22
637500 -- (-980.161) (-977.675) (-980.111) [-978.456] * (-976.506) (-978.103) (-977.499) [-976.402] -- 0:00:22
638000 -- (-980.088) (-977.914) (-978.887) [-976.339] * [-976.361] (-977.021) (-980.456) (-977.846) -- 0:00:22
638500 -- (-977.389) (-976.827) [-976.928] (-980.014) * (-977.550) [-978.606] (-977.052) (-978.102) -- 0:00:22
639000 -- (-977.972) [-979.225] (-977.176) (-979.779) * (-977.890) [-976.681] (-976.296) (-978.871) -- 0:00:22
639500 -- (-976.944) [-981.680] (-978.651) (-978.043) * (-979.783) [-978.173] (-978.620) (-979.438) -- 0:00:22
640000 -- (-978.868) (-980.312) [-978.261] (-977.962) * (-978.168) (-978.698) [-980.315] (-978.718) -- 0:00:22
Average standard deviation of split frequencies: 0.009473
640500 -- (-977.113) (-981.740) (-977.932) [-977.415] * [-977.461] (-977.616) (-978.301) (-978.202) -- 0:00:22
641000 -- (-979.975) (-987.308) (-977.305) [-979.093] * [-977.561] (-978.365) (-979.003) (-980.217) -- 0:00:22
641500 -- [-976.530] (-977.747) (-977.401) (-980.153) * (-977.804) [-977.528] (-978.687) (-976.997) -- 0:00:22
642000 -- [-976.287] (-980.498) (-977.727) (-980.151) * (-982.380) (-980.487) [-978.029] (-979.041) -- 0:00:22
642500 -- (-976.822) (-979.811) (-983.354) [-977.979] * (-978.245) [-976.811] (-976.596) (-979.750) -- 0:00:22
643000 -- [-976.371] (-982.855) (-980.601) (-978.457) * [-978.514] (-978.724) (-980.160) (-980.488) -- 0:00:22
643500 -- [-977.151] (-980.006) (-978.573) (-980.582) * (-976.914) [-979.554] (-979.336) (-979.479) -- 0:00:22
644000 -- (-981.490) (-981.163) (-979.654) [-980.871] * [-977.585] (-977.665) (-977.939) (-980.854) -- 0:00:22
644500 -- [-980.773] (-979.476) (-977.240) (-976.424) * (-976.457) [-977.625] (-978.928) (-980.688) -- 0:00:22
645000 -- (-980.201) (-976.439) [-976.501] (-979.924) * (-977.138) [-977.521] (-977.272) (-977.514) -- 0:00:22
Average standard deviation of split frequencies: 0.009304
645500 -- (-978.362) [-978.226] (-981.231) (-977.632) * [-977.425] (-977.388) (-976.929) (-977.285) -- 0:00:21
646000 -- [-980.859] (-977.978) (-976.367) (-983.513) * (-978.733) (-979.055) (-977.191) [-976.797] -- 0:00:21
646500 -- (-976.792) [-979.078] (-978.321) (-979.580) * (-977.252) (-979.326) (-979.780) [-976.613] -- 0:00:21
647000 -- (-977.210) [-978.923] (-979.401) (-978.125) * (-977.791) (-980.802) [-978.037] (-979.182) -- 0:00:21
647500 -- (-980.132) (-979.262) [-977.342] (-978.901) * [-976.349] (-979.709) (-981.286) (-980.886) -- 0:00:21
648000 -- (-977.570) (-977.407) [-976.637] (-977.339) * (-976.398) (-977.049) (-980.188) [-983.344] -- 0:00:21
648500 -- (-979.538) [-977.350] (-978.478) (-977.752) * (-979.002) [-979.435] (-980.448) (-977.981) -- 0:00:21
649000 -- (-986.391) [-977.599] (-976.674) (-977.801) * (-977.206) [-980.431] (-978.269) (-982.598) -- 0:00:21
649500 -- (-977.775) [-978.020] (-976.364) (-978.119) * (-977.698) [-978.537] (-978.558) (-987.415) -- 0:00:21
650000 -- (-977.988) [-976.446] (-978.754) (-977.618) * (-979.176) (-981.904) [-976.660] (-979.806) -- 0:00:21
Average standard deviation of split frequencies: 0.009373
650500 -- [-978.165] (-976.393) (-977.786) (-978.076) * (-978.607) [-977.385] (-976.808) (-978.318) -- 0:00:21
651000 -- (-980.318) (-978.342) [-979.226] (-978.323) * (-979.467) [-979.149] (-978.579) (-976.503) -- 0:00:21
651500 -- (-978.775) [-977.668] (-978.998) (-979.284) * (-978.400) (-976.177) [-978.307] (-976.463) -- 0:00:21
652000 -- (-979.407) (-982.739) [-977.291] (-977.154) * (-977.160) [-978.543] (-976.996) (-977.518) -- 0:00:21
652500 -- (-977.543) (-983.324) (-979.013) [-977.394] * (-980.140) (-981.142) (-978.323) [-977.243] -- 0:00:21
653000 -- [-978.481] (-980.004) (-981.213) (-976.814) * (-977.606) (-976.306) [-976.615] (-976.329) -- 0:00:21
653500 -- (-977.409) [-977.989] (-979.143) (-981.479) * (-982.461) (-986.722) [-976.405] (-977.483) -- 0:00:21
654000 -- [-982.165] (-977.669) (-977.713) (-979.422) * (-982.862) (-977.054) (-976.461) [-977.806] -- 0:00:21
654500 -- (-981.633) [-976.584] (-980.945) (-987.535) * (-981.822) (-977.317) [-976.375] (-977.261) -- 0:00:21
655000 -- (-978.180) (-977.580) [-979.538] (-979.384) * (-977.144) (-978.103) (-979.265) [-978.384] -- 0:00:21
Average standard deviation of split frequencies: 0.009486
655500 -- (-981.778) (-980.226) [-979.767] (-980.128) * [-976.320] (-977.824) (-983.467) (-976.070) -- 0:00:21
656000 -- [-977.233] (-979.778) (-977.428) (-976.378) * (-980.916) [-980.678] (-978.902) (-978.182) -- 0:00:21
656500 -- [-977.658] (-977.897) (-980.721) (-978.749) * (-977.678) [-976.438] (-976.418) (-976.484) -- 0:00:21
657000 -- (-977.172) (-982.365) (-979.444) [-980.110] * (-977.036) (-976.885) [-976.051] (-976.622) -- 0:00:21
657500 -- [-975.997] (-978.987) (-979.017) (-977.143) * (-976.873) (-976.623) [-976.962] (-978.368) -- 0:00:21
658000 -- (-979.327) (-983.064) (-976.806) [-976.221] * (-978.361) (-977.317) (-977.908) [-979.268] -- 0:00:21
658500 -- [-980.772] (-982.283) (-978.715) (-977.304) * [-978.299] (-978.204) (-977.336) (-980.383) -- 0:00:21
659000 -- (-980.041) (-978.070) (-977.128) [-976.557] * (-976.987) (-983.317) [-977.201] (-978.718) -- 0:00:21
659500 -- (-978.165) (-977.167) (-978.003) [-977.104] * [-977.276] (-978.607) (-978.341) (-979.471) -- 0:00:21
660000 -- (-978.064) (-977.252) (-978.002) [-976.277] * (-981.032) (-979.518) (-979.603) [-980.263] -- 0:00:21
Average standard deviation of split frequencies: 0.009181
660500 -- (-981.103) (-977.850) (-978.892) [-976.451] * [-980.026] (-981.344) (-978.808) (-976.222) -- 0:00:21
661000 -- (-981.163) (-981.331) (-980.216) [-976.867] * [-978.808] (-977.829) (-978.680) (-978.566) -- 0:00:21
661500 -- (-979.943) (-979.279) (-977.168) [-981.229] * (-978.467) (-976.675) [-982.667] (-982.846) -- 0:00:20
662000 -- [-978.949] (-980.925) (-984.079) (-980.320) * (-977.323) [-979.535] (-984.864) (-982.707) -- 0:00:20
662500 -- (-978.458) (-978.892) [-979.130] (-976.926) * (-976.861) [-978.911] (-980.976) (-980.107) -- 0:00:20
663000 -- [-978.095] (-976.149) (-976.878) (-976.499) * [-978.352] (-976.240) (-979.093) (-977.983) -- 0:00:20
663500 -- (-979.498) [-977.145] (-978.738) (-978.117) * (-977.236) [-978.131] (-980.734) (-977.052) -- 0:00:20
664000 -- (-978.456) (-977.737) (-981.258) [-976.015] * [-976.766] (-981.874) (-979.108) (-976.337) -- 0:00:20
664500 -- (-976.274) (-977.300) [-976.850] (-977.649) * [-976.843] (-977.932) (-980.521) (-978.125) -- 0:00:20
665000 -- (-976.305) (-978.145) [-977.384] (-976.653) * (-980.243) (-979.718) [-980.927] (-976.726) -- 0:00:20
Average standard deviation of split frequencies: 0.009154
665500 -- (-977.491) [-980.158] (-976.927) (-983.147) * (-977.229) (-984.617) (-984.706) [-976.920] -- 0:00:20
666000 -- (-977.672) [-977.453] (-980.283) (-981.543) * (-976.402) (-980.451) (-980.777) [-976.512] -- 0:00:20
666500 -- (-977.356) [-981.824] (-977.892) (-977.381) * [-978.569] (-976.554) (-985.820) (-976.605) -- 0:00:20
667000 -- (-977.176) (-981.182) (-976.531) [-976.305] * (-976.706) (-976.495) (-979.822) [-976.405] -- 0:00:20
667500 -- (-975.956) (-979.700) (-976.315) [-980.711] * (-978.290) (-976.468) [-977.133] (-977.487) -- 0:00:20
668000 -- (-982.899) (-980.767) (-980.876) [-980.069] * (-977.724) (-979.711) (-976.743) [-976.660] -- 0:00:20
668500 -- [-977.487] (-977.017) (-981.529) (-977.309) * (-977.425) (-979.859) [-978.849] (-978.650) -- 0:00:20
669000 -- (-977.618) [-979.195] (-979.110) (-978.854) * [-976.837] (-980.357) (-978.111) (-977.989) -- 0:00:20
669500 -- (-977.188) (-978.836) [-977.330] (-981.590) * (-977.499) (-980.282) [-976.395] (-980.909) -- 0:00:20
670000 -- (-978.115) (-978.686) (-977.166) [-976.205] * (-978.986) (-984.971) (-977.844) [-978.254] -- 0:00:20
Average standard deviation of split frequencies: 0.009700
670500 -- (-981.146) (-977.369) [-975.994] (-977.004) * (-976.693) [-977.346] (-976.857) (-982.112) -- 0:00:20
671000 -- [-978.346] (-978.779) (-977.545) (-977.974) * (-977.451) (-981.684) [-979.564] (-983.233) -- 0:00:20
671500 -- (-979.245) (-976.453) (-977.343) [-976.543] * (-978.190) [-981.381] (-980.250) (-977.998) -- 0:00:20
672000 -- [-976.672] (-979.307) (-979.429) (-977.923) * (-980.117) [-980.844] (-976.879) (-978.577) -- 0:00:20
672500 -- (-979.863) (-978.391) [-978.878] (-977.403) * (-978.078) (-984.067) [-976.791] (-978.220) -- 0:00:20
673000 -- (-980.323) (-978.954) [-978.841] (-978.955) * (-977.032) (-976.781) [-977.738] (-980.011) -- 0:00:20
673500 -- [-977.403] (-977.718) (-980.300) (-978.812) * (-978.335) [-979.639] (-976.323) (-978.157) -- 0:00:20
674000 -- (-978.835) [-978.019] (-978.484) (-985.287) * (-981.103) (-985.688) [-980.953] (-979.260) -- 0:00:20
674500 -- [-977.124] (-983.181) (-979.080) (-980.228) * (-983.175) (-982.170) [-976.878] (-976.363) -- 0:00:20
675000 -- (-977.945) (-978.683) [-980.675] (-979.667) * (-981.370) (-979.108) [-979.098] (-978.813) -- 0:00:20
Average standard deviation of split frequencies: 0.009484
675500 -- (-979.238) (-976.482) [-978.671] (-978.369) * (-978.269) (-978.086) (-976.538) [-977.619] -- 0:00:20
676000 -- (-979.164) (-977.502) [-976.020] (-976.341) * (-977.501) [-977.444] (-980.583) (-976.923) -- 0:00:20
676500 -- (-980.142) [-977.251] (-977.402) (-977.165) * (-977.386) [-979.839] (-977.389) (-977.480) -- 0:00:20
677000 -- (-980.596) [-979.468] (-979.831) (-978.526) * (-979.989) [-977.211] (-980.163) (-977.431) -- 0:00:20
677500 -- [-978.621] (-979.402) (-977.507) (-976.878) * (-978.733) [-977.727] (-981.551) (-975.916) -- 0:00:19
678000 -- (-977.592) (-979.876) (-976.279) [-977.202] * (-976.996) [-977.440] (-977.465) (-979.671) -- 0:00:19
678500 -- (-977.807) (-978.449) (-977.819) [-980.570] * (-982.164) (-977.670) (-977.009) [-978.576] -- 0:00:19
679000 -- (-977.436) [-983.069] (-980.950) (-980.783) * (-978.224) (-988.145) (-979.266) [-978.018] -- 0:00:19
679500 -- (-976.866) [-978.287] (-978.703) (-977.394) * (-977.711) (-981.686) (-979.484) [-977.343] -- 0:00:19
680000 -- (-978.557) (-978.141) (-979.325) [-978.152] * (-981.092) (-978.485) (-979.273) [-978.806] -- 0:00:19
Average standard deviation of split frequencies: 0.009327
680500 -- [-981.851] (-976.541) (-977.605) (-976.772) * (-978.502) (-978.077) [-980.053] (-979.220) -- 0:00:19
681000 -- (-976.587) (-977.640) [-977.608] (-978.543) * (-978.678) (-979.013) [-977.175] (-977.979) -- 0:00:19
681500 -- [-977.985] (-978.249) (-983.433) (-979.430) * (-977.613) (-980.675) (-977.463) [-977.994] -- 0:00:19
682000 -- (-978.583) (-978.816) (-979.555) [-979.104] * (-977.778) (-980.717) [-982.669] (-977.003) -- 0:00:19
682500 -- (-983.144) (-976.045) [-976.941] (-977.421) * [-978.484] (-977.533) (-976.541) (-977.244) -- 0:00:19
683000 -- (-976.084) (-979.295) (-977.483) [-977.335] * (-979.195) (-980.599) [-976.022] (-977.195) -- 0:00:19
683500 -- (-979.450) (-978.761) [-976.850] (-980.880) * (-977.385) (-980.658) (-977.032) [-976.733] -- 0:00:19
684000 -- [-977.278] (-978.593) (-978.331) (-979.016) * (-976.053) (-980.099) (-979.259) [-976.180] -- 0:00:19
684500 -- (-981.684) (-978.631) [-978.193] (-976.099) * [-977.819] (-977.866) (-977.201) (-978.435) -- 0:00:19
685000 -- (-977.693) [-979.866] (-978.184) (-977.822) * [-978.465] (-979.214) (-976.117) (-978.853) -- 0:00:19
Average standard deviation of split frequencies: 0.010050
685500 -- (-977.575) (-978.885) (-980.872) [-977.769] * (-982.034) (-980.609) [-976.244] (-978.155) -- 0:00:19
686000 -- (-976.921) [-977.560] (-979.737) (-976.475) * (-984.135) [-978.129] (-977.882) (-978.734) -- 0:00:19
686500 -- (-978.832) (-978.322) [-981.212] (-981.126) * [-977.335] (-981.779) (-976.633) (-978.601) -- 0:00:19
687000 -- (-978.280) (-980.424) [-977.463] (-983.272) * (-978.795) (-979.147) (-978.053) [-979.962] -- 0:00:19
687500 -- [-978.852] (-979.029) (-978.321) (-982.692) * [-976.799] (-979.544) (-976.901) (-987.226) -- 0:00:19
688000 -- [-981.185] (-977.117) (-978.971) (-982.680) * [-978.276] (-984.679) (-977.931) (-976.580) -- 0:00:19
688500 -- (-978.662) [-982.003] (-978.386) (-980.302) * (-979.061) (-982.306) [-977.148] (-977.540) -- 0:00:19
689000 -- [-979.840] (-979.136) (-982.114) (-978.611) * (-980.608) (-987.318) [-979.314] (-978.219) -- 0:00:19
689500 -- (-980.321) (-977.557) [-980.509] (-979.409) * [-978.248] (-982.521) (-984.118) (-981.080) -- 0:00:19
690000 -- (-979.863) (-979.120) [-983.221] (-979.550) * (-978.336) (-979.871) [-978.950] (-976.991) -- 0:00:19
Average standard deviation of split frequencies: 0.009385
690500 -- (-983.370) [-978.184] (-979.217) (-979.878) * (-977.561) (-983.322) [-981.073] (-977.607) -- 0:00:19
691000 -- [-977.646] (-976.455) (-978.896) (-982.418) * [-979.713] (-985.857) (-981.563) (-977.960) -- 0:00:19
691500 -- [-978.802] (-982.435) (-982.335) (-982.095) * (-976.836) (-978.349) (-977.878) [-978.426] -- 0:00:19
692000 -- (-980.047) (-976.177) [-979.859] (-977.628) * (-976.715) (-976.806) (-979.353) [-976.203] -- 0:00:19
692500 -- (-980.063) [-977.099] (-978.754) (-978.974) * (-977.474) (-977.022) (-984.352) [-976.630] -- 0:00:19
693000 -- (-978.413) (-979.976) [-979.091] (-979.857) * [-977.428] (-981.806) (-977.698) (-977.227) -- 0:00:19
693500 -- [-976.968] (-978.961) (-981.533) (-977.670) * (-978.570) (-979.718) (-978.873) [-978.010] -- 0:00:19
694000 -- (-976.906) [-978.076] (-983.515) (-985.252) * (-978.315) (-979.075) [-978.617] (-978.893) -- 0:00:18
694500 -- (-977.348) (-978.119) [-983.292] (-979.679) * (-977.722) (-978.539) [-978.443] (-981.476) -- 0:00:18
695000 -- (-980.007) (-983.468) [-978.008] (-980.031) * (-979.126) (-978.021) (-979.162) [-977.214] -- 0:00:18
Average standard deviation of split frequencies: 0.009567
695500 -- [-980.923] (-984.773) (-977.826) (-978.742) * (-980.276) (-980.379) (-978.378) [-980.763] -- 0:00:18
696000 -- [-983.186] (-976.618) (-982.177) (-980.566) * [-978.377] (-982.312) (-978.411) (-978.946) -- 0:00:18
696500 -- (-980.405) (-977.384) [-981.067] (-979.447) * [-979.430] (-979.579) (-979.939) (-976.204) -- 0:00:18
697000 -- [-979.583] (-978.044) (-978.491) (-983.526) * [-981.457] (-979.351) (-977.984) (-976.999) -- 0:00:18
697500 -- (-978.284) [-978.237] (-977.535) (-976.582) * [-981.269] (-979.806) (-977.519) (-978.192) -- 0:00:18
698000 -- (-979.999) [-978.091] (-978.734) (-976.285) * (-978.928) (-977.725) (-980.093) [-979.938] -- 0:00:18
698500 -- (-982.233) (-978.705) (-978.569) [-976.741] * [-977.535] (-983.463) (-979.701) (-981.191) -- 0:00:18
699000 -- (-981.162) (-978.815) [-979.570] (-978.802) * [-979.036] (-982.201) (-978.706) (-976.821) -- 0:00:18
699500 -- [-977.579] (-980.438) (-976.090) (-976.144) * (-980.574) (-978.542) (-976.901) [-977.571] -- 0:00:18
700000 -- (-978.371) [-978.552] (-977.840) (-978.565) * [-977.713] (-979.552) (-976.683) (-981.575) -- 0:00:18
Average standard deviation of split frequencies: 0.009713
700500 -- [-980.338] (-977.655) (-977.146) (-977.558) * (-976.452) [-981.936] (-978.020) (-981.758) -- 0:00:18
701000 -- (-986.503) [-977.182] (-976.820) (-981.297) * [-976.839] (-981.893) (-978.288) (-976.625) -- 0:00:18
701500 -- (-982.948) (-978.930) (-980.951) [-977.385] * [-979.367] (-981.956) (-977.828) (-976.961) -- 0:00:18
702000 -- (-983.847) (-977.462) [-979.211] (-978.043) * (-978.365) (-978.070) (-977.615) [-976.436] -- 0:00:18
702500 -- (-978.744) (-976.919) (-976.650) [-979.215] * (-978.741) [-979.139] (-976.874) (-977.904) -- 0:00:18
703000 -- (-978.706) (-979.175) [-976.409] (-979.123) * (-977.767) (-976.543) (-976.567) [-981.941] -- 0:00:18
703500 -- (-979.047) (-982.595) (-977.113) [-976.372] * [-977.966] (-980.322) (-983.927) (-985.620) -- 0:00:18
704000 -- (-981.402) (-983.396) [-977.194] (-977.648) * (-977.170) (-983.413) [-977.764] (-978.740) -- 0:00:18
704500 -- [-976.243] (-978.556) (-978.369) (-977.541) * [-977.828] (-979.638) (-976.334) (-980.201) -- 0:00:18
705000 -- [-977.056] (-978.845) (-978.055) (-979.940) * (-980.117) (-980.281) [-977.733] (-977.902) -- 0:00:18
Average standard deviation of split frequencies: 0.009765
705500 -- (-977.182) (-982.253) [-978.778] (-978.931) * (-979.449) (-976.913) [-981.952] (-982.333) -- 0:00:18
706000 -- (-979.762) (-979.652) (-978.990) [-983.940] * (-978.002) (-976.212) (-982.246) [-977.745] -- 0:00:18
706500 -- (-978.598) (-978.118) (-984.736) [-980.349] * (-977.178) (-976.212) (-978.177) [-977.207] -- 0:00:18
707000 -- [-979.960] (-979.822) (-977.090) (-979.614) * (-977.328) [-977.550] (-978.808) (-977.037) -- 0:00:18
707500 -- (-978.336) (-976.271) [-976.835] (-981.750) * (-976.292) [-982.061] (-978.831) (-978.189) -- 0:00:18
708000 -- (-978.002) [-976.502] (-977.412) (-977.162) * [-976.222] (-978.082) (-976.418) (-978.005) -- 0:00:18
708500 -- [-976.879] (-977.369) (-978.441) (-977.501) * [-976.376] (-976.738) (-977.459) (-979.869) -- 0:00:18
709000 -- (-979.994) (-983.266) [-976.968] (-979.094) * (-977.809) (-983.630) [-977.418] (-978.095) -- 0:00:18
709500 -- (-977.293) [-979.115] (-977.488) (-978.194) * (-977.236) (-978.780) [-979.205] (-979.000) -- 0:00:18
710000 -- [-976.826] (-978.643) (-978.887) (-977.391) * (-978.937) (-977.352) [-977.648] (-980.935) -- 0:00:17
Average standard deviation of split frequencies: 0.009494
710500 -- [-977.354] (-979.453) (-980.420) (-978.554) * (-981.053) (-975.952) (-977.489) [-976.194] -- 0:00:17
711000 -- (-978.469) (-979.830) [-978.291] (-976.061) * (-981.456) (-976.540) [-979.569] (-977.993) -- 0:00:17
711500 -- [-976.319] (-977.738) (-977.249) (-976.130) * (-979.906) [-981.632] (-981.574) (-978.111) -- 0:00:17
712000 -- (-976.659) (-978.702) [-977.102] (-977.264) * (-976.566) (-979.647) (-981.535) [-977.763] -- 0:00:17
712500 -- [-976.723] (-982.312) (-977.112) (-976.801) * (-976.340) (-979.618) (-977.456) [-977.713] -- 0:00:17
713000 -- (-976.601) (-982.907) [-976.559] (-976.883) * (-978.274) [-978.247] (-979.263) (-976.817) -- 0:00:17
713500 -- [-979.576] (-979.932) (-976.428) (-980.980) * (-980.546) (-978.081) [-978.687] (-976.827) -- 0:00:17
714000 -- (-977.625) (-978.934) [-980.361] (-977.791) * (-977.623) [-979.299] (-979.249) (-976.751) -- 0:00:17
714500 -- (-979.547) (-976.476) (-978.641) [-980.587] * [-976.352] (-976.696) (-978.162) (-977.443) -- 0:00:17
715000 -- (-976.407) (-977.924) [-976.244] (-978.426) * (-977.544) [-976.370] (-980.541) (-978.130) -- 0:00:17
Average standard deviation of split frequencies: 0.009382
715500 -- (-978.014) (-977.767) [-976.573] (-978.804) * [-976.094] (-975.970) (-979.702) (-976.390) -- 0:00:17
716000 -- (-979.079) [-977.446] (-977.895) (-979.353) * [-980.505] (-976.290) (-978.391) (-976.078) -- 0:00:17
716500 -- (-982.170) (-977.670) [-976.485] (-980.486) * [-978.219] (-978.752) (-978.403) (-983.385) -- 0:00:17
717000 -- (-978.897) [-980.155] (-978.342) (-976.775) * [-976.537] (-978.583) (-977.508) (-977.041) -- 0:00:17
717500 -- [-978.333] (-978.810) (-977.795) (-975.984) * (-979.626) [-977.401] (-978.932) (-978.627) -- 0:00:17
718000 -- (-979.880) [-979.247] (-981.747) (-977.736) * (-977.420) [-977.368] (-979.172) (-975.997) -- 0:00:17
718500 -- (-980.758) (-977.265) (-977.713) [-977.095] * [-979.861] (-983.861) (-981.960) (-979.096) -- 0:00:17
719000 -- (-981.070) (-981.455) (-976.750) [-976.989] * (-983.184) (-977.960) (-983.427) [-977.827] -- 0:00:17
719500 -- (-978.138) [-978.593] (-978.069) (-976.974) * (-978.562) (-978.030) (-981.262) [-976.599] -- 0:00:17
720000 -- (-977.761) (-980.644) [-978.827] (-976.615) * (-978.824) [-976.211] (-979.714) (-976.872) -- 0:00:17
Average standard deviation of split frequencies: 0.009485
720500 -- (-980.572) (-978.626) [-978.812] (-976.594) * (-978.522) (-976.992) [-979.949] (-977.233) -- 0:00:17
721000 -- (-982.019) (-980.131) [-978.201] (-977.866) * [-977.151] (-977.936) (-978.258) (-980.008) -- 0:00:17
721500 -- (-980.855) (-978.413) [-977.489] (-976.222) * (-981.038) (-979.603) (-976.751) [-978.069] -- 0:00:17
722000 -- [-978.660] (-978.969) (-976.563) (-984.822) * (-978.237) (-979.905) (-977.662) [-977.124] -- 0:00:17
722500 -- (-979.166) (-979.590) [-978.490] (-979.818) * [-978.358] (-980.548) (-976.322) (-978.866) -- 0:00:17
723000 -- [-977.382] (-976.895) (-978.125) (-977.325) * (-978.051) (-979.107) [-978.258] (-978.438) -- 0:00:17
723500 -- (-980.249) (-980.410) (-981.959) [-978.112] * (-977.595) [-978.424] (-976.794) (-978.229) -- 0:00:17
724000 -- [-978.479] (-981.711) (-978.087) (-976.809) * [-976.050] (-977.657) (-981.506) (-978.461) -- 0:00:17
724500 -- (-980.754) (-981.182) (-977.240) [-978.119] * (-979.501) (-978.800) [-980.992] (-976.523) -- 0:00:17
725000 -- (-980.479) [-980.057] (-978.109) (-978.110) * (-981.066) (-983.335) (-978.640) [-977.032] -- 0:00:17
Average standard deviation of split frequencies: 0.009740
725500 -- (-977.255) (-976.305) [-977.400] (-978.463) * [-976.963] (-979.787) (-976.492) (-977.698) -- 0:00:17
726000 -- (-979.583) [-978.411] (-977.030) (-977.153) * [-976.762] (-976.531) (-981.008) (-978.363) -- 0:00:16
726500 -- (-977.999) (-979.918) [-979.022] (-975.907) * [-976.388] (-976.618) (-976.154) (-979.164) -- 0:00:16
727000 -- (-978.056) (-980.925) (-976.858) [-976.631] * (-976.183) (-976.011) (-978.526) [-978.006] -- 0:00:16
727500 -- (-978.414) [-980.383] (-977.010) (-978.320) * [-978.589] (-983.634) (-979.678) (-978.061) -- 0:00:16
728000 -- (-977.768) (-979.702) [-976.988] (-979.231) * (-980.341) (-980.881) (-977.946) [-976.291] -- 0:00:16
728500 -- (-979.175) (-977.413) (-976.988) [-977.463] * (-976.475) (-977.172) (-978.665) [-976.317] -- 0:00:16
729000 -- (-979.469) (-979.118) [-981.903] (-977.345) * (-982.134) (-977.715) (-977.610) [-976.319] -- 0:00:16
729500 -- (-979.570) [-977.754] (-977.073) (-977.218) * (-977.761) (-977.264) (-983.761) [-978.756] -- 0:00:16
730000 -- (-981.689) (-977.713) (-977.300) [-975.979] * [-977.486] (-976.705) (-981.360) (-977.682) -- 0:00:16
Average standard deviation of split frequencies: 0.010000
730500 -- (-978.189) (-978.377) (-980.328) [-976.088] * (-977.394) (-977.787) (-976.032) [-977.219] -- 0:00:16
731000 -- (-977.217) (-978.897) (-978.795) [-978.436] * (-978.395) [-977.918] (-976.496) (-978.720) -- 0:00:16
731500 -- (-979.959) (-977.746) [-977.871] (-979.080) * (-976.287) (-976.732) (-978.614) [-976.952] -- 0:00:16
732000 -- (-981.368) [-977.219] (-977.213) (-977.951) * [-981.161] (-976.679) (-976.597) (-980.113) -- 0:00:16
732500 -- (-979.540) (-977.164) [-978.119] (-977.818) * (-979.305) (-976.610) [-979.044] (-978.129) -- 0:00:16
733000 -- (-979.085) (-980.769) [-977.165] (-977.764) * (-982.862) (-977.408) [-977.276] (-977.605) -- 0:00:16
733500 -- (-977.278) (-981.521) (-976.544) [-977.326] * (-978.116) [-979.296] (-981.837) (-978.839) -- 0:00:16
734000 -- (-977.324) (-978.510) [-976.979] (-977.220) * [-976.899] (-976.596) (-976.295) (-978.235) -- 0:00:16
734500 -- (-981.714) (-976.976) [-978.390] (-977.933) * (-976.544) [-979.118] (-977.329) (-976.946) -- 0:00:16
735000 -- (-976.599) (-979.947) [-977.668] (-979.366) * (-976.377) (-981.019) [-977.446] (-976.311) -- 0:00:16
Average standard deviation of split frequencies: 0.009247
735500 -- (-977.183) (-978.278) [-977.157] (-978.749) * (-978.181) (-981.983) [-976.107] (-977.146) -- 0:00:16
736000 -- (-977.095) [-977.420] (-978.482) (-979.390) * (-979.985) [-977.606] (-977.758) (-978.220) -- 0:00:16
736500 -- (-978.071) (-978.736) [-977.187] (-978.873) * [-984.405] (-979.178) (-979.606) (-976.158) -- 0:00:16
737000 -- (-977.436) (-981.952) [-978.694] (-980.571) * (-981.295) (-979.407) [-976.648] (-977.354) -- 0:00:16
737500 -- (-978.357) (-977.945) [-977.178] (-980.116) * (-977.880) (-978.330) [-976.013] (-978.363) -- 0:00:16
738000 -- [-976.819] (-979.819) (-980.760) (-979.399) * (-981.136) (-984.513) [-975.897] (-976.902) -- 0:00:16
738500 -- (-976.336) [-977.663] (-977.028) (-976.637) * [-977.860] (-977.324) (-978.747) (-976.361) -- 0:00:16
739000 -- (-977.571) [-976.632] (-977.002) (-976.589) * (-978.203) (-977.526) (-977.305) [-977.969] -- 0:00:16
739500 -- (-978.049) (-976.535) (-977.387) [-978.826] * [-978.835] (-981.064) (-978.468) (-976.576) -- 0:00:16
740000 -- (-980.133) (-978.945) [-977.887] (-977.196) * (-979.328) [-978.223] (-982.666) (-977.658) -- 0:00:16
Average standard deviation of split frequencies: 0.009507
740500 -- (-978.764) (-981.697) [-977.735] (-976.010) * (-976.879) [-977.519] (-979.152) (-980.250) -- 0:00:16
741000 -- [-979.767] (-984.352) (-987.195) (-978.539) * (-980.789) (-977.985) (-977.604) [-977.949] -- 0:00:16
741500 -- [-979.167] (-983.560) (-979.352) (-980.118) * [-978.529] (-979.240) (-977.265) (-977.417) -- 0:00:16
742000 -- [-978.496] (-979.937) (-977.958) (-977.810) * (-977.880) (-978.600) (-977.281) [-979.267] -- 0:00:15
742500 -- (-978.869) [-977.636] (-978.403) (-978.258) * [-978.155] (-979.583) (-976.868) (-978.143) -- 0:00:15
743000 -- (-980.210) (-980.702) (-981.300) [-976.838] * [-977.367] (-977.066) (-980.762) (-976.982) -- 0:00:15
743500 -- (-978.613) (-978.502) (-979.520) [-977.716] * (-977.632) [-978.547] (-976.731) (-978.205) -- 0:00:15
744000 -- (-979.645) [-977.059] (-982.464) (-978.745) * (-978.769) (-976.474) (-977.266) [-978.520] -- 0:00:15
744500 -- (-978.381) [-977.510] (-980.073) (-979.284) * [-979.594] (-978.820) (-978.038) (-978.123) -- 0:00:15
745000 -- (-978.469) [-977.903] (-979.322) (-978.887) * (-975.948) (-983.113) [-976.710] (-980.782) -- 0:00:15
Average standard deviation of split frequencies: 0.009637
745500 -- (-978.928) [-977.576] (-984.413) (-979.668) * (-979.706) (-978.769) [-976.697] (-977.599) -- 0:00:15
746000 -- (-978.455) (-977.149) (-976.011) [-976.548] * [-979.339] (-980.138) (-978.260) (-977.634) -- 0:00:15
746500 -- (-977.748) (-977.228) (-976.494) [-977.495] * (-979.119) (-978.425) [-981.230] (-976.471) -- 0:00:15
747000 -- (-979.421) (-977.213) [-977.211] (-978.764) * (-979.531) (-976.981) [-978.856] (-977.053) -- 0:00:15
747500 -- (-978.942) (-976.170) (-976.981) [-976.999] * (-976.524) (-978.362) (-978.883) [-976.015] -- 0:00:15
748000 -- (-979.669) [-977.907] (-978.281) (-977.326) * [-981.573] (-976.332) (-984.293) (-978.031) -- 0:00:15
748500 -- (-977.485) [-979.878] (-981.874) (-976.491) * (-978.455) (-976.585) (-976.308) [-975.857] -- 0:00:15
749000 -- (-976.976) (-979.832) [-976.920] (-978.409) * (-978.825) (-977.016) [-976.188] (-977.927) -- 0:00:15
749500 -- (-978.449) [-978.255] (-978.472) (-976.963) * (-978.831) (-976.962) (-979.291) [-976.322] -- 0:00:15
750000 -- (-979.595) [-976.917] (-980.447) (-976.729) * (-980.607) (-977.351) (-979.949) [-977.829] -- 0:00:15
Average standard deviation of split frequencies: 0.008949
750500 -- (-978.843) [-975.963] (-978.843) (-976.803) * (-980.615) [-977.868] (-978.959) (-979.183) -- 0:00:15
751000 -- (-976.809) (-976.148) (-977.569) [-976.908] * (-978.284) [-976.686] (-981.551) (-979.276) -- 0:00:15
751500 -- [-977.660] (-979.062) (-977.601) (-978.193) * [-979.239] (-975.996) (-979.233) (-979.129) -- 0:00:15
752000 -- (-976.625) (-980.678) (-976.953) [-976.492] * [-978.536] (-977.322) (-980.693) (-977.913) -- 0:00:15
752500 -- (-978.452) (-976.615) (-976.644) [-977.522] * (-978.977) (-977.186) (-978.416) [-977.775] -- 0:00:15
753000 -- (-977.730) (-977.291) (-977.774) [-976.006] * [-981.401] (-976.549) (-977.632) (-979.710) -- 0:00:15
753500 -- (-979.737) [-976.425] (-979.078) (-978.112) * (-977.129) (-976.549) [-976.917] (-976.245) -- 0:00:15
754000 -- (-981.306) [-976.619] (-979.824) (-975.972) * (-977.626) (-976.564) (-976.919) [-976.245] -- 0:00:15
754500 -- (-977.242) (-976.651) (-978.667) [-980.033] * [-977.488] (-976.823) (-976.313) (-982.855) -- 0:00:15
755000 -- [-981.729] (-977.781) (-976.342) (-980.707) * (-978.409) (-977.658) (-976.955) [-977.615] -- 0:00:15
Average standard deviation of split frequencies: 0.008769
755500 -- (-977.742) (-977.832) (-976.263) [-982.070] * (-976.494) [-978.380] (-977.993) (-976.736) -- 0:00:15
756000 -- (-976.043) (-980.775) (-977.675) [-979.265] * [-976.557] (-984.776) (-977.132) (-978.020) -- 0:00:15
756500 -- (-977.188) (-977.418) [-976.797] (-980.332) * (-976.942) [-976.635] (-977.995) (-977.820) -- 0:00:15
757000 -- (-980.361) (-976.107) [-976.719] (-981.106) * [-977.434] (-975.893) (-978.785) (-977.951) -- 0:00:15
757500 -- (-977.572) (-977.488) [-980.646] (-978.837) * [-977.193] (-975.895) (-980.827) (-983.616) -- 0:00:15
758000 -- (-981.408) [-978.533] (-977.748) (-978.540) * (-977.542) [-975.967] (-982.983) (-978.191) -- 0:00:15
758500 -- (-978.718) (-978.767) (-977.316) [-977.295] * (-978.949) [-976.085] (-979.465) (-978.810) -- 0:00:14
759000 -- (-981.342) [-976.415] (-980.007) (-979.511) * (-979.077) (-976.253) [-981.928] (-980.216) -- 0:00:14
759500 -- (-978.411) (-979.059) (-977.976) [-977.914] * (-977.320) [-977.225] (-977.699) (-977.130) -- 0:00:14
760000 -- [-978.571] (-978.417) (-977.304) (-977.870) * (-980.460) (-976.077) [-978.493] (-979.593) -- 0:00:14
Average standard deviation of split frequencies: 0.008635
760500 -- (-976.692) [-976.524] (-979.225) (-976.596) * (-977.945) [-979.292] (-977.228) (-976.636) -- 0:00:14
761000 -- (-976.525) (-975.985) [-976.518] (-979.015) * (-978.612) [-976.978] (-977.077) (-979.185) -- 0:00:14
761500 -- (-977.881) (-977.667) (-975.878) [-977.160] * [-983.562] (-978.738) (-976.960) (-976.978) -- 0:00:14
762000 -- (-976.869) (-981.494) (-977.535) [-977.845] * (-978.655) (-979.055) (-977.972) [-978.767] -- 0:00:14
762500 -- (-978.418) [-979.363] (-979.158) (-981.344) * (-978.511) (-977.174) (-977.628) [-977.560] -- 0:00:14
763000 -- (-978.751) [-976.008] (-980.598) (-977.533) * (-977.358) (-977.837) (-981.046) [-978.691] -- 0:00:14
763500 -- [-978.322] (-977.571) (-977.264) (-977.386) * (-978.393) [-977.092] (-980.248) (-978.983) -- 0:00:14
764000 -- [-977.429] (-979.358) (-980.024) (-976.109) * (-976.655) (-976.999) [-984.058] (-980.522) -- 0:00:14
764500 -- [-976.164] (-978.889) (-979.803) (-976.203) * (-976.430) (-977.766) [-977.068] (-977.460) -- 0:00:14
765000 -- (-977.122) [-976.669] (-979.314) (-977.876) * (-983.585) [-977.138] (-978.331) (-980.347) -- 0:00:14
Average standard deviation of split frequencies: 0.008575
765500 -- [-979.281] (-976.712) (-981.009) (-976.630) * (-977.925) (-980.123) [-978.552] (-978.763) -- 0:00:14
766000 -- (-978.117) (-978.598) (-976.741) [-978.303] * [-976.309] (-982.217) (-977.606) (-977.158) -- 0:00:14
766500 -- (-979.241) (-979.511) (-976.412) [-977.277] * (-978.981) [-976.860] (-977.382) (-979.439) -- 0:00:14
767000 -- (-984.401) (-978.753) (-979.508) [-977.743] * [-977.584] (-979.443) (-981.203) (-978.356) -- 0:00:14
767500 -- (-979.034) [-979.643] (-978.960) (-978.447) * [-977.437] (-979.100) (-984.765) (-977.116) -- 0:00:14
768000 -- (-979.323) (-981.075) (-982.002) [-977.101] * [-978.752] (-978.863) (-979.686) (-976.199) -- 0:00:14
768500 -- (-979.340) (-981.299) (-982.655) [-976.716] * (-977.396) (-977.182) (-979.636) [-979.222] -- 0:00:14
769000 -- (-979.595) (-977.911) [-978.235] (-976.719) * (-977.294) (-979.568) (-979.214) [-976.839] -- 0:00:14
769500 -- [-981.520] (-978.820) (-979.111) (-978.072) * (-977.452) (-979.951) [-978.663] (-977.750) -- 0:00:14
770000 -- [-979.096] (-979.185) (-982.029) (-977.837) * (-982.023) (-981.571) [-976.623] (-976.919) -- 0:00:14
Average standard deviation of split frequencies: 0.008645
770500 -- [-977.809] (-978.359) (-977.230) (-977.141) * [-978.755] (-978.624) (-978.356) (-978.284) -- 0:00:14
771000 -- (-978.045) (-981.894) (-977.190) [-978.067] * (-984.341) [-977.594] (-978.423) (-977.222) -- 0:00:14
771500 -- [-978.950] (-977.652) (-980.104) (-977.501) * (-978.150) [-978.706] (-975.815) (-979.895) -- 0:00:14
772000 -- (-979.537) [-977.877] (-980.116) (-977.731) * (-977.236) [-977.481] (-978.123) (-977.295) -- 0:00:14
772500 -- (-977.926) (-978.648) [-977.512] (-977.359) * [-977.567] (-983.280) (-977.490) (-977.434) -- 0:00:14
773000 -- (-977.902) (-980.673) (-978.849) [-979.252] * [-976.542] (-981.670) (-979.922) (-978.848) -- 0:00:14
773500 -- (-979.493) (-979.604) (-978.182) [-978.440] * (-977.683) (-981.152) [-978.860] (-980.304) -- 0:00:14
774000 -- (-982.470) (-978.124) [-978.943] (-976.545) * (-977.191) [-976.924] (-977.811) (-978.384) -- 0:00:14
774500 -- (-982.672) (-978.868) [-978.296] (-978.321) * (-976.953) (-977.572) [-976.625] (-977.058) -- 0:00:13
775000 -- (-983.713) [-983.489] (-978.508) (-977.510) * (-979.187) (-977.918) [-977.091] (-978.075) -- 0:00:13
Average standard deviation of split frequencies: 0.008991
775500 -- (-981.307) (-979.527) (-976.580) [-980.103] * (-979.034) (-978.091) (-977.637) [-975.895] -- 0:00:13
776000 -- (-978.872) (-978.061) (-976.140) [-976.651] * (-978.095) (-980.126) [-976.904] (-978.926) -- 0:00:13
776500 -- (-978.979) [-977.175] (-977.277) (-976.779) * [-977.507] (-980.087) (-976.678) (-979.360) -- 0:00:13
777000 -- (-978.591) (-982.616) (-977.509) [-982.881] * [-976.489] (-980.387) (-983.041) (-978.598) -- 0:00:13
777500 -- (-979.341) (-978.968) (-977.755) [-979.145] * [-978.476] (-980.340) (-980.993) (-979.039) -- 0:00:13
778000 -- (-978.267) [-981.546] (-979.243) (-977.602) * (-980.526) [-978.973] (-980.376) (-979.588) -- 0:00:13
778500 -- (-977.713) (-980.151) (-978.924) [-978.996] * [-979.646] (-977.315) (-979.314) (-979.424) -- 0:00:13
779000 -- [-977.403] (-977.282) (-977.255) (-978.369) * (-978.392) [-977.567] (-978.472) (-977.277) -- 0:00:13
779500 -- (-981.467) [-979.565] (-977.147) (-980.254) * (-976.984) (-977.732) (-978.257) [-980.019] -- 0:00:13
780000 -- (-982.240) (-976.477) [-978.381] (-980.408) * [-976.526] (-978.538) (-979.336) (-978.523) -- 0:00:13
Average standard deviation of split frequencies: 0.009098
780500 -- [-977.979] (-976.662) (-977.264) (-977.500) * (-978.114) (-985.618) [-977.629] (-979.410) -- 0:00:13
781000 -- (-980.945) (-976.950) (-981.349) [-976.647] * (-977.312) (-981.317) (-977.679) [-980.262] -- 0:00:13
781500 -- (-978.909) [-981.455] (-977.286) (-977.089) * (-977.274) (-979.388) [-977.349] (-977.276) -- 0:00:13
782000 -- [-977.756] (-978.325) (-977.151) (-977.452) * (-979.702) [-979.060] (-978.951) (-979.597) -- 0:00:13
782500 -- (-977.412) (-978.230) [-976.021] (-979.962) * (-979.953) [-977.416] (-980.510) (-978.244) -- 0:00:13
783000 -- [-976.597] (-979.258) (-975.971) (-979.331) * [-977.672] (-976.934) (-979.905) (-976.909) -- 0:00:13
783500 -- (-978.334) (-983.404) (-977.692) [-978.191] * (-976.454) [-977.330] (-978.677) (-979.292) -- 0:00:13
784000 -- (-978.286) (-976.842) (-979.422) [-981.558] * (-977.034) (-977.572) (-979.826) [-978.859] -- 0:00:13
784500 -- (-976.637) (-977.663) [-980.697] (-978.286) * [-977.254] (-977.019) (-976.264) (-977.299) -- 0:00:13
785000 -- (-976.841) (-979.189) (-977.655) [-976.500] * (-977.363) [-977.794] (-978.377) (-977.569) -- 0:00:13
Average standard deviation of split frequencies: 0.008676
785500 -- (-978.221) (-979.157) [-977.128] (-979.010) * [-980.547] (-981.164) (-976.292) (-983.012) -- 0:00:13
786000 -- (-979.756) (-978.363) (-981.116) [-981.127] * (-980.500) (-977.022) (-977.923) [-981.611] -- 0:00:13
786500 -- (-981.713) (-976.710) (-978.882) [-977.246] * (-976.913) (-976.961) [-977.532] (-977.202) -- 0:00:13
787000 -- (-984.616) (-977.713) (-981.434) [-977.304] * [-976.562] (-978.355) (-977.497) (-986.899) -- 0:00:13
787500 -- (-978.968) [-978.878] (-977.622) (-978.691) * (-978.791) [-978.980] (-976.957) (-977.938) -- 0:00:13
788000 -- (-978.169) (-976.852) (-977.649) [-977.733] * (-976.669) (-981.925) [-975.893] (-980.700) -- 0:00:13
788500 -- (-976.999) (-979.594) (-980.323) [-977.679] * [-977.850] (-979.224) (-976.834) (-989.486) -- 0:00:13
789000 -- (-976.821) [-978.388] (-978.344) (-983.934) * (-976.895) [-977.957] (-979.778) (-981.030) -- 0:00:13
789500 -- [-981.263] (-980.761) (-977.588) (-981.452) * [-976.648] (-979.982) (-980.365) (-979.525) -- 0:00:13
790000 -- (-977.355) [-977.348] (-976.605) (-980.500) * (-983.061) [-979.175] (-977.692) (-977.723) -- 0:00:13
Average standard deviation of split frequencies: 0.008546
790500 -- (-979.826) [-978.603] (-978.995) (-977.927) * (-980.856) [-978.068] (-976.425) (-976.635) -- 0:00:12
791000 -- [-979.132] (-977.956) (-980.098) (-980.342) * (-980.233) (-977.944) (-977.768) [-981.719] -- 0:00:12
791500 -- (-981.548) [-978.112] (-982.915) (-976.782) * (-977.776) [-980.759] (-978.707) (-979.681) -- 0:00:12
792000 -- [-976.114] (-979.513) (-977.691) (-976.977) * (-977.522) (-978.206) [-978.338] (-979.007) -- 0:00:12
792500 -- [-976.278] (-980.324) (-976.907) (-979.020) * (-979.872) (-978.034) (-977.205) [-978.721] -- 0:00:12
793000 -- [-977.151] (-978.062) (-980.210) (-979.061) * (-981.645) (-977.536) (-981.646) [-977.868] -- 0:00:12
793500 -- (-976.597) [-977.564] (-980.248) (-976.948) * (-978.944) [-979.238] (-978.575) (-979.733) -- 0:00:12
794000 -- (-976.699) [-977.791] (-977.420) (-977.510) * (-979.329) (-979.193) [-979.838] (-977.344) -- 0:00:12
794500 -- (-978.800) [-977.143] (-979.252) (-980.312) * (-976.604) [-979.617] (-977.959) (-976.119) -- 0:00:12
795000 -- (-977.020) (-976.866) [-977.410] (-978.819) * (-977.749) [-977.942] (-977.064) (-976.357) -- 0:00:12
Average standard deviation of split frequencies: 0.008488
795500 -- [-981.734] (-976.764) (-979.357) (-982.151) * (-978.075) [-979.594] (-977.429) (-977.032) -- 0:00:12
796000 -- (-978.405) [-980.642] (-978.791) (-977.339) * (-977.063) (-984.383) [-979.956] (-977.467) -- 0:00:12
796500 -- (-977.975) (-978.692) [-977.020] (-978.528) * (-976.945) (-979.329) [-978.555] (-977.402) -- 0:00:12
797000 -- [-980.625] (-977.266) (-978.240) (-976.269) * [-978.884] (-980.094) (-981.322) (-979.502) -- 0:00:12
797500 -- (-980.968) (-979.954) (-977.282) [-978.873] * (-980.386) (-978.579) [-976.719] (-976.676) -- 0:00:12
798000 -- (-978.038) (-978.914) (-976.599) [-980.826] * [-979.289] (-980.206) (-977.895) (-979.597) -- 0:00:12
798500 -- [-976.567] (-977.883) (-976.066) (-977.369) * (-978.861) (-982.938) (-978.694) [-978.787] -- 0:00:12
799000 -- (-978.294) (-979.601) (-976.906) [-978.030] * [-979.048] (-984.465) (-977.159) (-979.684) -- 0:00:12
799500 -- (-979.633) (-980.594) (-978.196) [-979.754] * (-979.273) (-980.540) [-976.546] (-978.788) -- 0:00:12
800000 -- (-979.480) (-979.580) [-979.712] (-981.305) * (-982.547) (-976.066) (-979.941) [-976.695] -- 0:00:12
Average standard deviation of split frequencies: 0.008596
800500 -- (-977.348) [-977.038] (-977.290) (-977.925) * (-979.876) (-976.586) (-976.841) [-978.197] -- 0:00:12
801000 -- [-976.405] (-977.123) (-976.757) (-979.325) * (-979.935) (-977.073) [-976.232] (-976.793) -- 0:00:12
801500 -- [-976.038] (-978.231) (-979.696) (-976.138) * (-976.776) (-978.129) [-977.795] (-976.763) -- 0:00:12
802000 -- [-976.606] (-976.017) (-980.205) (-977.755) * [-977.327] (-977.837) (-976.998) (-977.325) -- 0:00:12
802500 -- [-977.330] (-977.876) (-979.202) (-981.236) * (-981.366) [-980.967] (-976.362) (-978.050) -- 0:00:12
803000 -- (-984.212) [-976.090] (-978.552) (-977.841) * (-979.247) (-978.783) (-978.896) [-979.423] -- 0:00:12
803500 -- (-978.568) (-977.594) [-980.611] (-980.724) * (-977.081) (-980.921) [-976.319] (-976.931) -- 0:00:12
804000 -- (-977.337) (-977.854) [-979.865] (-978.243) * (-977.527) [-977.983] (-976.276) (-977.848) -- 0:00:12
804500 -- (-978.431) [-977.779] (-979.229) (-982.707) * (-976.915) (-976.884) (-982.847) [-981.023] -- 0:00:12
805000 -- (-977.681) (-978.160) (-978.405) [-978.357] * (-977.443) (-976.314) [-976.790] (-981.141) -- 0:00:12
Average standard deviation of split frequencies: 0.008890
805500 -- (-976.217) [-977.279] (-982.529) (-978.357) * (-978.351) (-977.603) [-977.970] (-979.938) -- 0:00:12
806000 -- (-976.760) (-977.418) [-977.282] (-975.985) * (-978.375) (-977.832) (-978.234) [-978.156] -- 0:00:12
806500 -- [-976.800] (-980.576) (-979.463) (-976.638) * (-978.222) [-978.673] (-977.761) (-976.190) -- 0:00:11
807000 -- (-977.443) (-981.047) (-977.554) [-981.966] * (-977.010) [-975.864] (-976.641) (-977.071) -- 0:00:11
807500 -- (-977.931) (-979.920) (-977.383) [-976.554] * (-979.326) (-975.869) (-978.494) [-980.926] -- 0:00:11
808000 -- (-977.464) (-979.837) [-981.683] (-978.173) * (-977.282) (-976.210) [-978.985] (-980.296) -- 0:00:11
808500 -- (-978.767) (-979.903) [-980.293] (-982.448) * (-977.225) (-976.343) [-977.521] (-980.168) -- 0:00:11
809000 -- (-976.596) [-977.241] (-978.687) (-976.675) * (-977.917) (-979.972) (-976.671) [-977.577] -- 0:00:11
809500 -- (-977.379) (-978.363) (-978.288) [-978.501] * (-979.149) (-977.657) [-976.210] (-977.777) -- 0:00:11
810000 -- [-977.537] (-978.376) (-979.379) (-977.525) * (-979.857) [-978.211] (-977.980) (-977.074) -- 0:00:11
Average standard deviation of split frequencies: 0.008451
810500 -- [-979.852] (-979.773) (-978.754) (-978.086) * (-979.951) [-983.082] (-977.195) (-977.826) -- 0:00:11
811000 -- [-977.176] (-985.941) (-976.905) (-977.675) * (-981.036) (-977.449) [-976.460] (-977.678) -- 0:00:11
811500 -- (-979.262) [-982.471] (-976.173) (-979.204) * [-978.238] (-976.450) (-976.613) (-980.530) -- 0:00:11
812000 -- (-978.276) (-982.417) [-976.685] (-979.481) * [-978.885] (-976.788) (-977.406) (-980.276) -- 0:00:11
812500 -- [-979.648] (-979.992) (-976.444) (-978.132) * (-978.889) (-978.146) [-976.955] (-977.445) -- 0:00:11
813000 -- (-976.028) [-979.228] (-977.913) (-982.011) * [-976.653] (-977.873) (-981.659) (-977.466) -- 0:00:11
813500 -- (-979.183) [-978.451] (-978.305) (-977.915) * [-976.676] (-980.990) (-981.211) (-980.390) -- 0:00:11
814000 -- (-982.387) [-976.810] (-978.697) (-980.318) * (-978.287) (-977.220) [-980.878] (-978.785) -- 0:00:11
814500 -- [-976.497] (-979.771) (-976.900) (-977.392) * (-978.087) (-980.386) [-978.173] (-985.506) -- 0:00:11
815000 -- (-976.277) (-977.444) [-977.919] (-976.768) * [-978.108] (-977.469) (-978.750) (-984.677) -- 0:00:11
Average standard deviation of split frequencies: 0.008280
815500 -- (-976.932) (-976.792) (-977.988) [-977.005] * [-979.615] (-977.440) (-979.881) (-982.594) -- 0:00:11
816000 -- (-977.076) (-978.385) [-977.907] (-978.459) * (-981.588) [-983.659] (-982.472) (-978.952) -- 0:00:11
816500 -- (-976.056) (-977.381) (-984.798) [-976.023] * (-980.303) (-979.245) [-977.410] (-978.722) -- 0:00:11
817000 -- (-978.701) [-976.537] (-978.227) (-977.360) * (-978.422) [-978.129] (-986.011) (-980.068) -- 0:00:11
817500 -- (-976.739) [-978.636] (-980.469) (-976.613) * [-979.781] (-975.863) (-979.612) (-977.811) -- 0:00:11
818000 -- (-979.685) (-982.255) [-979.667] (-980.819) * (-982.707) (-977.456) [-978.346] (-977.072) -- 0:00:11
818500 -- [-977.556] (-979.625) (-976.166) (-978.280) * (-979.120) [-977.480] (-977.802) (-978.099) -- 0:00:11
819000 -- (-980.556) (-980.968) (-977.611) [-977.459] * (-981.320) (-976.411) [-979.643] (-980.195) -- 0:00:11
819500 -- [-978.698] (-977.276) (-979.425) (-979.745) * [-976.800] (-978.374) (-978.039) (-976.624) -- 0:00:11
820000 -- (-975.900) (-978.145) [-978.121] (-981.165) * [-975.964] (-976.094) (-980.086) (-978.888) -- 0:00:11
Average standard deviation of split frequencies: 0.008463
820500 -- (-976.910) (-977.721) (-979.038) [-980.155] * (-978.127) (-976.550) [-979.859] (-981.805) -- 0:00:11
821000 -- [-978.525] (-977.970) (-984.804) (-978.300) * (-976.892) (-976.609) [-978.319] (-982.035) -- 0:00:11
821500 -- (-978.521) (-979.595) (-977.222) [-978.247] * (-977.768) (-976.385) (-980.482) [-981.910] -- 0:00:11
822000 -- [-978.317] (-976.953) (-980.760) (-977.945) * (-979.264) (-978.135) (-977.997) [-981.312] -- 0:00:11
822500 -- (-977.371) (-978.962) [-980.749] (-981.893) * (-982.445) [-977.159] (-978.722) (-982.712) -- 0:00:11
823000 -- [-978.478] (-979.689) (-977.733) (-982.970) * [-979.604] (-976.727) (-978.014) (-980.527) -- 0:00:10
823500 -- (-978.249) [-978.517] (-977.524) (-979.230) * (-980.429) (-982.913) [-980.084] (-981.933) -- 0:00:10
824000 -- (-980.029) (-977.958) [-981.985] (-978.700) * [-976.304] (-980.548) (-977.111) (-982.414) -- 0:00:10
824500 -- [-978.009] (-979.165) (-977.505) (-981.672) * (-977.052) [-981.732] (-980.537) (-977.843) -- 0:00:10
825000 -- (-979.376) (-979.556) (-976.020) [-981.032] * (-980.191) (-980.483) [-977.189] (-977.928) -- 0:00:10
Average standard deviation of split frequencies: 0.008294
825500 -- [-976.478] (-978.958) (-980.590) (-982.172) * (-979.445) (-977.793) [-977.881] (-979.589) -- 0:00:10
826000 -- (-976.308) [-978.275] (-978.595) (-978.505) * (-979.162) [-978.444] (-977.846) (-979.889) -- 0:00:10
826500 -- [-977.977] (-976.771) (-979.181) (-979.927) * (-980.351) (-978.698) [-976.925] (-979.670) -- 0:00:10
827000 -- (-978.802) (-978.955) (-978.589) [-978.491] * (-978.881) (-978.599) [-981.191] (-978.774) -- 0:00:10
827500 -- [-980.274] (-978.907) (-977.637) (-977.266) * (-981.032) (-977.185) (-980.191) [-983.268] -- 0:00:10
828000 -- (-979.245) (-980.660) (-981.883) [-976.905] * (-978.910) [-977.210] (-982.073) (-979.604) -- 0:00:10
828500 -- (-977.768) (-981.742) (-980.484) [-979.083] * (-978.711) (-980.762) (-986.526) [-977.800] -- 0:00:10
829000 -- (-979.259) [-977.255] (-979.381) (-977.739) * [-976.526] (-976.756) (-977.512) (-978.805) -- 0:00:10
829500 -- (-985.236) [-976.410] (-977.951) (-978.430) * (-986.753) [-977.020] (-976.893) (-979.986) -- 0:00:10
830000 -- (-986.049) (-977.288) (-978.842) [-977.169] * [-980.711] (-977.758) (-977.814) (-979.707) -- 0:00:10
Average standard deviation of split frequencies: 0.008248
830500 -- [-979.368] (-976.724) (-978.412) (-977.354) * [-979.963] (-976.904) (-977.642) (-979.021) -- 0:00:10
831000 -- (-982.372) (-978.491) [-978.216] (-979.843) * (-979.172) [-976.684] (-977.786) (-979.539) -- 0:00:10
831500 -- (-979.052) (-980.648) [-978.849] (-977.647) * (-978.698) (-978.835) (-980.759) [-979.169] -- 0:00:10
832000 -- [-982.341] (-977.814) (-981.701) (-979.468) * (-978.416) (-976.851) [-976.969] (-979.251) -- 0:00:10
832500 -- (-986.752) (-978.225) (-981.524) [-980.802] * [-976.592] (-978.328) (-979.367) (-981.028) -- 0:00:10
833000 -- (-980.082) (-982.134) (-978.751) [-980.248] * [-977.801] (-976.584) (-981.181) (-981.494) -- 0:00:10
833500 -- (-978.453) (-976.326) (-977.326) [-979.253] * (-978.744) (-976.531) [-981.099] (-980.251) -- 0:00:10
834000 -- (-978.773) (-978.656) (-980.305) [-976.963] * (-976.498) [-981.613] (-979.806) (-981.987) -- 0:00:10
834500 -- [-977.404] (-979.177) (-979.842) (-978.379) * (-976.411) [-977.304] (-978.906) (-978.541) -- 0:00:10
835000 -- (-978.988) (-979.481) [-977.311] (-980.980) * (-979.772) [-978.159] (-979.596) (-979.198) -- 0:00:10
Average standard deviation of split frequencies: 0.008045
835500 -- [-976.980] (-976.470) (-976.359) (-977.231) * [-976.715] (-977.186) (-978.875) (-979.359) -- 0:00:10
836000 -- [-976.631] (-978.015) (-977.631) (-979.695) * (-978.959) (-976.221) [-981.418] (-982.790) -- 0:00:10
836500 -- [-981.355] (-976.790) (-977.638) (-977.713) * (-980.926) (-976.844) (-982.112) [-978.617] -- 0:00:10
837000 -- [-978.919] (-978.898) (-982.490) (-982.624) * (-978.981) (-978.246) (-978.523) [-977.342] -- 0:00:10
837500 -- (-978.757) (-980.488) (-981.392) [-977.789] * [-980.610] (-979.233) (-977.306) (-977.431) -- 0:00:10
838000 -- (-978.166) (-976.814) (-981.431) [-976.630] * (-986.021) [-977.826] (-976.496) (-977.284) -- 0:00:10
838500 -- [-977.009] (-976.397) (-977.390) (-978.920) * (-982.184) (-977.048) (-979.247) [-979.379] -- 0:00:10
839000 -- (-978.827) (-975.962) (-977.660) [-979.777] * [-978.112] (-977.251) (-978.086) (-977.238) -- 0:00:09
839500 -- (-979.185) (-975.952) (-977.987) [-981.092] * (-978.763) (-976.396) (-979.777) [-980.870] -- 0:00:09
840000 -- (-977.664) [-976.989] (-978.713) (-978.782) * (-978.742) [-976.301] (-980.337) (-978.569) -- 0:00:09
Average standard deviation of split frequencies: 0.008037
840500 -- (-978.675) [-985.604] (-977.268) (-977.124) * (-978.585) (-977.106) (-981.828) [-976.960] -- 0:00:09
841000 -- (-979.459) (-976.981) (-978.457) [-978.524] * (-979.629) (-976.647) [-977.128] (-976.407) -- 0:00:09
841500 -- [-979.504] (-976.561) (-977.087) (-977.788) * (-978.379) [-978.398] (-980.308) (-976.750) -- 0:00:09
842000 -- [-979.725] (-980.144) (-977.911) (-978.282) * [-976.154] (-978.733) (-977.344) (-979.606) -- 0:00:09
842500 -- (-979.650) (-978.570) [-976.968] (-978.480) * [-976.943] (-984.508) (-977.477) (-978.780) -- 0:00:09
843000 -- (-981.174) (-978.692) (-977.627) [-976.224] * [-979.027] (-977.553) (-977.408) (-976.836) -- 0:00:09
843500 -- (-979.500) (-977.188) [-979.414] (-976.628) * (-983.292) [-977.954] (-976.939) (-977.135) -- 0:00:09
844000 -- (-982.212) (-983.346) [-978.780] (-977.628) * (-981.897) (-978.299) [-975.893] (-976.990) -- 0:00:09
844500 -- [-980.182] (-977.706) (-978.621) (-980.773) * (-979.002) [-981.215] (-977.204) (-976.785) -- 0:00:09
845000 -- [-979.472] (-978.207) (-979.150) (-978.341) * (-978.438) (-978.700) [-976.997] (-980.347) -- 0:00:09
Average standard deviation of split frequencies: 0.008284
845500 -- (-977.094) (-982.579) (-976.728) [-978.450] * (-977.239) (-978.814) [-978.912] (-979.024) -- 0:00:09
846000 -- (-984.688) (-981.659) [-978.501] (-977.871) * (-979.214) (-978.108) [-979.764] (-979.204) -- 0:00:09
846500 -- (-984.594) (-980.012) (-978.623) [-976.489] * (-979.426) [-977.907] (-981.139) (-980.489) -- 0:00:09
847000 -- [-979.656] (-978.539) (-977.039) (-982.712) * (-978.971) [-977.302] (-979.818) (-977.502) -- 0:00:09
847500 -- (-978.966) [-976.613] (-978.760) (-978.658) * [-977.229] (-977.583) (-980.954) (-977.093) -- 0:00:09
848000 -- [-977.855] (-984.550) (-980.915) (-977.486) * (-977.178) (-978.610) [-977.139] (-977.839) -- 0:00:09
848500 -- [-976.785] (-976.388) (-978.392) (-977.174) * (-977.311) (-980.776) (-976.753) [-977.781] -- 0:00:09
849000 -- (-977.520) (-982.356) (-978.263) [-977.934] * (-976.695) (-977.084) (-976.843) [-976.381] -- 0:00:09
849500 -- (-978.007) [-979.248] (-977.495) (-976.375) * (-977.243) (-976.492) [-978.912] (-984.078) -- 0:00:09
850000 -- [-978.224] (-977.569) (-978.546) (-977.177) * (-977.168) (-978.253) [-977.255] (-979.146) -- 0:00:09
Average standard deviation of split frequencies: 0.007241
850500 -- [-977.828] (-979.896) (-977.680) (-976.322) * (-977.137) [-977.394] (-977.903) (-977.951) -- 0:00:09
851000 -- (-978.955) (-979.484) [-978.231] (-980.052) * [-976.630] (-976.210) (-978.358) (-981.170) -- 0:00:09
851500 -- (-977.566) (-976.513) (-977.918) [-976.978] * (-978.682) [-976.562] (-977.208) (-981.357) -- 0:00:09
852000 -- (-977.741) [-976.746] (-978.810) (-977.281) * (-978.686) (-977.699) (-978.114) [-981.073] -- 0:00:09
852500 -- (-976.295) [-981.271] (-978.598) (-976.753) * (-979.232) (-976.252) (-977.105) [-979.039] -- 0:00:09
853000 -- (-978.429) (-984.422) (-977.092) [-976.984] * (-976.959) (-981.388) [-978.558] (-979.736) -- 0:00:09
853500 -- (-976.974) [-979.795] (-976.781) (-977.021) * (-978.172) [-977.678] (-977.101) (-978.368) -- 0:00:09
854000 -- (-976.136) (-978.297) [-977.874] (-980.259) * [-978.305] (-980.359) (-978.995) (-978.288) -- 0:00:09
854500 -- (-982.507) (-983.146) [-977.791] (-981.895) * (-979.829) (-982.013) [-979.776] (-977.528) -- 0:00:09
855000 -- (-981.135) (-976.539) (-976.731) [-977.995] * (-978.816) [-978.494] (-980.185) (-977.285) -- 0:00:08
Average standard deviation of split frequencies: 0.007416
855500 -- (-979.710) (-977.125) [-977.644] (-977.613) * (-979.459) [-976.265] (-977.316) (-976.259) -- 0:00:08
856000 -- (-979.737) (-978.614) [-976.861] (-976.570) * (-976.247) [-976.261] (-977.530) (-979.336) -- 0:00:08
856500 -- (-980.766) (-977.501) [-976.536] (-977.690) * (-976.783) [-977.138] (-977.255) (-979.315) -- 0:00:08
857000 -- (-977.492) [-977.169] (-976.469) (-977.486) * [-976.884] (-976.579) (-980.375) (-978.129) -- 0:00:08
857500 -- (-980.743) (-977.651) (-977.359) [-976.276] * (-977.758) (-978.919) (-979.988) [-979.166] -- 0:00:08
858000 -- (-982.507) (-977.783) (-979.706) [-979.917] * (-977.635) (-976.624) [-978.077] (-981.507) -- 0:00:08
858500 -- (-979.338) (-978.439) (-981.809) [-978.108] * (-980.219) (-976.476) (-977.366) [-979.530] -- 0:00:08
859000 -- (-978.426) (-978.704) (-982.434) [-978.513] * (-979.558) (-976.447) [-977.475] (-977.407) -- 0:00:08
859500 -- (-979.088) [-977.774] (-979.990) (-977.619) * [-977.786] (-976.469) (-979.785) (-979.240) -- 0:00:08
860000 -- (-978.450) (-976.843) (-979.747) [-977.342] * (-979.768) (-980.788) [-978.085] (-978.006) -- 0:00:08
Average standard deviation of split frequencies: 0.007266
860500 -- (-976.844) (-977.425) (-979.228) [-976.792] * (-977.943) (-979.351) [-978.216] (-979.529) -- 0:00:08
861000 -- (-976.292) (-977.710) (-977.945) [-977.765] * (-980.260) (-982.296) [-980.322] (-978.955) -- 0:00:08
861500 -- (-981.622) [-977.575] (-982.694) (-977.514) * [-977.631] (-980.746) (-980.453) (-980.599) -- 0:00:08
862000 -- (-979.957) [-980.139] (-981.512) (-977.996) * (-980.554) (-975.885) [-977.963] (-978.745) -- 0:00:08
862500 -- [-976.463] (-979.482) (-979.383) (-977.499) * [-979.074] (-978.037) (-976.705) (-977.636) -- 0:00:08
863000 -- (-977.801) [-978.101] (-979.154) (-976.918) * (-976.579) [-977.028] (-977.120) (-977.643) -- 0:00:08
863500 -- (-979.258) (-976.535) (-978.169) [-978.543] * (-977.016) (-976.192) (-979.244) [-980.197] -- 0:00:08
864000 -- (-980.588) [-977.599] (-979.611) (-979.963) * (-981.513) (-977.339) [-980.006] (-978.408) -- 0:00:08
864500 -- (-982.682) (-977.250) (-981.567) [-978.836] * (-978.978) (-978.923) (-980.428) [-977.868] -- 0:00:08
865000 -- (-982.582) (-977.686) [-978.960] (-976.074) * (-977.816) (-977.792) [-978.949] (-976.970) -- 0:00:08
Average standard deviation of split frequencies: 0.006895
865500 -- (-976.492) (-975.936) (-976.614) [-976.374] * (-976.422) [-978.913] (-979.137) (-976.108) -- 0:00:08
866000 -- (-976.532) (-975.947) [-978.712] (-977.685) * (-976.013) [-979.737] (-979.940) (-981.904) -- 0:00:08
866500 -- (-977.324) (-977.383) (-977.393) [-976.909] * (-976.684) [-977.401] (-982.347) (-980.465) -- 0:00:08
867000 -- (-977.302) [-976.964] (-976.393) (-978.598) * [-977.084] (-977.517) (-981.238) (-982.882) -- 0:00:08
867500 -- (-976.851) [-981.765] (-977.028) (-976.729) * [-976.775] (-981.056) (-981.136) (-978.302) -- 0:00:08
868000 -- (-976.675) (-979.233) [-976.699] (-977.372) * (-978.669) (-980.525) (-981.232) [-981.857] -- 0:00:08
868500 -- (-976.925) (-979.516) [-976.639] (-977.372) * (-978.717) (-978.278) [-976.545] (-980.234) -- 0:00:08
869000 -- (-977.841) (-977.159) [-977.086] (-976.721) * (-977.112) [-977.542] (-979.136) (-977.887) -- 0:00:08
869500 -- (-979.796) (-977.205) (-977.420) [-976.757] * [-977.850] (-978.718) (-980.115) (-978.716) -- 0:00:08
870000 -- [-979.703] (-977.806) (-976.742) (-978.349) * [-978.520] (-979.944) (-978.850) (-978.249) -- 0:00:08
Average standard deviation of split frequencies: 0.007111
870500 -- [-977.574] (-977.720) (-977.945) (-978.389) * (-976.732) (-976.776) (-977.433) [-977.338] -- 0:00:08
871000 -- [-977.036] (-976.981) (-976.673) (-980.163) * [-977.986] (-979.534) (-979.644) (-978.003) -- 0:00:07
871500 -- (-977.681) (-981.560) (-977.667) [-978.163] * [-977.545] (-979.111) (-977.932) (-979.503) -- 0:00:07
872000 -- [-978.042] (-982.437) (-982.873) (-978.204) * (-978.680) (-976.466) [-977.926] (-983.127) -- 0:00:07
872500 -- (-977.004) (-978.551) [-977.241] (-978.557) * (-977.315) [-977.013] (-982.363) (-983.391) -- 0:00:07
873000 -- [-979.741] (-977.314) (-978.077) (-980.025) * (-978.587) [-977.264] (-981.330) (-986.983) -- 0:00:07
873500 -- (-977.013) [-977.833] (-978.781) (-978.974) * [-977.872] (-978.069) (-977.828) (-978.436) -- 0:00:07
874000 -- (-979.433) [-979.185] (-982.497) (-977.269) * (-977.106) [-976.338] (-980.909) (-977.256) -- 0:00:07
874500 -- (-978.349) [-979.518] (-979.491) (-979.784) * (-979.161) (-977.501) [-977.580] (-976.366) -- 0:00:07
875000 -- (-976.919) [-978.119] (-978.051) (-978.879) * (-975.899) (-980.407) (-977.675) [-976.357] -- 0:00:07
Average standard deviation of split frequencies: 0.006996
875500 -- (-979.493) (-978.519) [-976.935] (-978.662) * [-976.906] (-981.323) (-976.943) (-976.999) -- 0:00:07
876000 -- (-977.516) (-978.108) [-976.874] (-979.141) * (-979.285) (-978.723) [-981.866] (-976.752) -- 0:00:07
876500 -- [-978.918] (-982.291) (-982.454) (-977.797) * [-977.358] (-981.059) (-982.660) (-978.000) -- 0:00:07
877000 -- [-980.441] (-975.979) (-978.326) (-978.868) * [-976.856] (-980.421) (-977.662) (-977.847) -- 0:00:07
877500 -- (-979.849) (-976.083) (-978.159) [-978.627] * (-976.080) [-983.316] (-978.920) (-979.719) -- 0:00:07
878000 -- (-978.722) [-976.226] (-978.068) (-979.425) * (-978.208) (-982.505) [-981.161] (-978.064) -- 0:00:07
878500 -- (-987.114) (-979.863) (-976.954) [-978.895] * (-977.015) (-979.864) [-980.692] (-978.167) -- 0:00:07
879000 -- (-981.198) [-978.797] (-979.647) (-980.070) * [-977.915] (-978.310) (-979.831) (-979.177) -- 0:00:07
879500 -- [-979.857] (-976.997) (-978.021) (-981.221) * (-977.187) (-977.818) [-980.318] (-976.388) -- 0:00:07
880000 -- (-977.215) (-980.587) [-976.741] (-978.558) * (-979.930) (-977.524) [-976.282] (-979.732) -- 0:00:07
Average standard deviation of split frequencies: 0.006923
880500 -- (-984.332) [-978.496] (-977.411) (-978.859) * (-976.686) [-977.751] (-981.884) (-978.065) -- 0:00:07
881000 -- (-982.843) (-977.200) [-978.552] (-977.839) * (-976.989) (-976.362) [-980.875] (-976.363) -- 0:00:07
881500 -- [-977.265] (-978.787) (-977.793) (-979.856) * [-976.369] (-977.218) (-980.766) (-978.129) -- 0:00:07
882000 -- [-977.427] (-983.659) (-977.298) (-976.844) * (-977.476) (-979.046) [-981.598] (-978.033) -- 0:00:07
882500 -- (-977.437) (-979.742) (-981.375) [-977.338] * [-978.795] (-978.233) (-980.010) (-976.478) -- 0:00:07
883000 -- (-980.867) [-978.788] (-975.937) (-978.578) * [-981.182] (-978.417) (-976.832) (-976.783) -- 0:00:07
883500 -- (-979.622) (-978.425) [-977.230] (-977.410) * (-978.473) [-979.913] (-978.370) (-977.199) -- 0:00:07
884000 -- [-985.530] (-977.552) (-978.233) (-976.804) * (-977.958) (-978.466) [-976.344] (-977.553) -- 0:00:07
884500 -- (-979.536) [-979.676] (-979.251) (-976.774) * (-977.902) (-980.093) (-977.562) [-977.033] -- 0:00:07
885000 -- (-977.316) (-980.578) (-978.119) [-976.810] * (-981.177) [-979.692] (-977.030) (-977.645) -- 0:00:07
Average standard deviation of split frequencies: 0.006881
885500 -- (-979.162) [-976.691] (-978.601) (-978.705) * (-977.930) [-977.451] (-977.089) (-980.536) -- 0:00:07
886000 -- [-976.605] (-977.617) (-978.429) (-976.955) * (-977.186) [-978.881] (-977.743) (-981.584) -- 0:00:07
886500 -- (-977.328) (-977.343) (-978.542) [-981.440] * (-977.623) (-979.213) [-976.616] (-983.104) -- 0:00:07
887000 -- (-977.425) (-979.000) (-977.046) [-976.514] * (-977.411) [-979.338] (-977.850) (-977.537) -- 0:00:07
887500 -- [-978.444] (-979.555) (-978.293) (-978.287) * (-977.453) (-979.762) (-977.091) [-979.679] -- 0:00:06
888000 -- (-976.982) [-978.483] (-976.938) (-980.773) * (-979.337) [-981.064] (-976.598) (-979.910) -- 0:00:06
888500 -- [-976.433] (-976.487) (-979.083) (-980.338) * [-980.366] (-979.216) (-976.391) (-977.996) -- 0:00:06
889000 -- (-976.972) [-979.033] (-977.823) (-978.424) * [-976.213] (-978.010) (-977.963) (-979.735) -- 0:00:06
889500 -- (-978.746) (-978.334) [-976.875] (-976.788) * (-978.798) (-978.354) (-980.192) [-979.579] -- 0:00:06
890000 -- (-979.408) [-977.508] (-978.861) (-977.311) * (-981.629) [-977.866] (-982.896) (-981.716) -- 0:00:06
Average standard deviation of split frequencies: 0.006916
890500 -- [-978.405] (-976.952) (-976.686) (-978.282) * (-980.189) (-976.512) [-978.858] (-978.340) -- 0:00:06
891000 -- [-977.133] (-977.730) (-978.210) (-978.331) * (-982.320) (-978.004) (-981.259) [-979.585] -- 0:00:06
891500 -- (-976.872) (-979.095) [-977.021] (-979.665) * (-978.168) (-979.759) [-980.853] (-979.515) -- 0:00:06
892000 -- (-977.193) (-978.486) (-981.794) [-979.939] * (-977.065) (-977.532) [-979.786] (-980.408) -- 0:00:06
892500 -- [-977.253] (-979.135) (-980.010) (-976.783) * (-976.767) [-977.401] (-978.109) (-981.725) -- 0:00:06
893000 -- (-978.974) [-977.825] (-976.740) (-979.390) * (-980.454) (-980.229) [-976.016] (-981.250) -- 0:00:06
893500 -- [-979.324] (-976.121) (-977.221) (-977.756) * (-978.472) (-979.120) [-976.605] (-979.212) -- 0:00:06
894000 -- (-976.735) [-975.900] (-978.480) (-978.113) * (-976.643) [-979.410] (-976.233) (-978.809) -- 0:00:06
894500 -- (-976.602) [-978.754] (-977.484) (-981.566) * (-978.633) [-979.303] (-978.153) (-979.712) -- 0:00:06
895000 -- (-977.057) [-976.771] (-976.342) (-978.852) * (-981.536) (-978.926) [-976.287] (-979.305) -- 0:00:06
Average standard deviation of split frequencies: 0.007225
895500 -- [-977.653] (-977.158) (-978.339) (-979.771) * [-976.591] (-976.141) (-976.038) (-976.439) -- 0:00:06
896000 -- (-980.904) [-977.128] (-976.603) (-979.236) * (-977.723) (-977.238) [-977.736] (-979.544) -- 0:00:06
896500 -- [-976.769] (-977.607) (-978.921) (-976.550) * (-977.605) (-979.665) (-978.002) [-981.513] -- 0:00:06
897000 -- (-980.518) (-979.880) [-978.087] (-980.205) * (-979.894) [-978.386] (-977.962) (-979.791) -- 0:00:06
897500 -- (-976.805) (-977.857) (-979.043) [-978.116] * (-981.731) (-978.775) (-976.903) [-979.841] -- 0:00:06
898000 -- (-979.503) (-978.424) [-985.418] (-977.080) * (-979.524) [-979.074] (-978.504) (-978.645) -- 0:00:06
898500 -- (-978.394) [-978.920] (-986.016) (-977.212) * (-978.545) (-977.525) [-978.345] (-977.075) -- 0:00:06
899000 -- (-979.069) [-981.429] (-987.852) (-982.353) * (-977.315) (-978.457) (-978.873) [-977.530] -- 0:00:06
899500 -- (-978.822) (-979.815) (-978.358) [-978.800] * [-979.178] (-977.223) (-978.059) (-978.886) -- 0:00:06
900000 -- (-977.445) (-977.344) [-982.254] (-982.282) * [-976.240] (-977.304) (-978.086) (-977.011) -- 0:00:06
Average standard deviation of split frequencies: 0.006909
900500 -- (-977.461) (-980.388) [-978.778] (-981.279) * (-979.182) (-976.705) [-977.964] (-979.760) -- 0:00:06
901000 -- (-979.790) (-977.066) (-977.469) [-978.438] * (-978.997) [-976.360] (-977.284) (-980.420) -- 0:00:06
901500 -- [-980.109] (-977.243) (-976.497) (-979.607) * (-978.595) (-979.390) [-977.119] (-978.622) -- 0:00:06
902000 -- (-976.978) (-976.858) [-976.668] (-977.911) * [-977.285] (-979.019) (-977.235) (-977.180) -- 0:00:06
902500 -- (-976.863) [-977.177] (-978.071) (-977.706) * (-976.300) (-979.399) (-981.162) [-979.063] -- 0:00:06
903000 -- (-977.027) [-976.579] (-977.591) (-976.491) * [-977.328] (-978.959) (-976.360) (-976.398) -- 0:00:06
903500 -- (-978.459) (-977.739) (-977.332) [-976.724] * (-983.070) (-979.690) [-978.314] (-979.216) -- 0:00:05
904000 -- [-977.642] (-978.890) (-979.516) (-976.864) * [-978.982] (-978.622) (-980.500) (-977.750) -- 0:00:05
904500 -- [-977.520] (-981.188) (-978.042) (-977.277) * (-976.756) (-984.723) (-978.579) [-979.222] -- 0:00:05
905000 -- (-977.493) [-977.891] (-980.579) (-979.326) * (-980.018) [-978.590] (-977.726) (-983.279) -- 0:00:05
Average standard deviation of split frequencies: 0.006972
905500 -- [-978.196] (-978.484) (-979.320) (-978.322) * (-980.752) (-977.121) [-977.468] (-980.891) -- 0:00:05
906000 -- (-979.122) (-976.317) (-980.375) [-978.930] * [-978.715] (-976.566) (-977.776) (-979.752) -- 0:00:05
906500 -- (-978.036) (-979.534) (-980.273) [-978.297] * [-977.093] (-984.015) (-981.813) (-976.675) -- 0:00:05
907000 -- (-980.354) (-978.023) (-983.700) [-977.940] * (-977.140) (-979.287) (-980.379) [-977.443] -- 0:00:05
907500 -- (-976.914) [-979.424] (-980.267) (-976.671) * (-977.564) [-979.397] (-977.423) (-977.287) -- 0:00:05
908000 -- (-976.422) [-979.485] (-981.106) (-978.981) * [-979.979] (-980.353) (-976.330) (-978.571) -- 0:00:05
908500 -- [-976.610] (-980.577) (-978.618) (-985.833) * (-977.435) (-978.167) (-976.147) [-980.698] -- 0:00:05
909000 -- (-981.566) (-979.581) (-977.281) [-978.661] * (-977.944) (-977.624) (-976.874) [-982.017] -- 0:00:05
909500 -- (-977.057) (-979.360) (-976.701) [-977.500] * [-978.534] (-978.489) (-978.984) (-978.720) -- 0:00:05
910000 -- (-979.088) (-978.950) (-977.557) [-977.571] * (-977.860) (-982.559) [-979.950] (-977.806) -- 0:00:05
Average standard deviation of split frequencies: 0.006902
910500 -- (-977.854) (-976.680) (-978.895) [-977.614] * [-976.154] (-977.336) (-978.673) (-979.308) -- 0:00:05
911000 -- [-977.505] (-979.927) (-979.018) (-978.314) * [-977.874] (-976.766) (-977.057) (-977.193) -- 0:00:05
911500 -- [-978.611] (-977.825) (-980.100) (-978.030) * (-976.673) (-979.552) (-980.263) [-977.510] -- 0:00:05
912000 -- (-977.974) (-978.331) [-979.973] (-977.841) * (-977.179) (-977.259) (-976.959) [-977.844] -- 0:00:05
912500 -- [-979.196] (-978.216) (-978.665) (-977.057) * [-977.484] (-977.492) (-978.306) (-977.057) -- 0:00:05
913000 -- (-978.737) (-977.475) [-978.813] (-977.552) * (-979.120) (-978.222) [-977.315] (-978.542) -- 0:00:05
913500 -- (-980.324) [-977.098] (-979.753) (-978.115) * (-979.837) [-978.706] (-977.371) (-976.863) -- 0:00:05
914000 -- (-981.451) (-976.349) [-981.669] (-980.647) * (-978.765) [-978.615] (-976.671) (-978.025) -- 0:00:05
914500 -- (-979.233) (-979.922) [-978.946] (-979.839) * (-980.186) (-980.510) [-976.494] (-977.426) -- 0:00:05
915000 -- [-976.509] (-976.869) (-976.022) (-976.910) * (-976.857) (-978.306) [-976.641] (-980.433) -- 0:00:05
Average standard deviation of split frequencies: 0.006965
915500 -- (-980.160) [-979.976] (-977.039) (-976.596) * (-978.539) (-977.764) (-977.751) [-976.902] -- 0:00:05
916000 -- (-977.634) (-978.577) (-978.001) [-975.911] * (-979.147) (-979.440) [-976.847] (-978.951) -- 0:00:05
916500 -- (-977.168) (-976.108) [-978.029] (-981.217) * (-977.034) [-982.457] (-978.332) (-979.632) -- 0:00:05
917000 -- (-978.496) (-978.043) [-978.216] (-982.081) * (-976.526) [-978.348] (-980.410) (-976.489) -- 0:00:05
917500 -- (-977.747) [-977.500] (-979.018) (-978.274) * (-976.741) [-980.058] (-977.472) (-977.248) -- 0:00:05
918000 -- [-978.906] (-976.813) (-979.167) (-977.687) * [-977.343] (-980.704) (-976.195) (-976.990) -- 0:00:05
918500 -- (-977.995) (-976.640) (-980.962) [-977.699] * [-978.654] (-980.973) (-976.346) (-977.505) -- 0:00:05
919000 -- (-977.252) [-979.436] (-978.307) (-978.414) * (-975.804) (-982.008) (-976.277) [-976.552] -- 0:00:05
919500 -- [-977.303] (-976.557) (-977.872) (-982.362) * [-977.515] (-984.955) (-976.541) (-977.255) -- 0:00:04
920000 -- (-976.871) (-981.672) [-977.123] (-979.480) * (-978.313) (-979.148) [-977.264] (-977.796) -- 0:00:04
Average standard deviation of split frequencies: 0.006588
920500 -- (-977.242) (-978.445) (-976.198) [-977.597] * (-980.717) [-981.965] (-978.300) (-978.003) -- 0:00:04
921000 -- (-980.699) [-978.656] (-977.511) (-978.412) * (-977.116) (-977.705) (-981.320) [-976.820] -- 0:00:04
921500 -- [-976.930] (-976.901) (-977.048) (-977.535) * (-982.838) (-978.774) (-979.037) [-976.399] -- 0:00:04
922000 -- (-976.468) (-978.584) [-978.924] (-976.651) * [-978.912] (-976.617) (-977.745) (-977.879) -- 0:00:04
922500 -- [-979.546] (-979.116) (-977.706) (-978.403) * (-978.143) [-976.676] (-977.143) (-981.091) -- 0:00:04
923000 -- [-981.446] (-976.609) (-978.898) (-979.347) * (-976.532) [-978.396] (-977.357) (-986.030) -- 0:00:04
923500 -- (-977.277) (-976.869) (-976.445) [-978.294] * [-977.526] (-981.442) (-978.224) (-980.336) -- 0:00:04
924000 -- (-978.217) (-977.146) [-977.616] (-979.081) * [-978.123] (-979.108) (-977.252) (-980.839) -- 0:00:04
924500 -- (-976.077) (-977.246) [-977.955] (-981.420) * (-979.186) [-978.954] (-981.607) (-978.437) -- 0:00:04
925000 -- [-976.023] (-980.488) (-978.732) (-976.734) * (-978.784) (-977.970) [-980.698] (-979.809) -- 0:00:04
Average standard deviation of split frequencies: 0.006414
925500 -- (-979.024) [-978.327] (-980.068) (-977.188) * [-977.468] (-979.206) (-978.949) (-977.240) -- 0:00:04
926000 -- (-981.950) (-979.218) (-977.964) [-979.411] * (-981.694) (-977.121) [-978.300] (-983.368) -- 0:00:04
926500 -- (-978.112) [-977.609] (-981.235) (-980.996) * (-978.058) [-978.989] (-979.262) (-976.854) -- 0:00:04
927000 -- [-979.501] (-977.542) (-978.876) (-979.409) * (-978.942) (-977.298) [-979.482] (-976.644) -- 0:00:04
927500 -- [-978.265] (-976.822) (-977.998) (-978.652) * (-978.803) (-976.088) [-977.642] (-977.914) -- 0:00:04
928000 -- [-977.515] (-976.805) (-978.653) (-978.678) * (-977.454) [-976.652] (-977.868) (-984.573) -- 0:00:04
928500 -- (-977.204) [-979.954] (-978.384) (-977.890) * (-977.395) [-978.640] (-981.527) (-982.650) -- 0:00:04
929000 -- [-978.075] (-980.373) (-978.764) (-977.748) * (-977.497) (-977.706) (-980.549) [-977.460] -- 0:00:04
929500 -- (-977.501) (-977.511) (-977.375) [-977.562] * [-977.416] (-977.461) (-978.029) (-978.813) -- 0:00:04
930000 -- (-978.417) (-979.445) [-977.669] (-977.179) * (-979.384) [-976.309] (-976.281) (-977.484) -- 0:00:04
Average standard deviation of split frequencies: 0.006450
930500 -- (-978.338) (-977.227) (-977.633) [-978.512] * (-979.025) (-978.648) [-976.128] (-977.624) -- 0:00:04
931000 -- (-976.132) (-976.222) [-977.173] (-978.483) * (-979.365) [-978.629] (-976.236) (-977.064) -- 0:00:04
931500 -- [-976.416] (-976.391) (-976.788) (-978.020) * [-978.624] (-979.066) (-978.008) (-977.276) -- 0:00:04
932000 -- [-977.290] (-978.736) (-976.862) (-977.102) * (-980.195) [-978.784] (-979.981) (-977.186) -- 0:00:04
932500 -- (-977.143) (-981.560) (-976.944) [-979.322] * (-978.724) (-977.277) [-977.456] (-978.564) -- 0:00:04
933000 -- [-977.559] (-983.377) (-977.141) (-977.412) * (-976.781) (-976.946) [-978.892] (-978.836) -- 0:00:04
933500 -- [-978.066] (-976.307) (-976.204) (-977.876) * (-980.435) (-978.517) (-976.371) [-978.577] -- 0:00:04
934000 -- (-978.116) (-976.216) (-978.486) [-978.096] * (-980.519) (-976.687) (-975.951) [-978.173] -- 0:00:04
934500 -- (-978.997) [-979.047] (-979.481) (-978.386) * [-980.721] (-978.625) (-978.141) (-977.320) -- 0:00:04
935000 -- [-978.058] (-979.779) (-979.284) (-977.938) * (-978.461) [-977.590] (-979.576) (-976.734) -- 0:00:04
Average standard deviation of split frequencies: 0.006346
935500 -- (-979.681) (-978.017) [-978.886] (-983.490) * (-982.531) [-978.077] (-977.974) (-977.057) -- 0:00:03
936000 -- [-978.716] (-976.740) (-976.477) (-978.024) * (-977.726) (-980.112) [-977.825] (-978.964) -- 0:00:03
936500 -- [-976.472] (-980.754) (-977.969) (-977.655) * (-977.023) (-978.614) (-977.872) [-977.077] -- 0:00:03
937000 -- (-979.899) (-981.897) (-978.200) [-978.504] * [-977.242] (-983.067) (-976.782) (-976.833) -- 0:00:03
937500 -- (-976.171) (-977.577) [-976.798] (-976.883) * (-977.324) [-977.092] (-978.182) (-977.272) -- 0:00:03
938000 -- (-976.963) (-977.221) [-976.942] (-976.825) * [-982.465] (-976.482) (-976.569) (-977.583) -- 0:00:03
938500 -- (-978.569) (-977.878) [-978.424] (-982.623) * (-977.313) [-976.583] (-981.477) (-976.693) -- 0:00:03
939000 -- [-978.096] (-979.523) (-978.139) (-980.238) * (-977.944) (-980.257) (-976.763) [-978.964] -- 0:00:03
939500 -- (-977.978) (-979.051) (-978.087) [-977.873] * (-977.577) (-977.258) (-976.679) [-977.953] -- 0:00:03
940000 -- (-978.418) (-976.868) [-978.512] (-977.194) * (-977.619) (-976.801) (-976.995) [-977.221] -- 0:00:03
Average standard deviation of split frequencies: 0.006448
940500 -- [-976.666] (-976.538) (-976.744) (-976.933) * [-978.150] (-981.795) (-980.053) (-977.331) -- 0:00:03
941000 -- (-978.992) (-976.141) [-976.962] (-977.152) * (-978.778) (-978.302) [-976.429] (-977.588) -- 0:00:03
941500 -- (-978.443) (-976.417) (-978.668) [-977.630] * (-977.156) (-978.374) (-976.607) [-979.378] -- 0:00:03
942000 -- (-980.407) (-976.806) (-978.145) [-977.463] * (-983.178) (-978.166) (-976.791) [-976.950] -- 0:00:03
942500 -- (-978.084) (-979.644) (-983.143) [-978.129] * (-983.870) (-977.481) (-976.530) [-981.776] -- 0:00:03
943000 -- [-976.049] (-977.156) (-977.749) (-979.126) * (-979.796) (-977.916) [-976.382] (-976.368) -- 0:00:03
943500 -- [-977.419] (-977.852) (-977.749) (-978.232) * (-981.972) (-982.206) [-976.765] (-977.895) -- 0:00:03
944000 -- [-980.095] (-979.134) (-980.201) (-978.067) * (-977.503) [-978.699] (-980.050) (-978.486) -- 0:00:03
944500 -- (-980.748) [-981.546] (-979.765) (-977.035) * (-976.697) (-978.764) (-978.255) [-978.702] -- 0:00:03
945000 -- (-980.240) (-977.126) (-976.641) [-978.073] * [-977.459] (-977.132) (-978.017) (-977.459) -- 0:00:03
Average standard deviation of split frequencies: 0.006777
945500 -- (-977.016) [-982.210] (-978.853) (-976.498) * (-976.940) (-980.444) (-978.361) [-976.559] -- 0:00:03
946000 -- (-979.823) [-979.729] (-978.908) (-976.520) * (-977.623) (-979.626) (-981.582) [-978.658] -- 0:00:03
946500 -- (-978.725) [-978.595] (-980.349) (-978.405) * (-977.666) (-976.644) [-977.313] (-976.119) -- 0:00:03
947000 -- (-977.290) (-976.796) (-977.761) [-976.947] * [-976.620] (-976.774) (-981.944) (-977.853) -- 0:00:03
947500 -- [-977.684] (-983.669) (-977.460) (-979.117) * (-978.744) [-977.910] (-978.207) (-977.259) -- 0:00:03
948000 -- (-982.183) (-987.825) [-978.303] (-978.994) * (-977.421) (-977.802) [-978.068] (-977.429) -- 0:00:03
948500 -- (-977.266) (-977.146) (-980.397) [-978.229] * (-980.474) (-979.887) [-977.327] (-982.376) -- 0:00:03
949000 -- (-976.688) [-979.110] (-983.448) (-978.886) * (-986.135) [-977.715] (-976.768) (-978.620) -- 0:00:03
949500 -- (-976.902) (-979.159) (-982.123) [-979.599] * (-980.148) (-980.131) (-977.315) [-977.989] -- 0:00:03
950000 -- (-976.648) (-980.312) (-981.264) [-977.168] * (-977.912) (-978.766) (-977.056) [-976.419] -- 0:00:03
Average standard deviation of split frequencies: 0.006545
950500 -- (-980.906) (-977.405) (-978.599) [-976.239] * (-976.942) (-980.348) [-976.825] (-976.203) -- 0:00:03
951000 -- (-980.477) (-977.920) [-980.098] (-979.383) * (-979.201) [-977.653] (-978.447) (-978.780) -- 0:00:03
951500 -- [-976.764] (-979.001) (-977.832) (-980.009) * (-976.552) (-983.479) [-978.045] (-979.361) -- 0:00:03
952000 -- (-980.357) (-978.457) [-978.037] (-978.045) * (-978.975) [-979.297] (-976.938) (-980.990) -- 0:00:02
952500 -- (-979.804) (-977.282) [-978.177] (-977.731) * (-976.728) [-976.508] (-977.239) (-978.580) -- 0:00:02
953000 -- (-977.442) (-979.153) (-977.733) [-977.129] * (-977.903) (-977.808) (-977.181) [-977.481] -- 0:00:02
953500 -- [-977.470] (-979.266) (-977.150) (-976.427) * [-979.226] (-980.577) (-976.441) (-979.571) -- 0:00:02
954000 -- [-976.860] (-979.425) (-976.579) (-977.520) * [-979.122] (-980.769) (-977.822) (-977.650) -- 0:00:02
954500 -- (-977.692) (-981.480) [-976.379] (-977.089) * (-979.462) (-977.979) [-981.262] (-977.867) -- 0:00:02
955000 -- (-979.694) (-977.105) (-976.179) [-976.633] * (-978.067) (-977.293) [-979.536] (-982.921) -- 0:00:02
Average standard deviation of split frequencies: 0.006180
955500 -- (-978.127) (-980.953) [-979.631] (-978.542) * (-980.131) (-979.355) [-977.758] (-977.255) -- 0:00:02
956000 -- (-978.629) (-982.241) (-978.203) [-979.598] * (-978.706) [-978.803] (-977.900) (-979.742) -- 0:00:02
956500 -- (-978.110) (-977.523) [-979.958] (-977.579) * (-977.720) [-978.651] (-976.988) (-976.243) -- 0:00:02
957000 -- (-976.614) (-978.996) (-976.871) [-978.324] * (-977.138) [-977.614] (-977.393) (-978.334) -- 0:00:02
957500 -- (-978.182) (-978.416) [-976.667] (-979.713) * (-978.312) (-977.696) (-979.228) [-978.098] -- 0:00:02
958000 -- (-977.531) (-978.958) [-976.005] (-980.739) * (-977.026) (-978.392) (-978.039) [-977.550] -- 0:00:02
958500 -- [-976.824] (-979.255) (-978.010) (-980.842) * (-978.424) [-979.528] (-977.651) (-976.526) -- 0:00:02
959000 -- (-977.007) [-976.958] (-977.392) (-978.626) * (-977.296) [-980.936] (-978.723) (-978.494) -- 0:00:02
959500 -- (-979.988) [-976.527] (-977.694) (-981.886) * [-978.683] (-981.686) (-979.825) (-979.500) -- 0:00:02
960000 -- [-978.014] (-976.153) (-978.980) (-980.006) * [-976.963] (-977.541) (-979.890) (-977.277) -- 0:00:02
Average standard deviation of split frequencies: 0.005725
960500 -- (-977.258) (-977.374) (-979.374) [-978.114] * (-979.535) (-977.302) [-979.291] (-976.509) -- 0:00:02
961000 -- (-978.922) [-978.079] (-976.786) (-978.399) * (-979.044) (-977.389) [-980.608] (-980.348) -- 0:00:02
961500 -- (-980.773) (-979.639) (-977.193) [-979.782] * [-977.982] (-976.911) (-978.660) (-977.475) -- 0:00:02
962000 -- [-976.438] (-977.362) (-977.404) (-977.018) * [-976.239] (-980.340) (-979.274) (-976.818) -- 0:00:02
962500 -- [-976.971] (-976.478) (-980.131) (-978.024) * (-978.487) (-978.250) (-978.808) [-979.679] -- 0:00:02
963000 -- (-979.125) (-977.159) [-977.354] (-984.718) * (-979.479) [-978.280] (-978.321) (-982.145) -- 0:00:02
963500 -- [-977.920] (-980.758) (-977.637) (-979.127) * [-976.797] (-977.879) (-977.223) (-980.676) -- 0:00:02
964000 -- (-978.286) (-979.927) [-976.711] (-978.530) * (-979.311) [-977.493] (-977.922) (-981.643) -- 0:00:02
964500 -- [-980.038] (-981.901) (-979.609) (-977.633) * (-977.341) (-978.039) [-977.348] (-979.123) -- 0:00:02
965000 -- (-979.762) [-981.072] (-976.904) (-981.098) * (-979.210) [-978.200] (-976.601) (-977.408) -- 0:00:02
Average standard deviation of split frequencies: 0.006311
965500 -- (-976.557) (-978.814) (-978.505) [-977.521] * (-979.081) (-976.386) (-978.851) [-977.306] -- 0:00:02
966000 -- [-977.292] (-980.045) (-981.707) (-977.669) * [-977.276] (-977.378) (-981.400) (-982.420) -- 0:00:02
966500 -- (-976.671) [-977.811] (-977.646) (-977.655) * (-978.372) (-981.620) (-978.206) [-979.708] -- 0:00:02
967000 -- (-978.253) (-976.530) (-977.278) [-978.067] * [-978.783] (-977.437) (-979.295) (-980.491) -- 0:00:02
967500 -- (-977.319) (-976.544) [-977.093] (-976.264) * (-978.174) [-977.396] (-978.508) (-980.408) -- 0:00:02
968000 -- (-976.994) [-978.934] (-979.807) (-981.511) * (-977.206) [-979.112] (-977.259) (-976.239) -- 0:00:01
968500 -- (-979.217) [-978.476] (-979.988) (-980.989) * [-978.663] (-976.304) (-980.939) (-978.355) -- 0:00:01
969000 -- (-980.025) [-978.464] (-977.657) (-978.346) * (-979.586) (-977.505) (-976.612) [-978.146] -- 0:00:01
969500 -- (-978.623) (-977.185) (-977.310) [-977.044] * (-981.892) [-978.371] (-978.985) (-977.445) -- 0:00:01
970000 -- (-978.231) (-978.397) [-977.428] (-976.989) * (-981.106) [-977.409] (-981.013) (-977.663) -- 0:00:01
Average standard deviation of split frequencies: 0.006411
970500 -- (-977.890) [-976.638] (-979.857) (-979.048) * (-982.999) [-977.851] (-976.422) (-976.807) -- 0:00:01
971000 -- [-980.356] (-976.932) (-984.084) (-977.949) * (-976.072) [-977.070] (-976.347) (-979.007) -- 0:00:01
971500 -- (-976.839) (-977.541) [-978.571] (-978.217) * [-975.833] (-977.483) (-977.131) (-979.517) -- 0:00:01
972000 -- (-977.532) [-978.002] (-977.497) (-979.991) * (-978.807) (-976.736) [-976.867] (-978.546) -- 0:00:01
972500 -- (-977.644) (-978.331) [-980.577] (-980.004) * (-981.852) (-976.846) [-976.589] (-979.067) -- 0:00:01
973000 -- (-981.545) (-978.229) [-975.843] (-977.008) * (-978.145) (-981.688) (-978.790) [-977.273] -- 0:00:01
973500 -- (-980.170) (-979.680) [-976.693] (-977.639) * [-979.637] (-977.140) (-980.802) (-977.682) -- 0:00:01
974000 -- (-980.917) [-979.475] (-976.767) (-978.619) * (-979.285) (-980.515) [-977.681] (-980.455) -- 0:00:01
974500 -- (-976.165) [-978.301] (-976.396) (-978.454) * (-980.135) (-981.209) [-976.380] (-976.977) -- 0:00:01
975000 -- [-978.313] (-977.166) (-976.832) (-979.050) * (-979.192) (-981.461) (-978.114) [-980.865] -- 0:00:01
Average standard deviation of split frequencies: 0.006826
975500 -- (-978.281) (-977.124) (-981.072) [-980.903] * (-978.163) (-977.957) (-978.509) [-978.985] -- 0:00:01
976000 -- (-976.917) (-979.712) [-977.763] (-979.143) * (-978.749) (-977.732) (-977.123) [-980.526] -- 0:00:01
976500 -- [-978.409] (-978.054) (-978.405) (-982.884) * [-976.810] (-977.372) (-980.457) (-978.970) -- 0:00:01
977000 -- (-976.127) (-980.371) [-978.719] (-979.214) * (-977.940) (-977.967) (-977.606) [-977.927] -- 0:00:01
977500 -- (-977.670) [-978.413] (-981.888) (-977.565) * (-977.961) (-979.489) [-978.160] (-976.999) -- 0:00:01
978000 -- [-977.867] (-982.379) (-977.519) (-978.439) * (-976.311) [-978.818] (-977.899) (-978.963) -- 0:00:01
978500 -- (-978.896) (-981.734) [-977.044] (-977.699) * (-979.418) (-978.141) [-978.114] (-977.046) -- 0:00:01
979000 -- [-976.360] (-977.599) (-976.789) (-977.798) * (-976.972) (-978.607) [-979.392] (-977.512) -- 0:00:01
979500 -- (-979.387) (-977.088) (-979.354) [-978.135] * (-977.704) (-976.888) [-982.576] (-977.047) -- 0:00:01
980000 -- (-979.192) (-979.396) [-977.389] (-976.854) * (-977.621) (-976.265) (-986.771) [-980.631] -- 0:00:01
Average standard deviation of split frequencies: 0.006986
980500 -- (-979.126) [-981.298] (-977.671) (-978.748) * (-977.827) (-976.185) [-977.371] (-979.664) -- 0:00:01
981000 -- (-977.525) [-980.977] (-978.805) (-980.728) * [-979.555] (-978.591) (-976.495) (-979.137) -- 0:00:01
981500 -- (-976.990) (-980.995) [-980.083] (-978.569) * (-985.307) [-978.140] (-976.679) (-977.728) -- 0:00:01
982000 -- (-977.692) (-976.778) [-979.071] (-979.720) * [-976.641] (-981.546) (-976.876) (-979.272) -- 0:00:01
982500 -- [-978.654] (-978.700) (-982.196) (-976.816) * (-976.785) (-980.971) (-979.433) [-978.488] -- 0:00:01
983000 -- [-982.590] (-980.416) (-981.169) (-980.389) * (-976.991) (-976.688) [-979.971] (-981.096) -- 0:00:01
983500 -- (-977.921) (-977.436) [-977.097] (-978.174) * (-977.918) [-978.588] (-978.296) (-978.397) -- 0:00:01
984000 -- (-979.301) (-977.440) [-978.675] (-977.527) * (-977.317) [-978.777] (-981.431) (-978.687) -- 0:00:00
984500 -- [-976.589] (-976.852) (-979.303) (-978.792) * (-977.455) [-977.127] (-982.041) (-978.147) -- 0:00:00
985000 -- (-977.310) [-976.272] (-979.680) (-977.026) * [-977.225] (-978.546) (-985.564) (-981.750) -- 0:00:00
Average standard deviation of split frequencies: 0.006821
985500 -- (-976.682) (-977.776) (-982.099) [-980.221] * (-978.644) [-976.897] (-983.242) (-982.809) -- 0:00:00
986000 -- [-977.037] (-978.917) (-977.326) (-980.145) * (-979.472) [-978.402] (-981.509) (-981.853) -- 0:00:00
986500 -- (-976.231) (-976.445) (-978.554) [-977.413] * (-979.044) (-979.174) [-977.346] (-982.678) -- 0:00:00
987000 -- (-976.524) [-978.928] (-978.305) (-978.712) * (-977.343) (-976.545) [-977.002] (-979.580) -- 0:00:00
987500 -- (-977.283) (-976.262) [-977.081] (-979.843) * (-977.128) (-978.594) [-978.808] (-978.622) -- 0:00:00
988000 -- [-977.461] (-978.384) (-978.362) (-979.350) * (-977.041) [-980.299] (-977.605) (-979.426) -- 0:00:00
988500 -- [-977.293] (-981.238) (-978.789) (-978.846) * (-978.351) (-979.493) [-977.209] (-978.832) -- 0:00:00
989000 -- (-977.160) (-978.587) [-976.216] (-978.407) * (-977.966) (-979.214) (-982.130) [-978.525] -- 0:00:00
989500 -- [-980.930] (-980.769) (-980.408) (-977.213) * (-981.008) [-981.770] (-978.240) (-978.283) -- 0:00:00
990000 -- (-977.846) [-980.965] (-980.389) (-978.834) * [-977.561] (-978.972) (-981.539) (-977.859) -- 0:00:00
Average standard deviation of split frequencies: 0.006662
990500 -- (-976.738) [-977.531] (-979.403) (-976.368) * (-977.744) (-980.998) (-976.178) [-981.588] -- 0:00:00
991000 -- (-978.775) [-978.077] (-977.000) (-978.398) * (-977.744) [-976.971] (-976.481) (-975.788) -- 0:00:00
991500 -- [-977.589] (-980.877) (-977.217) (-978.801) * [-978.387] (-977.509) (-976.636) (-977.331) -- 0:00:00
992000 -- (-977.310) (-980.630) (-978.131) [-977.967] * [-977.704] (-978.447) (-976.710) (-979.642) -- 0:00:00
992500 -- (-976.952) (-977.518) (-980.253) [-977.152] * (-982.116) (-983.500) [-976.525] (-979.965) -- 0:00:00
993000 -- (-978.434) (-978.510) [-979.499] (-977.167) * (-982.209) [-978.164] (-977.604) (-978.845) -- 0:00:00
993500 -- [-976.595] (-979.411) (-978.764) (-978.330) * (-980.694) [-978.067] (-979.378) (-978.530) -- 0:00:00
994000 -- [-976.426] (-977.118) (-978.497) (-977.598) * (-977.058) [-977.417] (-977.452) (-980.166) -- 0:00:00
994500 -- [-977.655] (-977.302) (-977.983) (-981.990) * (-978.776) (-976.930) (-980.833) [-978.830] -- 0:00:00
995000 -- (-977.111) [-976.943] (-977.428) (-978.683) * (-977.320) (-978.050) (-977.941) [-977.968] -- 0:00:00
Average standard deviation of split frequencies: 0.006752
995500 -- (-977.896) (-976.745) (-978.509) [-978.669] * (-979.254) (-976.409) (-977.488) [-979.083] -- 0:00:00
996000 -- (-979.801) (-977.858) [-980.170] (-978.318) * (-983.147) (-977.511) [-977.734] (-976.540) -- 0:00:00
996500 -- [-980.190] (-977.758) (-980.438) (-977.747) * (-983.173) (-981.256) [-978.017] (-976.638) -- 0:00:00
997000 -- (-979.763) [-981.200] (-978.024) (-977.196) * (-977.875) [-977.807] (-977.610) (-977.335) -- 0:00:00
997500 -- [-978.677] (-976.824) (-977.588) (-977.633) * (-981.574) [-978.116] (-977.078) (-980.657) -- 0:00:00
998000 -- (-978.696) (-977.777) (-978.431) [-975.936] * (-978.734) (-978.323) [-978.877] (-978.697) -- 0:00:00
998500 -- (-980.796) [-981.515] (-979.069) (-977.910) * (-978.145) (-977.993) [-976.416] (-983.566) -- 0:00:00
999000 -- (-980.603) [-980.750] (-978.002) (-979.992) * (-976.610) (-978.513) (-977.746) [-978.349] -- 0:00:00
999500 -- [-979.246] (-977.062) (-979.309) (-978.324) * [-977.678] (-982.133) (-978.479) (-976.319) -- 0:00:00
1000000 -- (-977.795) (-977.200) [-976.669] (-976.599) * (-981.337) [-977.774] (-979.700) (-978.669) -- 0:00:00
Average standard deviation of split frequencies: 0.006941
Analysis completed in 1 mins 2 seconds
Analysis used 61.33 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -975.74
Likelihood of best state for "cold" chain of run 2 was -975.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 63 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.9 % ( 26 %) Dirichlet(Pi{all})
29.0 % ( 19 %) Slider(Pi{all})
78.8 % ( 53 %) Multiplier(Alpha{1,2})
78.4 % ( 57 %) Multiplier(Alpha{3})
20.8 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.3 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.5 % ( 27 %) Dirichlet(Pi{all})
29.9 % ( 21 %) Slider(Pi{all})
78.5 % ( 50 %) Multiplier(Alpha{1,2})
77.3 % ( 47 %) Multiplier(Alpha{3})
21.4 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 15 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166886 0.82 0.67
3 | 165972 167013 0.84
4 | 166319 167000 166810
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167037 0.82 0.67
3 | 166601 166793 0.84
4 | 166258 166476 166835
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -977.36
| 1 |
| 1 1 |
| 2 1 11 1 |
| 1* 1 2 2* 2 1 2 |
| 1 2 22 2 2 2 2 1 1 2 221 2 2 |
|** 21 * 2 21 1 * 1*22 1 212 2 2 * 1 |
| 2 2 *1 * 22 112 2 1 11* 1 2|
| 1 1 1 2 11 1 1 1 1 1 2 1|
| 2 2 22 2 122 2 *1 * |
| 1 1 1 2 2 |
| 1 1 2 2 |
| |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -979.50
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -977.49 -980.23
2 -977.46 -980.18
--------------------------------------
TOTAL -977.48 -980.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897657 0.087234 0.348370 1.458194 0.873493 1501.00 1501.00 1.000
r(A<->C){all} 0.168382 0.020288 0.000001 0.461061 0.130394 208.75 216.96 1.000
r(A<->G){all} 0.163346 0.019383 0.000008 0.453785 0.126661 235.71 274.99 1.007
r(A<->T){all} 0.161887 0.019331 0.000024 0.445972 0.124379 197.24 329.80 1.000
r(C<->G){all} 0.166404 0.020463 0.000093 0.448463 0.127245 199.23 209.59 1.002
r(C<->T){all} 0.167018 0.021545 0.000448 0.467162 0.125030 260.65 288.01 1.000
r(G<->T){all} 0.172962 0.022269 0.000289 0.461311 0.133254 153.90 163.25 1.001
pi(A){all} 0.196108 0.000220 0.168210 0.225227 0.196233 1179.93 1288.30 1.001
pi(C){all} 0.270185 0.000273 0.239421 0.304534 0.270198 1282.98 1329.33 1.001
pi(G){all} 0.322361 0.000292 0.292725 0.359573 0.322204 1340.99 1365.50 1.000
pi(T){all} 0.211345 0.000222 0.184655 0.243363 0.211129 1283.66 1284.73 1.000
alpha{1,2} 0.436816 0.262576 0.000293 1.438817 0.253421 1083.51 1205.99 1.000
alpha{3} 0.458607 0.236024 0.000163 1.455973 0.286676 1236.52 1274.23 1.000
pinvar{all} 0.997842 0.000007 0.993204 0.999999 0.998648 890.86 1038.83 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- .**.**
9 -- .*.*..
10 -- ..**..
11 -- .*..*.
12 -- .***.*
13 -- ....**
14 -- ..*.*.
15 -- .*.***
16 -- ..****
17 -- ...**.
18 -- .*...*
19 -- ...*.*
20 -- .**...
21 -- ..*..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 447 0.148901 0.008951 0.142572 0.155230 2
8 443 0.147568 0.007066 0.142572 0.152565 2
9 442 0.147235 0.001884 0.145903 0.148568 2
10 438 0.145903 0.005653 0.141905 0.149900 2
11 438 0.145903 0.005653 0.141905 0.149900 2
12 434 0.144570 0.000942 0.143904 0.145237 2
13 433 0.144237 0.008951 0.137908 0.150566 2
14 432 0.143904 0.015075 0.133245 0.154564 2
15 431 0.143571 0.016488 0.131912 0.155230 2
16 431 0.143571 0.005182 0.139907 0.147235 2
17 420 0.139907 0.005653 0.135909 0.143904 2
18 420 0.139907 0.001884 0.138574 0.141239 2
19 413 0.137575 0.010835 0.129913 0.145237 2
20 407 0.135576 0.007066 0.130580 0.140573 2
21 404 0.134577 0.002827 0.132578 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099570 0.009614 0.000213 0.296946 0.069349 1.000 2
length{all}[2] 0.101699 0.010468 0.000073 0.305455 0.069810 1.002 2
length{all}[3] 0.101435 0.010571 0.000005 0.308501 0.068985 1.000 2
length{all}[4] 0.101146 0.010421 0.000004 0.307349 0.070666 1.000 2
length{all}[5] 0.099008 0.009692 0.000020 0.288254 0.069276 1.000 2
length{all}[6] 0.098216 0.010161 0.000004 0.302674 0.066435 1.000 2
length{all}[7] 0.104578 0.012647 0.000300 0.308174 0.068221 1.000 2
length{all}[8] 0.101563 0.010811 0.000589 0.312961 0.069431 0.999 2
length{all}[9] 0.107362 0.011616 0.000160 0.327436 0.073246 0.999 2
length{all}[10] 0.094197 0.008846 0.000284 0.269668 0.067031 0.999 2
length{all}[11] 0.092962 0.008159 0.000196 0.266761 0.063464 1.016 2
length{all}[12] 0.087714 0.008532 0.000181 0.267682 0.057444 0.998 2
length{all}[13] 0.101813 0.010849 0.000072 0.323098 0.067944 1.000 2
length{all}[14] 0.096232 0.008839 0.000442 0.268371 0.067933 1.000 2
length{all}[15] 0.111312 0.012892 0.000265 0.329280 0.074602 0.998 2
length{all}[16] 0.099771 0.009407 0.000179 0.304455 0.067715 1.002 2
length{all}[17] 0.101907 0.011443 0.000024 0.335351 0.070103 0.998 2
length{all}[18] 0.099699 0.009394 0.000219 0.302457 0.068460 0.998 2
length{all}[19] 0.091253 0.010860 0.000002 0.293707 0.058264 0.999 2
length{all}[20] 0.095600 0.009529 0.000455 0.280563 0.066618 0.998 2
length{all}[21] 0.098177 0.008330 0.000583 0.278467 0.072685 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006941
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.016
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 714
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 238 / 238 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 238 / 238 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077082 0.018986 0.076973 0.049259 0.077923 0.080814 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1035.165590
Iterating by ming2
Initial: fx= 1035.165590
x= 0.07708 0.01899 0.07697 0.04926 0.07792 0.08081 0.30000 1.30000
1 h-m-p 0.0000 0.0001 570.7204 ++ 1008.793999 m 0.0001 13 | 1/8
2 h-m-p 0.0014 0.0369 30.6358 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 521.9187 ++ 973.396745 m 0.0001 44 | 2/8
4 h-m-p 0.0023 0.0537 26.3723 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 468.8508 ++ 947.121756 m 0.0001 76 | 3/8
6 h-m-p 0.0018 0.0619 26.9447 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 408.0123 ++ 947.043254 m 0.0000 108 | 4/8
8 h-m-p 0.0002 0.0797 24.2578 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 333.1020 ++ 946.641845 m 0.0000 138 | 5/8
10 h-m-p 0.0002 0.1185 16.1712 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 235.5133 ++ 945.951232 m 0.0000 168 | 6/8
12 h-m-p 0.0975 8.0000 0.0000 ---------Y 945.951232 0 0.0000 188 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 --------N 945.951232 0 0.0000 209
Out..
lnL = -945.951232
210 lfun, 210 eigenQcodon, 1260 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070628 0.028027 0.109077 0.078691 0.048783 0.045212 0.300027 0.624920 0.219167
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.169535
np = 9
lnL0 = -1030.438775
Iterating by ming2
Initial: fx= 1030.438775
x= 0.07063 0.02803 0.10908 0.07869 0.04878 0.04521 0.30003 0.62492 0.21917
1 h-m-p 0.0000 0.0001 518.0412 ++ 994.397459 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 318.5155 ++ 974.847909 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 7850.5985 ++ 971.725744 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 6062.3791 ++ 956.860243 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 143443.5221 ++ 953.143114 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 549570.4917 ++ 952.872999 m 0.0000 74 | 6/9
7 h-m-p 0.0001 0.0173 21.8327 ---------.. | 6/9
8 h-m-p 0.0000 0.0001 226.5714 ++ 945.951175 m 0.0001 105 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 945.951175 m 8.0000 117 | 7/9
10 h-m-p 0.0160 8.0000 0.0131 +++++ 945.951173 m 8.0000 134 | 7/9
11 h-m-p 0.2312 1.1560 0.1725 ++ 945.951172 m 1.1560 148 | 8/9
12 h-m-p 0.0845 0.4792 0.9621 ++ 945.950965 m 0.4792 162 | 9/9
13 h-m-p 0.0160 8.0000 0.0000 N 945.950965 0 0.0160 175 | 9/9
14 h-m-p 0.0160 8.0000 0.0000 N 945.950965 0 0.0160 187
Out..
lnL = -945.950965
188 lfun, 564 eigenQcodon, 2256 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065285 0.019940 0.087566 0.094687 0.054173 0.065329 0.000100 1.646564 0.261467 0.396745 1.466498
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.069650
np = 11
lnL0 = -1032.437196
Iterating by ming2
Initial: fx= 1032.437196
x= 0.06529 0.01994 0.08757 0.09469 0.05417 0.06533 0.00011 1.64656 0.26147 0.39674 1.46650
1 h-m-p 0.0000 0.0000 525.3101 ++ 1031.810708 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 390.6589 +++ 1005.324142 m 0.0002 31 | 2/11
3 h-m-p 0.0001 0.0005 177.1356 ++ 970.772151 m 0.0005 45 | 3/11
4 h-m-p 0.0008 0.0041 42.3881 ++ 952.860442 m 0.0041 59 | 4/11
5 h-m-p 0.0000 0.0000 2787.7443 ++ 952.838694 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 9918.4734 ++ 946.437015 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 9.6470 -------.. | 6/11
8 h-m-p 0.0000 0.0000 327.0007 ++ 946.416312 m 0.0000 120 | 7/11
9 h-m-p 0.0007 0.3444 2.8539 -----------.. | 7/11
10 h-m-p 0.0000 0.0000 231.1283 ++ 945.951140 m 0.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951140 m 8.0000 174 | 8/11
12 h-m-p 0.0194 8.0000 0.0016 +++++ 945.951140 m 8.0000 194 | 8/11
13 h-m-p 0.0160 8.0000 2.4970 ----------Y 945.951140 0 0.0000 221 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 Y 945.951140 0 0.0040 235 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 N 945.951140 0 0.0040 252
Out..
lnL = -945.951140
253 lfun, 1012 eigenQcodon, 4554 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -945.971770 S = -945.948647 -0.008875
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:02
did 20 / 53 patterns 0:02
did 30 / 53 patterns 0:02
did 40 / 53 patterns 0:02
did 50 / 53 patterns 0:02
did 53 / 53 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030517 0.090089 0.047167 0.025796 0.012016 0.026572 0.000100 0.200288 1.921742
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 29.665911
np = 9
lnL0 = -996.896537
Iterating by ming2
Initial: fx= 996.896537
x= 0.03052 0.09009 0.04717 0.02580 0.01202 0.02657 0.00011 0.20029 1.92174
1 h-m-p 0.0000 0.0000 523.8657 ++ 996.590004 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0336 15.1639 ---------.. | 1/9
3 h-m-p 0.0000 0.0001 524.0425 ++ 981.607140 m 0.0001 45 | 2/9
4 h-m-p 0.0025 0.1915 10.2476 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 485.5381 ++ 966.555936 m 0.0001 79 | 3/9
6 h-m-p 0.0005 0.0025 17.6474 -----------.. | 3/9
7 h-m-p 0.0000 0.0000 441.8040 ++ 965.868197 m 0.0000 112 | 4/9
8 h-m-p 0.0001 0.0047 24.6441 ++++ 965.316998 m 0.0047 126 | 5/9
9 h-m-p 0.0000 0.0002 376.3124 ++ 958.669160 m 0.0002 138 | 6/9
10 h-m-p 0.0000 0.0000 292.7893 ++ 956.179984 m 0.0000 150 | 7/9
11 h-m-p 0.0160 8.0000 1.0148 -------------.. | 7/9
12 h-m-p 0.0000 0.0002 214.0138 +++ 945.950965 m 0.0002 186 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 945.950965 0 1.6000 198 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 Y 945.950965 0 0.0040 211
Out..
lnL = -945.950965
212 lfun, 2332 eigenQcodon, 12720 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.088829 0.024285 0.034987 0.070626 0.076124 0.013535 0.000100 0.900000 0.577472 1.626575 1.299930
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.241316
np = 11
lnL0 = -1012.717793
Iterating by ming2
Initial: fx= 1012.717793
x= 0.08883 0.02428 0.03499 0.07063 0.07612 0.01353 0.00011 0.90000 0.57747 1.62658 1.29993
1 h-m-p 0.0000 0.0000 498.8281 ++ 1012.363083 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 166.4717 ++++ 994.901506 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0001 272.3625 ++ 983.172409 m 0.0001 46 | 3/11
4 h-m-p 0.0003 0.0013 123.4395 ++ 973.298372 m 0.0013 60 | 4/11
5 h-m-p 0.0000 0.0001 1932.3639 ++ 951.302973 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0002 582.1830 ++ 948.740218 m 0.0002 88 | 6/11
7 h-m-p 0.0000 0.0000 4834.2948 ++ 948.163587 m 0.0000 102 | 7/11
8 h-m-p 0.0022 0.0312 23.1505 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 229.1457 ++ 945.951169 m 0.0000 140 | 8/11
10 h-m-p 0.2733 8.0000 0.0000 +++ 945.951169 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0225 +++++ 945.951163 m 8.0000 175 | 8/11
12 h-m-p 0.2324 4.6164 0.7757 -----------Y 945.951163 0 0.0000 203 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 ----N 945.951163 0 0.0000 224 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951163 m 8.0000 244 | 8/11
15 h-m-p 0.0112 5.6219 0.6593 ---------Y 945.951163 0 0.0000 270 | 8/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 945.951163 m 8.0000 290 | 8/11
17 h-m-p 0.0092 4.6135 0.7822 -------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951163 m 8.0000 338 | 8/11
19 h-m-p 0.0096 2.9759 0.2473 -----------C 945.951163 0 0.0000 366 | 8/11
20 h-m-p 0.0160 8.0000 0.0025 +++++ 945.951157 m 8.0000 386 | 8/11
21 h-m-p 0.0724 2.9673 0.2779 -------------Y 945.951157 0 0.0000 416 | 8/11
22 h-m-p 0.0160 8.0000 0.0004 +++++ 945.951156 m 8.0000 436 | 8/11
23 h-m-p 0.0099 3.3583 0.2919 ----------Y 945.951156 0 0.0000 463 | 8/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 945.951156 m 8.0000 483 | 8/11
25 h-m-p 0.0042 2.1247 0.3788 ---------C 945.951156 0 0.0000 509 | 8/11
26 h-m-p 0.0160 8.0000 0.0005 +++++ 945.951156 m 8.0000 529 | 8/11
27 h-m-p 0.0102 2.0597 0.3849 ------------C 945.951156 0 0.0000 558 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
29 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951155 m 8.0000 606 | 8/11
30 h-m-p 0.0113 3.2481 0.2337 -------------.. | 8/11
31 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951154 m 8.0000 654 | 8/11
32 h-m-p 0.0115 3.2779 0.2323 ----------Y 945.951154 0 0.0000 681 | 8/11
33 h-m-p 0.0160 8.0000 0.0035 +++++ 945.951144 m 8.0000 701 | 8/11
34 h-m-p 0.1152 3.3698 0.2413 ---------------.. | 8/11
35 h-m-p 0.0160 8.0000 0.0004 +++++ 945.951143 m 8.0000 751 | 8/11
36 h-m-p 0.0141 3.6483 0.2163 ------------Y 945.951143 0 0.0000 780 | 8/11
37 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951143 m 8.0000 800 | 8/11
38 h-m-p 0.0089 2.7174 0.2772 -----------Y 945.951143 0 0.0000 828 | 8/11
39 h-m-p 0.0160 8.0000 0.0001 +++++ 945.951143 m 8.0000 848 | 8/11
40 h-m-p 0.0058 2.8859 0.3143 --------Y 945.951143 0 0.0000 873 | 8/11
41 h-m-p 0.0160 8.0000 0.0001 -Y 945.951143 0 0.0010 891 | 8/11
42 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951143 m 8.0000 911 | 8/11
43 h-m-p 0.0160 8.0000 0.0530 ------N 945.951143 0 0.0000 934 | 8/11
44 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951143 m 8.0000 954 | 8/11
45 h-m-p 0.0130 6.4868 0.1351 -------C 945.951143 0 0.0000 978 | 8/11
46 h-m-p 0.0160 8.0000 0.0003 --------Y 945.951143 0 0.0000 1003 | 8/11
47 h-m-p 0.0160 8.0000 0.0000 -C 945.951143 0 0.0010 1021
Out..
lnL = -945.951143
1022 lfun, 12264 eigenQcodon, 67452 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -945.978186 S = -945.948591 -0.013048
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:22
did 20 / 53 patterns 0:22
did 30 / 53 patterns 0:22
did 40 / 53 patterns 0:23
did 50 / 53 patterns 0:23
did 53 / 53 patterns 0:23
Time used: 0:23
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238
NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
NC_002677_1_NP_302140_1_1012_rnc VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
**************************************************
NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
NC_002677_1_NP_302140_1_1012_rnc LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
**************************************************
NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
NC_002677_1_NP_302140_1_1012_rnc LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
**************************************************
NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
NC_002677_1_NP_302140_1_1012_rnc DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
**************************************************
NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
NC_002677_1_NP_302140_1_1012_rnc DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
**************************************
>NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NC_002677_1_NP_302140_1_1012_rnc GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG
>NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NC_002677_1_NP_302140_1_1012_rnc VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
#NEXUS
[ID: 0877481311]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908461_1_1762_MLBR_RS08350
NC_002677_1_NP_302140_1_1012_rnc
NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955
NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670
NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115
NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908461_1_1762_MLBR_RS08350,
2 NC_002677_1_NP_302140_1_1012_rnc,
3 NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955,
4 NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670,
5 NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115,
6 NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06934873,2:0.06981047,3:0.06898548,4:0.07066602,5:0.06927571,6:0.06643473);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06934873,2:0.06981047,3:0.06898548,4:0.07066602,5:0.06927571,6:0.06643473);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -977.49 -980.23
2 -977.46 -980.18
--------------------------------------
TOTAL -977.48 -980.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897657 0.087234 0.348370 1.458194 0.873493 1501.00 1501.00 1.000
r(A<->C){all} 0.168382 0.020288 0.000001 0.461061 0.130394 208.75 216.96 1.000
r(A<->G){all} 0.163346 0.019383 0.000008 0.453785 0.126661 235.71 274.99 1.007
r(A<->T){all} 0.161887 0.019331 0.000024 0.445972 0.124379 197.24 329.80 1.000
r(C<->G){all} 0.166404 0.020463 0.000093 0.448463 0.127245 199.23 209.59 1.002
r(C<->T){all} 0.167018 0.021545 0.000448 0.467162 0.125030 260.65 288.01 1.000
r(G<->T){all} 0.172962 0.022269 0.000289 0.461311 0.133254 153.90 163.25 1.001
pi(A){all} 0.196108 0.000220 0.168210 0.225227 0.196233 1179.93 1288.30 1.001
pi(C){all} 0.270185 0.000273 0.239421 0.304534 0.270198 1282.98 1329.33 1.001
pi(G){all} 0.322361 0.000292 0.292725 0.359573 0.322204 1340.99 1365.50 1.000
pi(T){all} 0.211345 0.000222 0.184655 0.243363 0.211129 1283.66 1284.73 1.000
alpha{1,2} 0.436816 0.262576 0.000293 1.438817 0.253421 1083.51 1205.99 1.000
alpha{3} 0.458607 0.236024 0.000163 1.455973 0.286676 1236.52 1274.23 1.000
pinvar{all} 0.997842 0.000007 0.993204 0.999999 0.998648 890.86 1038.83 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rnc/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 238
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 4 4 4 4 4 4 | TAC 6 6 6 6 6 6 | TGC 0 0 0 0 0 0
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 9 9 9 9 9 9 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 6 6 6 6 6 6 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 17 17 17 17 17 17 | CCG 1 1 1 1 1 1 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 2 2 2 2 2 2 | ACC 11 11 11 11 11 11 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 8 8 8 8 8 8 | Asp GAT 9 9 9 9 9 9 | Gly GGT 9 9 9 9 9 9
GTC 7 7 7 7 7 7 | GCC 5 5 5 5 5 5 | GAC 7 7 7 7 7 7 | GGC 10 10 10 10 10 10
GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 10 10 10 10 10 10 | GCG 9 9 9 9 9 9 | GAG 10 10 10 10 10 10 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
#2: NC_002677_1_NP_302140_1_1012_rnc
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
#3: NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
#4: NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
#5: NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
#6: NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 24 | TAC 36 | TGC 0
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 30 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 24
CTC 18 | CCC 6 | CAC 36 | CGC 24
CTA 12 | CCA 12 | Gln Q CAA 6 | CGA 12
CTG 102 | CCG 6 | CAG 30 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 12
ATC 12 | ACC 66 | AAC 24 | AGC 18
ATA 6 | ACA 18 | Lys K AAA 36 | Arg R AGA 0
Met M ATG 18 | ACG 18 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 48 | Asp D GAT 54 | Gly G GGT 54
GTC 42 | GCC 30 | GAC 42 | GGC 60
GTA 0 | GCA 24 | Glu E GAA 24 | GGA 18
GTG 60 | GCG 54 | GAG 60 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857
position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908
position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874
Average T:0.21148 C:0.27031 A:0.19608 G:0.32213
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -945.951232 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300027 1.299930
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30003
omega (dN/dS) = 1.29993
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -945.950965 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -945.951140 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.728046 0.149672 0.000001 1.332962
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.72805 0.14967 0.12228
w: 0.00000 1.00000 1.33296
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0
7..2 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0
7..3 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0
7..4 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0
7..5 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0
7..6 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -945.950965 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.905527
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.90553
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -945.951143 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.782188 0.005000 1.736161 1.486608
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.78219 p = 0.00500 q = 1.73616
(p1 = 0.21781) w = 1.48661
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.21781
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.48661
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0
7..2 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0
7..3 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0
7..4 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0
7..5 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0
7..6 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:23
Model 1: NearlyNeutral -945.950965 Model 2: PositiveSelection -945.95114 Model 0: one-ratio -945.951232 Model 7: beta -945.950965 Model 8: beta&w>1 -945.951143 Model 0 vs 1 5.340000000160217E-4 Model 2 vs 1 3.5000000002582965E-4 Model 8 vs 7 3.560000000106811E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
