--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:28:24 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/11res/rnc/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -977.49 -980.23 2 -977.46 -980.18 -------------------------------------- TOTAL -977.48 -980.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897657 0.087234 0.348370 1.458194 0.873493 1501.00 1501.00 1.000 r(A<->C){all} 0.168382 0.020288 0.000001 0.461061 0.130394 208.75 216.96 1.000 r(A<->G){all} 0.163346 0.019383 0.000008 0.453785 0.126661 235.71 274.99 1.007 r(A<->T){all} 0.161887 0.019331 0.000024 0.445972 0.124379 197.24 329.80 1.000 r(C<->G){all} 0.166404 0.020463 0.000093 0.448463 0.127245 199.23 209.59 1.002 r(C<->T){all} 0.167018 0.021545 0.000448 0.467162 0.125030 260.65 288.01 1.000 r(G<->T){all} 0.172962 0.022269 0.000289 0.461311 0.133254 153.90 163.25 1.001 pi(A){all} 0.196108 0.000220 0.168210 0.225227 0.196233 1179.93 1288.30 1.001 pi(C){all} 0.270185 0.000273 0.239421 0.304534 0.270198 1282.98 1329.33 1.001 pi(G){all} 0.322361 0.000292 0.292725 0.359573 0.322204 1340.99 1365.50 1.000 pi(T){all} 0.211345 0.000222 0.184655 0.243363 0.211129 1283.66 1284.73 1.000 alpha{1,2} 0.436816 0.262576 0.000293 1.438817 0.253421 1083.51 1205.99 1.000 alpha{3} 0.458607 0.236024 0.000163 1.455973 0.286676 1236.52 1274.23 1.000 pinvar{all} 0.997842 0.000007 0.993204 0.999999 0.998648 890.86 1038.83 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -945.950965 Model 2: PositiveSelection -945.95114 Model 0: one-ratio -945.951232 Model 7: beta -945.950965 Model 8: beta&w>1 -945.951143 Model 0 vs 1 5.340000000160217E-4 Model 2 vs 1 3.5000000002582965E-4 Model 8 vs 7 3.560000000106811E-4
>C1 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C2 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C3 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C4 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C5 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C6 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238 C1 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C2 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C3 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C4 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C5 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C6 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV ************************************************** C1 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C2 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C3 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C4 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C5 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C6 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL ************************************************** C1 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C2 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C3 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C4 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C5 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C6 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL ************************************************** C1 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C2 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C3 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C4 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C5 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C6 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM ************************************************** C1 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C2 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C3 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C4 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C5 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C6 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV ************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 238 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 238 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7140] Library Relaxation: Multi_proc [96] Relaxation Summary: [7140]--->[7140] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.778 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C2 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C3 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C4 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C5 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV C6 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV ************************************************** C1 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C2 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C3 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C4 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C5 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL C6 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL ************************************************** C1 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C2 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C3 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C4 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C5 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL C6 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL ************************************************** C1 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C2 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C3 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C4 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C5 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM C6 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM ************************************************** C1 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C2 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C3 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C4 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C5 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV C6 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV ************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC C2 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC C3 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC C4 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC C5 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC C6 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC ************************************************** C1 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC C2 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC C3 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC C4 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC C5 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC C6 TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ************************************************** C1 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC C2 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC C3 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC C4 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC C5 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC C6 ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC ************************************************** C1 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC C2 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC C3 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC C4 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC C5 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC C6 CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC ************************************************** C1 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC C2 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC C3 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC C4 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC C5 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC C6 GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC ************************************************** C1 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG C2 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG C3 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG C4 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG C5 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG C6 TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG ************************************************** C1 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT C2 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT C3 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT C4 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT C5 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT C6 CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ************************************************** C1 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG C2 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG C3 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG C4 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG C5 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG C6 ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG ************************************************** C1 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG C2 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG C3 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG C4 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG C5 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG C6 GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG ************************************************** C1 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA C2 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA C3 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA C4 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA C5 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA C6 GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA ************************************************** C1 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT C2 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT C3 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT C4 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT C5 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT C6 GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT ************************************************** C1 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG C2 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG C3 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG C4 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG C5 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG C6 CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG ************************************************** C1 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA C2 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA C3 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA C4 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA C5 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA C6 GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA ************************************************** C1 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG C2 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG C3 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG C4 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG C5 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG C6 GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG ************************************************** C1 GGAAAACGTCCGTG C2 GGAAAACGTCCGTG C3 GGAAAACGTCCGTG C4 GGAAAACGTCCGTG C5 GGAAAACGTCCGTG C6 GGAAAACGTCCGTG ************** >C1 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >C2 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >C3 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >C4 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >C5 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >C6 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >C1 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C2 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C3 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C4 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C5 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >C6 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 714 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579789616 Setting output file names to "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1542864648 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0877481311 Seed = 2124774355 Swapseed = 1579789616 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1597.966227 -- -24.965149 Chain 2 -- -1597.966227 -- -24.965149 Chain 3 -- -1597.966227 -- -24.965149 Chain 4 -- -1597.966227 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1597.965984 -- -24.965149 Chain 2 -- -1597.966227 -- -24.965149 Chain 3 -- -1597.966227 -- -24.965149 Chain 4 -- -1597.966135 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1597.966] (-1597.966) (-1597.966) (-1597.966) * [-1597.966] (-1597.966) (-1597.966) (-1597.966) 500 -- [-983.479] (-990.836) (-992.443) (-996.162) * [-984.510] (-990.855) (-989.435) (-997.868) -- 0:00:00 1000 -- [-990.041] (-998.017) (-992.318) (-989.953) * (-992.763) (-1002.319) [-983.810] (-993.125) -- 0:00:00 1500 -- (-987.457) [-988.160] (-991.411) (-988.918) * (-985.487) (-991.314) (-986.522) [-986.711] -- 0:00:00 2000 -- (-989.989) (-995.993) (-989.842) [-982.073] * (-987.829) (-994.215) [-981.997] (-989.329) -- 0:00:00 2500 -- (-982.845) (-985.236) [-985.579] (-986.841) * [-986.938] (-980.847) (-983.605) (-993.266) -- 0:00:00 3000 -- (-982.966) (-987.917) [-987.707] (-986.749) * (-990.000) (-986.558) [-988.949] (-986.878) -- 0:00:00 3500 -- [-986.794] (-986.019) (-983.972) (-986.286) * (-985.211) (-984.047) (-992.172) [-983.580] -- 0:00:00 4000 -- (-989.249) (-992.427) [-987.003] (-985.213) * (-981.244) (-995.273) (-984.376) [-985.732] -- 0:00:00 4500 -- (-995.513) (-991.472) (-988.957) [-981.570] * (-989.542) (-985.261) [-989.610] (-989.492) -- 0:00:00 5000 -- (-985.234) (-980.918) [-984.681] (-992.729) * (-986.286) [-994.634] (-996.135) (-989.061) -- 0:00:00 Average standard deviation of split frequencies: 0.092852 5500 -- (-986.577) (-993.840) [-987.718] (-990.170) * (-982.649) (-988.382) (-980.734) [-985.283] -- 0:00:00 6000 -- (-989.908) (-989.046) [-986.679] (-986.429) * (-985.952) (-984.342) (-989.539) [-983.594] -- 0:00:00 6500 -- [-983.727] (-986.574) (-987.735) (-987.212) * (-982.904) (-984.025) [-985.110] (-988.268) -- 0:00:00 7000 -- (-989.564) (-989.592) (-986.480) [-982.707] * (-985.159) (-983.225) [-986.555] (-984.272) -- 0:00:00 7500 -- (-987.009) (-988.937) (-985.382) [-992.108] * (-982.828) [-984.934] (-983.704) (-993.261) -- 0:00:00 8000 -- (-982.520) (-986.090) (-984.980) [-982.972] * (-984.209) (-990.470) (-988.417) [-984.302] -- 0:00:00 8500 -- (-990.348) (-983.312) [-989.489] (-985.810) * (-987.337) [-991.118] (-987.640) (-981.983) -- 0:00:00 9000 -- (-992.822) [-983.957] (-986.336) (-989.944) * [-982.961] (-986.531) (-989.867) (-983.429) -- 0:00:00 9500 -- (-993.219) (-980.958) (-982.141) [-985.571] * [-986.291] (-995.934) (-993.600) (-989.625) -- 0:00:00 10000 -- (-985.872) (-987.053) (-986.635) [-993.138] * (-990.227) (-985.977) [-986.834] (-988.382) -- 0:00:00 Average standard deviation of split frequencies: 0.081410 10500 -- (-986.784) (-996.504) [-988.853] (-995.302) * (-982.553) (-984.022) (-989.291) [-990.910] -- 0:00:00 11000 -- [-989.622] (-987.646) (-987.674) (-990.246) * (-989.104) (-987.758) (-987.435) [-985.531] -- 0:00:00 11500 -- [-982.674] (-983.570) (-989.332) (-983.785) * (-983.890) [-985.879] (-986.027) (-987.753) -- 0:00:00 12000 -- [-985.582] (-992.413) (-986.988) (-993.027) * (-982.633) (-993.384) [-987.232] (-985.411) -- 0:01:22 12500 -- (-983.971) (-986.202) (-984.314) [-985.580] * [-981.353] (-988.068) (-987.752) (-985.413) -- 0:01:19 13000 -- [-983.980] (-986.693) (-996.044) (-980.619) * [-983.541] (-985.818) (-988.032) (-993.338) -- 0:01:15 13500 -- (-985.777) (-989.431) [-984.379] (-986.200) * [-988.996] (-985.266) (-993.396) (-984.265) -- 0:01:13 14000 -- (-997.665) (-988.319) (-1004.091) [-988.297] * [-987.198] (-991.851) (-986.445) (-989.116) -- 0:01:10 14500 -- [-992.239] (-991.221) (-990.489) (-992.067) * [-986.275] (-989.102) (-984.881) (-990.525) -- 0:01:07 15000 -- (-992.990) (-989.262) [-983.181] (-989.173) * [-983.653] (-988.164) (-987.246) (-984.920) -- 0:01:05 Average standard deviation of split frequencies: 0.062854 15500 -- [-991.014] (-999.951) (-988.840) (-982.701) * (-986.153) [-984.154] (-984.726) (-985.165) -- 0:01:03 16000 -- (-994.367) (-990.912) [-990.370] (-992.409) * [-986.020] (-986.993) (-984.072) (-990.787) -- 0:01:01 16500 -- (-994.306) (-980.869) [-993.121] (-992.612) * (-986.985) [-983.611] (-993.657) (-990.022) -- 0:00:59 17000 -- [-988.672] (-982.789) (-990.142) (-988.445) * (-987.832) (-984.612) [-988.575] (-994.616) -- 0:00:57 17500 -- (-985.766) [-989.641] (-986.759) (-998.864) * (-986.936) (-985.619) (-984.785) [-982.480] -- 0:00:56 18000 -- (-989.163) (-990.439) [-987.332] (-991.643) * (-983.948) [-986.149] (-985.077) (-990.394) -- 0:00:54 18500 -- [-985.544] (-988.435) (-988.505) (-989.954) * [-986.932] (-983.247) (-988.725) (-988.198) -- 0:00:53 19000 -- [-986.762] (-988.126) (-992.973) (-1000.272) * (-994.212) (-985.819) (-991.002) [-983.194] -- 0:00:51 19500 -- [-981.407] (-987.748) (-986.534) (-990.841) * (-984.675) (-981.473) [-986.715] (-991.672) -- 0:00:50 20000 -- [-987.122] (-996.790) (-991.836) (-1003.677) * (-986.743) [-976.379] (-989.293) (-995.018) -- 0:00:49 Average standard deviation of split frequencies: 0.065388 20500 -- [-981.109] (-992.258) (-993.123) (-981.185) * (-986.931) [-978.566] (-989.488) (-987.138) -- 0:00:47 21000 -- (-989.773) (-988.471) (-991.770) [-978.701] * (-986.765) [-978.914] (-989.018) (-989.193) -- 0:00:46 21500 -- (-986.591) [-979.295] (-986.914) (-980.165) * (-997.053) (-976.841) [-985.630] (-990.142) -- 0:00:45 22000 -- (-985.264) [-976.505] (-994.640) (-977.649) * (-991.322) (-977.813) (-996.641) [-988.518] -- 0:00:44 22500 -- (-977.784) (-976.976) (-987.197) [-979.811] * (-984.085) (-980.049) [-988.535] (-984.253) -- 0:00:43 23000 -- (-979.074) [-976.357] (-986.679) (-977.217) * (-993.392) [-977.338] (-983.274) (-976.283) -- 0:00:42 23500 -- (-976.959) [-976.730] (-981.230) (-977.743) * [-982.990] (-977.802) (-991.306) (-979.242) -- 0:00:41 24000 -- (-979.403) [-977.094] (-981.291) (-977.680) * (-990.037) (-981.356) (-994.078) [-979.182] -- 0:00:40 24500 -- (-978.246) (-976.692) [-983.837] (-976.046) * (-999.570) (-976.414) (-996.376) [-980.822] -- 0:00:39 25000 -- [-978.921] (-979.101) (-983.618) (-978.239) * (-988.492) [-976.683] (-986.168) (-979.257) -- 0:00:39 Average standard deviation of split frequencies: 0.062981 25500 -- (-978.178) (-979.263) (-996.744) [-976.811] * (-990.149) [-977.253] (-990.842) (-981.448) -- 0:00:38 26000 -- [-979.440] (-979.792) (-986.385) (-978.132) * (-994.373) [-980.014] (-985.513) (-980.895) -- 0:00:37 26500 -- (-979.996) [-976.991] (-985.038) (-978.255) * (-1003.150) [-983.200] (-988.862) (-978.179) -- 0:00:36 27000 -- (-979.556) [-978.293] (-985.311) (-977.368) * (-987.863) (-981.462) (-991.629) [-977.606] -- 0:00:36 27500 -- (-980.786) (-977.550) [-984.324] (-976.179) * [-992.925] (-977.032) (-985.148) (-977.766) -- 0:01:10 28000 -- (-977.218) (-977.286) (-989.898) [-976.190] * (-987.861) (-978.072) (-987.841) [-977.131] -- 0:01:09 28500 -- [-976.270] (-977.738) (-988.925) (-978.107) * (-989.150) (-976.877) [-985.244] (-977.153) -- 0:01:08 29000 -- (-977.027) (-982.427) (-989.407) [-980.368] * (-991.915) (-977.696) (-981.857) [-976.454] -- 0:01:06 29500 -- (-976.975) (-985.656) (-990.770) [-978.341] * (-984.088) (-978.122) (-987.455) [-980.187] -- 0:01:05 30000 -- (-977.825) (-976.734) [-988.994] (-977.470) * (-989.471) (-978.255) [-987.509] (-976.430) -- 0:01:04 Average standard deviation of split frequencies: 0.053397 30500 -- (-977.762) (-976.581) (-990.220) [-979.393] * (-991.929) (-978.635) [-984.936] (-976.771) -- 0:01:03 31000 -- [-977.811] (-979.377) (-997.593) (-982.868) * (-988.264) (-976.846) [-987.456] (-978.268) -- 0:01:02 31500 -- (-978.352) [-980.204] (-989.523) (-976.621) * (-989.944) [-977.159] (-986.915) (-979.613) -- 0:01:01 32000 -- [-978.427] (-979.389) (-989.025) (-976.067) * (-987.718) (-978.295) [-985.141] (-979.319) -- 0:01:00 32500 -- [-977.322] (-977.423) (-991.535) (-978.480) * (-986.890) (-976.893) [-986.383] (-979.023) -- 0:00:59 33000 -- [-976.663] (-978.282) (-991.017) (-976.972) * (-986.543) (-979.091) (-992.374) [-978.259] -- 0:00:58 33500 -- [-977.237] (-978.069) (-989.193) (-976.501) * (-994.691) [-978.816] (-990.234) (-978.293) -- 0:00:57 34000 -- (-981.643) (-983.115) [-985.199] (-977.059) * (-990.646) (-977.715) [-991.938] (-978.352) -- 0:00:56 34500 -- [-976.810] (-980.829) (-995.607) (-976.223) * (-987.427) [-977.767] (-994.088) (-977.740) -- 0:00:55 35000 -- [-976.768] (-976.721) (-994.437) (-977.542) * [-982.857] (-980.977) (-983.868) (-980.444) -- 0:00:55 Average standard deviation of split frequencies: 0.048243 35500 -- (-978.100) (-977.288) (-984.219) [-977.628] * (-989.084) (-983.099) [-981.109] (-979.282) -- 0:00:54 36000 -- (-976.647) (-978.582) [-985.651] (-979.867) * (-988.987) (-977.554) (-981.267) [-976.916] -- 0:00:53 36500 -- (-976.997) [-978.355] (-981.575) (-980.128) * [-985.176] (-977.569) (-996.117) (-978.902) -- 0:00:52 37000 -- (-977.114) (-983.565) (-1001.095) [-978.650] * (-984.723) [-977.242] (-985.547) (-980.163) -- 0:00:52 37500 -- (-976.250) (-979.771) [-990.276] (-976.920) * (-990.429) (-979.661) (-987.795) [-978.234] -- 0:00:51 38000 -- (-982.562) (-976.715) (-992.129) [-977.353] * (-983.254) [-980.120] (-985.374) (-978.103) -- 0:00:50 38500 -- (-978.883) [-977.426] (-986.663) (-979.357) * [-991.786] (-978.060) (-983.146) (-978.918) -- 0:00:49 39000 -- [-978.682] (-978.326) (-986.532) (-979.509) * (-991.756) (-980.290) [-993.577] (-979.895) -- 0:00:49 39500 -- (-979.969) (-980.156) [-993.149] (-977.219) * (-991.332) (-980.544) [-984.891] (-976.531) -- 0:00:48 40000 -- (-979.079) [-978.941] (-988.079) (-977.765) * (-990.875) [-980.580] (-985.446) (-980.660) -- 0:00:48 Average standard deviation of split frequencies: 0.034094 40500 -- (-976.873) [-977.707] (-987.781) (-979.793) * (-985.139) (-980.029) [-986.864] (-981.084) -- 0:00:47 41000 -- (-979.027) (-977.301) (-985.262) [-979.841] * (-983.181) [-980.712] (-989.518) (-979.308) -- 0:00:46 41500 -- (-978.948) (-977.315) (-988.360) [-977.247] * (-989.247) (-978.496) (-985.573) [-978.212] -- 0:00:46 42000 -- (-980.892) [-980.352] (-988.333) (-976.819) * (-983.613) [-976.582] (-991.444) (-978.103) -- 0:00:45 42500 -- (-978.141) (-979.895) (-989.124) [-976.216] * [-982.264] (-977.416) (-987.714) (-978.190) -- 0:00:45 43000 -- (-978.790) (-985.256) (-983.911) [-977.567] * [-994.191] (-979.145) (-983.409) (-980.804) -- 0:00:44 43500 -- (-976.448) (-980.907) [-984.684] (-977.338) * [-987.877] (-980.096) (-989.159) (-977.508) -- 0:00:43 44000 -- (-976.466) (-977.396) [-983.232] (-976.442) * (-994.173) [-976.689] (-983.934) (-977.509) -- 0:01:05 44500 -- (-980.410) (-978.721) [-986.031] (-976.368) * (-989.813) (-976.977) [-987.279] (-980.539) -- 0:01:04 45000 -- (-978.954) [-978.512] (-984.421) (-977.261) * (-988.720) [-975.843] (-985.236) (-977.275) -- 0:01:03 Average standard deviation of split frequencies: 0.028304 45500 -- (-980.328) [-977.702] (-982.616) (-978.370) * [-984.199] (-976.904) (-991.351) (-977.920) -- 0:01:02 46000 -- (-980.257) (-976.863) [-978.272] (-979.544) * (-991.894) (-980.022) [-977.956] (-976.732) -- 0:01:02 46500 -- (-979.489) (-979.845) (-977.181) [-980.094] * (-982.342) [-978.434] (-978.070) (-976.580) -- 0:01:01 47000 -- (-981.621) (-983.616) (-978.201) [-981.099] * (-985.297) [-978.702] (-980.503) (-976.963) -- 0:01:00 47500 -- (-981.523) [-978.640] (-977.905) (-979.665) * [-987.018] (-979.654) (-979.946) (-980.476) -- 0:01:00 48000 -- (-982.024) (-980.247) (-977.147) [-981.299] * (-988.263) (-977.541) (-984.349) [-977.968] -- 0:00:59 48500 -- (-983.069) [-981.746] (-975.992) (-981.041) * [-983.639] (-979.034) (-980.473) (-979.288) -- 0:00:58 49000 -- (-977.621) (-978.456) [-976.932] (-977.977) * (-992.463) (-980.616) (-980.067) [-980.132] -- 0:00:58 49500 -- (-978.943) (-977.093) [-977.686] (-980.155) * (-982.194) [-978.094] (-978.214) (-977.819) -- 0:00:57 50000 -- [-976.709] (-976.955) (-980.807) (-976.495) * (-980.109) [-981.002] (-977.375) (-977.758) -- 0:00:57 Average standard deviation of split frequencies: 0.029684 50500 -- (-976.176) [-977.417] (-978.047) (-976.534) * (-979.806) (-978.000) [-976.776] (-977.768) -- 0:00:56 51000 -- (-978.552) [-977.464] (-978.666) (-979.139) * (-978.458) (-977.736) [-977.857] (-977.738) -- 0:00:55 51500 -- (-977.945) (-976.809) (-979.586) [-978.048] * (-976.460) (-979.482) [-977.699] (-978.973) -- 0:00:55 52000 -- (-976.939) (-980.101) [-978.778] (-978.211) * [-978.349] (-977.621) (-979.604) (-980.442) -- 0:00:54 52500 -- (-976.008) (-984.230) (-977.151) [-977.311] * (-976.627) [-978.586] (-977.311) (-976.892) -- 0:00:54 53000 -- [-977.213] (-982.000) (-976.438) (-977.915) * (-978.200) [-977.382] (-976.999) (-975.947) -- 0:00:53 53500 -- (-977.377) (-978.553) [-978.072] (-982.001) * [-975.901] (-977.329) (-976.760) (-976.561) -- 0:00:53 54000 -- (-977.580) (-978.751) [-977.905] (-985.031) * (-976.456) (-977.386) (-977.271) [-977.306] -- 0:00:52 54500 -- (-978.426) [-977.152] (-978.092) (-977.399) * (-980.468) [-979.216] (-977.548) (-976.406) -- 0:00:52 55000 -- [-977.423] (-978.224) (-979.058) (-978.107) * (-977.830) (-979.557) (-977.816) [-979.179] -- 0:00:51 Average standard deviation of split frequencies: 0.027469 55500 -- [-976.895] (-978.810) (-978.314) (-978.372) * [-978.220] (-977.444) (-978.802) (-979.113) -- 0:00:51 56000 -- (-977.727) (-979.167) (-977.861) [-977.616] * (-982.144) (-977.544) (-977.089) [-979.204] -- 0:00:50 56500 -- [-978.373] (-977.366) (-979.844) (-978.698) * (-980.342) (-977.419) (-978.400) [-977.372] -- 0:00:50 57000 -- (-979.556) [-978.308] (-978.199) (-976.184) * (-979.629) [-977.505] (-976.766) (-980.403) -- 0:00:49 57500 -- (-976.936) (-979.160) [-976.851] (-978.233) * (-981.250) (-978.666) [-978.872] (-980.110) -- 0:00:49 58000 -- (-978.248) (-979.677) [-977.628] (-978.914) * [-978.376] (-980.052) (-980.242) (-979.152) -- 0:00:48 58500 -- (-976.266) (-979.824) [-976.512] (-979.207) * (-977.941) (-978.400) [-983.474] (-976.736) -- 0:00:48 59000 -- [-976.596] (-978.748) (-976.829) (-977.579) * (-980.593) [-976.448] (-981.362) (-977.094) -- 0:00:47 59500 -- (-977.512) [-978.989] (-976.668) (-976.153) * (-979.061) (-977.437) [-978.547] (-982.951) -- 0:00:47 60000 -- (-978.022) (-978.153) (-978.298) [-976.270] * (-978.713) (-976.974) [-977.105] (-977.867) -- 0:01:02 Average standard deviation of split frequencies: 0.031491 60500 -- (-978.429) (-981.969) [-980.723] (-976.270) * (-980.581) [-976.695] (-976.837) (-976.720) -- 0:01:02 61000 -- [-976.979] (-979.344) (-977.606) (-977.110) * (-979.492) [-978.654] (-978.910) (-979.777) -- 0:01:01 61500 -- (-977.850) (-976.955) (-979.233) [-977.083] * (-980.492) (-979.242) (-979.716) [-976.271] -- 0:01:01 62000 -- (-979.180) (-976.125) [-980.035] (-979.027) * (-977.312) (-981.394) (-976.783) [-978.893] -- 0:01:00 62500 -- (-979.956) [-976.411] (-977.698) (-981.666) * [-977.460] (-977.558) (-976.783) (-981.067) -- 0:01:00 63000 -- (-977.224) (-976.488) [-977.054] (-978.978) * (-977.704) [-982.542] (-977.303) (-977.395) -- 0:00:59 63500 -- (-977.701) (-979.430) (-980.625) [-978.806] * (-977.249) [-976.979] (-977.365) (-977.720) -- 0:00:58 64000 -- (-977.523) (-977.603) (-980.596) [-978.525] * [-976.611] (-977.009) (-978.182) (-976.567) -- 0:00:58 64500 -- (-977.593) [-977.472] (-980.194) (-976.921) * (-977.298) (-977.453) [-978.393] (-977.207) -- 0:00:58 65000 -- (-978.450) (-977.517) [-978.526] (-977.407) * (-977.564) (-976.893) (-978.101) [-977.144] -- 0:00:57 Average standard deviation of split frequencies: 0.032855 65500 -- [-976.934] (-977.979) (-978.380) (-980.094) * (-978.856) (-978.120) [-979.296] (-976.492) -- 0:00:57 66000 -- (-978.251) (-978.260) [-978.235] (-978.737) * (-977.285) (-976.780) [-978.065] (-978.955) -- 0:00:56 66500 -- [-979.061] (-977.475) (-978.033) (-977.149) * (-979.626) [-976.734] (-978.361) (-976.987) -- 0:00:56 67000 -- [-977.308] (-977.187) (-976.327) (-977.625) * (-981.425) (-976.300) (-977.255) [-976.945] -- 0:00:55 67500 -- (-978.503) (-976.610) (-976.988) [-977.929] * (-978.352) (-976.256) [-978.117] (-989.031) -- 0:00:55 68000 -- (-977.762) (-977.066) (-976.307) [-982.201] * [-981.101] (-977.435) (-977.241) (-985.804) -- 0:00:54 68500 -- (-979.489) (-978.085) [-977.366] (-981.940) * (-977.740) (-980.051) (-976.551) [-979.590] -- 0:00:54 69000 -- (-979.221) [-977.912] (-978.248) (-984.410) * [-977.830] (-980.162) (-976.838) (-979.885) -- 0:00:53 69500 -- (-978.129) (-979.018) (-977.171) [-980.422] * (-977.459) [-978.508] (-982.507) (-980.511) -- 0:00:53 70000 -- [-976.906] (-977.150) (-977.523) (-980.538) * (-980.343) (-977.053) [-979.902] (-976.373) -- 0:00:53 Average standard deviation of split frequencies: 0.032020 70500 -- (-976.412) (-979.492) (-978.665) [-978.390] * (-979.876) (-976.318) (-982.558) [-978.657] -- 0:00:52 71000 -- (-977.407) [-977.684] (-978.875) (-978.983) * [-977.562] (-979.370) (-980.241) (-978.710) -- 0:00:52 71500 -- (-976.726) (-979.043) (-977.363) [-976.557] * (-980.539) (-978.590) (-977.631) [-976.974] -- 0:00:51 72000 -- (-976.152) (-978.814) (-976.086) [-976.859] * (-976.262) (-977.038) [-976.099] (-978.857) -- 0:00:51 72500 -- [-979.053] (-979.407) (-976.736) (-978.096) * (-978.741) (-976.941) [-976.081] (-976.262) -- 0:00:51 73000 -- (-980.951) (-976.098) [-979.353] (-978.535) * (-977.037) (-978.436) (-976.088) [-980.160] -- 0:00:50 73500 -- (-976.612) (-976.854) (-979.215) [-979.612] * (-976.888) [-976.838] (-979.964) (-980.057) -- 0:00:50 74000 -- [-977.225] (-977.910) (-979.874) (-976.139) * (-977.799) [-976.406] (-979.038) (-978.297) -- 0:00:50 74500 -- (-976.616) [-977.010] (-978.120) (-977.803) * [-978.213] (-977.236) (-978.807) (-980.259) -- 0:00:49 75000 -- (-981.629) (-977.767) (-977.853) [-976.912] * [-977.608] (-977.084) (-979.169) (-977.040) -- 0:00:49 Average standard deviation of split frequencies: 0.030703 75500 -- (-978.500) [-977.398] (-981.433) (-977.196) * [-979.254] (-977.086) (-980.003) (-976.979) -- 0:00:48 76000 -- (-977.887) [-977.386] (-979.922) (-976.256) * (-978.675) (-977.718) (-983.178) [-981.050] -- 0:01:00 76500 -- (-980.064) [-976.621] (-978.456) (-976.932) * (-981.083) (-977.536) (-976.161) [-979.505] -- 0:01:00 77000 -- (-979.802) [-978.891] (-978.630) (-980.143) * [-980.924] (-981.499) (-978.973) (-976.293) -- 0:00:59 77500 -- (-980.209) (-978.219) (-979.239) [-979.249] * (-982.569) [-977.258] (-980.521) (-976.293) -- 0:00:59 78000 -- (-981.686) [-977.234] (-980.309) (-977.835) * (-979.809) (-978.609) (-979.378) [-980.656] -- 0:00:59 78500 -- (-981.535) [-977.088] (-978.054) (-977.829) * (-980.033) [-977.734] (-978.324) (-979.310) -- 0:00:58 79000 -- [-977.059] (-976.900) (-977.404) (-979.145) * (-978.999) [-976.396] (-977.733) (-977.188) -- 0:00:58 79500 -- (-977.368) (-976.694) (-978.071) [-976.678] * (-978.887) (-977.163) [-978.939] (-979.046) -- 0:00:57 80000 -- [-976.757] (-976.959) (-977.913) (-976.490) * [-976.765] (-978.647) (-978.125) (-981.764) -- 0:00:57 Average standard deviation of split frequencies: 0.027596 80500 -- [-976.596] (-976.470) (-976.304) (-976.754) * (-981.442) [-976.903] (-978.204) (-977.209) -- 0:00:57 81000 -- [-976.130] (-977.401) (-978.522) (-979.055) * (-977.818) (-977.343) [-978.452] (-980.823) -- 0:00:56 81500 -- (-976.381) (-978.453) (-977.089) [-980.275] * (-976.344) (-979.363) [-978.084] (-978.669) -- 0:00:56 82000 -- (-976.849) (-977.057) (-979.465) [-976.489] * [-977.549] (-982.365) (-978.487) (-977.740) -- 0:00:55 82500 -- (-976.538) (-979.350) (-978.546) [-979.017] * [-977.252] (-977.730) (-979.725) (-977.835) -- 0:00:55 83000 -- (-980.156) [-978.470] (-978.321) (-975.901) * (-977.077) (-977.906) [-981.860] (-977.808) -- 0:00:55 83500 -- (-977.360) [-977.164] (-978.780) (-975.829) * (-978.081) (-977.721) (-978.090) [-977.337] -- 0:00:54 84000 -- (-979.835) [-978.001] (-978.013) (-977.990) * (-977.981) (-980.767) [-978.710] (-979.394) -- 0:00:54 84500 -- [-977.606] (-978.148) (-977.936) (-977.945) * (-979.279) [-978.209] (-982.589) (-982.191) -- 0:00:54 85000 -- (-978.170) (-979.271) [-982.407] (-981.895) * [-976.573] (-978.628) (-979.357) (-979.020) -- 0:00:53 Average standard deviation of split frequencies: 0.028930 85500 -- (-977.668) (-978.205) (-986.455) [-978.882] * (-976.432) [-976.899] (-977.139) (-979.624) -- 0:00:53 86000 -- (-980.116) (-977.857) (-983.313) [-981.095] * [-977.476] (-976.568) (-982.414) (-977.952) -- 0:00:53 86500 -- (-980.289) [-977.598] (-977.781) (-982.510) * (-976.975) (-977.075) [-979.504] (-976.723) -- 0:00:52 87000 -- [-981.248] (-977.706) (-977.779) (-979.044) * (-979.183) [-977.764] (-977.818) (-977.785) -- 0:00:52 87500 -- (-976.923) (-976.654) (-979.309) [-980.862] * (-978.789) (-980.201) (-978.019) [-976.618] -- 0:00:52 88000 -- (-976.211) [-976.386] (-981.293) (-979.338) * (-977.389) (-978.927) [-977.738] (-977.333) -- 0:00:51 88500 -- (-976.893) (-978.359) [-977.554] (-978.621) * (-980.852) [-977.764] (-977.281) (-977.350) -- 0:00:51 89000 -- (-978.722) (-981.130) (-977.652) [-977.368] * (-981.883) (-982.275) [-976.756] (-977.336) -- 0:00:51 89500 -- [-978.995] (-979.723) (-979.756) (-979.876) * (-977.572) [-979.355] (-980.710) (-981.998) -- 0:00:50 90000 -- (-977.145) [-978.171] (-978.770) (-980.755) * (-985.133) [-980.195] (-976.445) (-976.909) -- 0:00:50 Average standard deviation of split frequencies: 0.027730 90500 -- (-982.929) [-977.679] (-980.257) (-981.481) * (-982.267) (-983.452) [-976.941] (-978.739) -- 0:00:50 91000 -- (-978.918) (-980.879) [-978.920] (-981.256) * [-976.682] (-982.251) (-976.615) (-977.205) -- 0:00:49 91500 -- (-982.517) (-977.010) (-976.558) [-976.891] * [-981.156] (-985.304) (-980.264) (-978.014) -- 0:00:49 92000 -- (-978.158) (-976.976) [-976.941] (-978.629) * (-976.718) (-980.120) (-978.050) [-979.342] -- 0:00:49 92500 -- (-977.457) (-977.897) [-976.938] (-977.036) * (-983.166) (-982.076) (-977.091) [-982.286] -- 0:00:58 93000 -- (-984.267) [-977.082] (-976.937) (-976.134) * [-977.498] (-976.298) (-977.763) (-977.933) -- 0:00:58 93500 -- (-982.581) (-976.689) [-977.678] (-976.379) * (-980.282) (-976.525) [-976.791] (-976.923) -- 0:00:58 94000 -- (-979.370) (-976.689) [-976.915] (-977.502) * (-978.303) [-976.429] (-980.232) (-977.782) -- 0:00:57 94500 -- (-979.021) [-977.326] (-978.203) (-977.171) * (-977.085) (-977.499) (-977.576) [-977.553] -- 0:00:57 95000 -- (-979.540) [-977.064] (-981.456) (-978.128) * [-977.793] (-978.763) (-979.779) (-976.791) -- 0:00:57 Average standard deviation of split frequencies: 0.025644 95500 -- (-981.579) [-977.974] (-979.040) (-980.030) * (-977.206) (-976.389) (-978.632) [-977.069] -- 0:00:56 96000 -- (-980.122) (-982.790) [-978.535] (-976.536) * (-976.209) (-977.188) (-978.342) [-977.063] -- 0:00:56 96500 -- (-980.384) [-977.798] (-976.916) (-975.902) * [-978.471] (-981.141) (-977.073) (-978.382) -- 0:00:56 97000 -- [-977.107] (-981.404) (-977.130) (-976.185) * (-978.966) [-978.004] (-976.779) (-978.224) -- 0:00:55 97500 -- [-976.839] (-981.808) (-976.571) (-977.708) * (-978.603) (-977.738) [-982.140] (-979.393) -- 0:00:55 98000 -- (-976.877) (-981.327) (-979.354) [-978.986] * [-976.708] (-980.997) (-982.222) (-977.365) -- 0:00:55 98500 -- (-979.006) (-983.315) (-978.252) [-979.223] * (-978.058) (-979.075) (-981.450) [-979.264] -- 0:00:54 99000 -- (-978.261) (-981.523) (-976.555) [-977.341] * (-978.066) [-976.956] (-978.217) (-983.331) -- 0:00:54 99500 -- [-977.222] (-976.615) (-976.630) (-978.249) * (-978.798) [-977.516] (-983.882) (-983.049) -- 0:00:54 100000 -- (-976.349) (-978.899) (-976.847) [-978.355] * [-976.989] (-977.612) (-978.108) (-982.027) -- 0:00:54 Average standard deviation of split frequencies: 0.024975 100500 -- [-976.769] (-978.635) (-977.123) (-979.030) * (-983.685) [-976.523] (-979.989) (-980.872) -- 0:00:53 101000 -- (-975.829) (-979.903) (-976.590) [-978.949] * (-977.603) (-976.999) (-979.836) [-980.112] -- 0:00:53 101500 -- (-977.868) [-977.865] (-976.576) (-981.812) * (-980.161) (-978.787) [-976.820] (-979.976) -- 0:00:53 102000 -- (-977.616) (-979.602) [-978.211] (-978.246) * (-979.999) [-977.938] (-978.526) (-976.371) -- 0:00:52 102500 -- [-978.744] (-979.315) (-976.416) (-979.851) * (-979.635) (-977.128) [-977.406] (-976.988) -- 0:00:52 103000 -- [-979.595] (-979.300) (-977.037) (-981.147) * (-978.102) [-979.250] (-979.334) (-977.688) -- 0:00:52 103500 -- (-978.397) [-977.232] (-977.052) (-978.774) * (-979.872) [-976.421] (-981.718) (-979.126) -- 0:00:51 104000 -- (-976.207) [-977.225] (-978.917) (-979.416) * (-977.618) [-976.549] (-979.126) (-980.873) -- 0:00:51 104500 -- (-979.480) (-976.553) [-977.784] (-978.012) * [-979.823] (-978.256) (-980.092) (-981.212) -- 0:00:51 105000 -- (-978.747) [-977.251] (-978.667) (-976.276) * (-976.798) [-977.671] (-977.268) (-981.064) -- 0:00:51 Average standard deviation of split frequencies: 0.024109 105500 -- (-980.235) (-979.653) [-976.483] (-979.142) * (-980.445) [-977.196] (-978.530) (-980.632) -- 0:00:50 106000 -- (-979.427) (-979.951) (-983.504) [-978.048] * (-976.861) [-979.381] (-978.890) (-977.252) -- 0:00:50 106500 -- (-976.858) (-977.678) (-976.115) [-976.138] * (-976.971) [-977.714] (-977.184) (-977.750) -- 0:00:50 107000 -- [-979.905] (-978.204) (-984.257) (-980.439) * (-977.799) (-980.671) (-977.091) [-978.461] -- 0:00:50 107500 -- (-984.379) (-979.343) [-978.835] (-978.523) * [-977.297] (-977.905) (-977.945) (-979.891) -- 0:00:49 108000 -- [-981.478] (-977.003) (-978.798) (-979.794) * (-976.479) [-979.952] (-977.959) (-976.745) -- 0:00:49 108500 -- (-986.879) [-979.324] (-977.588) (-982.489) * [-977.238] (-981.867) (-978.583) (-976.838) -- 0:00:57 109000 -- [-979.044] (-978.150) (-979.777) (-979.336) * (-977.855) (-979.818) [-979.228] (-977.717) -- 0:00:57 109500 -- (-978.106) [-976.887] (-978.169) (-977.783) * [-977.730] (-980.719) (-978.131) (-987.535) -- 0:00:56 110000 -- [-976.304] (-980.154) (-979.455) (-977.121) * (-976.873) [-977.174] (-977.301) (-983.687) -- 0:00:56 Average standard deviation of split frequencies: 0.024661 110500 -- (-982.447) [-978.754] (-982.838) (-976.259) * [-977.906] (-976.735) (-976.571) (-976.948) -- 0:00:56 111000 -- [-977.885] (-981.044) (-978.334) (-977.581) * [-978.093] (-977.972) (-976.879) (-978.099) -- 0:00:56 111500 -- (-977.132) [-978.113] (-979.103) (-979.272) * (-979.039) [-976.816] (-978.413) (-979.344) -- 0:00:55 112000 -- (-977.240) (-978.048) (-977.345) [-978.052] * [-979.447] (-976.541) (-979.748) (-982.434) -- 0:00:55 112500 -- [-976.991] (-977.424) (-979.034) (-979.590) * (-977.356) (-979.213) [-982.808] (-979.101) -- 0:00:55 113000 -- (-981.171) [-977.760] (-983.227) (-978.348) * (-979.502) (-978.890) (-977.470) [-980.267] -- 0:00:54 113500 -- [-978.292] (-979.559) (-977.768) (-978.231) * (-977.481) (-981.385) [-976.759] (-978.145) -- 0:00:54 114000 -- (-982.917) (-978.764) [-981.569] (-980.477) * (-978.136) [-979.236] (-976.903) (-978.932) -- 0:00:54 114500 -- (-979.025) [-978.442] (-978.518) (-979.662) * (-976.809) [-979.003] (-979.166) (-980.354) -- 0:00:54 115000 -- (-978.234) (-979.855) [-977.758] (-982.184) * (-978.026) (-976.749) (-976.161) [-977.388] -- 0:00:53 Average standard deviation of split frequencies: 0.024383 115500 -- [-977.181] (-980.294) (-978.053) (-981.322) * (-977.856) [-977.186] (-976.794) (-978.122) -- 0:00:53 116000 -- (-979.168) (-976.640) [-977.489] (-977.512) * (-979.853) (-978.908) (-977.229) [-979.623] -- 0:00:53 116500 -- (-978.509) (-978.182) [-977.496] (-977.024) * [-976.895] (-977.413) (-977.016) (-981.152) -- 0:00:53 117000 -- (-978.346) [-980.598] (-977.905) (-977.371) * (-976.951) (-977.114) [-977.402] (-978.663) -- 0:00:52 117500 -- [-976.667] (-977.515) (-980.351) (-976.741) * [-976.945] (-976.100) (-978.435) (-977.339) -- 0:00:52 118000 -- [-977.318] (-977.241) (-978.861) (-978.803) * (-977.037) [-975.901] (-979.026) (-979.145) -- 0:00:52 118500 -- [-981.099] (-977.661) (-980.509) (-978.039) * (-978.896) (-976.907) (-977.727) [-979.365] -- 0:00:52 119000 -- [-978.481] (-978.839) (-983.057) (-979.321) * (-976.741) (-977.168) [-978.513] (-977.379) -- 0:00:51 119500 -- [-978.008] (-979.489) (-982.594) (-978.312) * [-977.131] (-978.696) (-977.464) (-980.428) -- 0:00:51 120000 -- [-977.430] (-980.122) (-978.479) (-978.877) * (-978.638) [-977.711] (-981.248) (-982.051) -- 0:00:51 Average standard deviation of split frequencies: 0.024742 120500 -- (-977.156) (-978.165) [-979.824] (-980.885) * (-978.853) (-977.125) (-978.784) [-977.700] -- 0:00:51 121000 -- [-977.789] (-981.170) (-978.333) (-980.234) * [-978.487] (-976.578) (-977.034) (-978.510) -- 0:00:50 121500 -- (-980.099) (-978.750) (-977.952) [-978.988] * (-976.570) (-977.038) [-978.997] (-980.085) -- 0:00:50 122000 -- (-977.886) (-977.271) (-978.653) [-978.527] * (-977.678) (-976.425) (-979.165) [-981.139] -- 0:00:50 122500 -- (-977.059) [-977.932] (-981.254) (-979.258) * (-987.851) (-976.357) (-978.754) [-981.171] -- 0:00:50 123000 -- (-977.413) (-978.967) (-976.724) [-979.625] * (-982.970) (-976.357) [-978.983] (-981.375) -- 0:00:49 123500 -- [-977.176] (-978.682) (-977.981) (-976.969) * [-977.849] (-978.822) (-979.908) (-982.185) -- 0:00:49 124000 -- (-980.028) (-980.967) (-980.093) [-980.586] * (-978.647) [-980.506] (-979.009) (-983.059) -- 0:00:49 124500 -- (-981.353) (-977.900) (-978.918) [-980.550] * (-978.933) [-976.349] (-979.118) (-983.110) -- 0:00:56 125000 -- [-978.261] (-977.276) (-980.177) (-979.434) * (-982.057) (-977.663) [-977.321] (-980.316) -- 0:00:56 Average standard deviation of split frequencies: 0.025401 125500 -- (-977.640) (-982.726) [-977.069] (-979.977) * (-979.393) (-977.061) [-977.583] (-979.326) -- 0:00:55 126000 -- (-976.096) (-980.163) (-978.204) [-978.434] * (-976.970) (-978.350) (-977.661) [-981.476] -- 0:00:55 126500 -- (-976.427) (-978.015) [-977.496] (-980.891) * [-978.924] (-978.537) (-977.469) (-979.163) -- 0:00:55 127000 -- (-977.495) (-978.139) [-977.769] (-980.374) * [-977.697] (-977.142) (-976.116) (-979.115) -- 0:00:54 127500 -- (-979.353) [-976.465] (-981.268) (-977.939) * (-978.322) (-979.728) (-975.943) [-976.672] -- 0:00:54 128000 -- (-978.230) (-977.251) (-981.283) [-977.252] * (-979.246) (-978.413) [-977.755] (-976.811) -- 0:00:54 128500 -- [-978.621] (-978.280) (-977.695) (-977.311) * (-978.242) [-980.034] (-979.327) (-978.983) -- 0:00:54 129000 -- [-978.902] (-977.913) (-977.293) (-978.569) * (-978.417) (-979.630) (-980.826) [-976.834] -- 0:00:54 129500 -- (-976.944) (-978.461) [-978.428] (-978.136) * (-979.412) (-978.036) (-979.312) [-979.168] -- 0:00:53 130000 -- [-979.996] (-978.204) (-978.062) (-978.828) * (-980.056) (-981.672) (-981.020) [-978.095] -- 0:00:53 Average standard deviation of split frequencies: 0.026456 130500 -- (-980.368) (-978.496) (-979.109) [-981.722] * (-979.231) (-977.598) (-977.073) [-977.832] -- 0:00:53 131000 -- (-975.864) (-977.782) (-977.138) [-981.000] * (-980.341) [-976.746] (-979.296) (-978.967) -- 0:00:53 131500 -- (-979.947) (-978.414) [-976.157] (-983.697) * [-976.975] (-977.161) (-976.635) (-980.736) -- 0:00:52 132000 -- (-979.814) (-978.318) (-977.589) [-977.239] * [-977.250] (-976.573) (-976.810) (-977.536) -- 0:00:52 132500 -- (-976.651) (-980.260) (-976.815) [-978.329] * (-978.112) [-976.148] (-976.813) (-977.519) -- 0:00:52 133000 -- [-976.633] (-977.715) (-976.525) (-979.366) * (-979.150) (-977.559) [-976.811] (-978.185) -- 0:00:52 133500 -- (-979.464) [-977.093] (-979.492) (-978.061) * (-982.008) (-977.384) [-976.570] (-977.878) -- 0:00:51 134000 -- (-978.653) (-976.271) (-978.486) [-976.917] * (-977.638) (-976.738) (-977.999) [-978.645] -- 0:00:51 134500 -- (-977.367) (-976.192) [-978.473] (-979.159) * (-980.473) (-978.999) [-979.329] (-982.727) -- 0:00:51 135000 -- (-977.333) [-980.113] (-978.103) (-984.166) * (-979.785) [-976.932] (-977.099) (-982.143) -- 0:00:51 Average standard deviation of split frequencies: 0.025997 135500 -- (-977.152) [-978.495] (-979.069) (-986.209) * (-977.111) (-979.099) (-978.064) [-981.669] -- 0:00:51 136000 -- (-979.048) (-978.200) (-978.699) [-978.160] * (-979.872) [-975.907] (-978.132) (-976.366) -- 0:00:50 136500 -- (-976.125) (-978.043) (-977.824) [-976.861] * [-978.552] (-977.823) (-977.198) (-977.723) -- 0:00:50 137000 -- (-981.288) (-977.391) [-977.938] (-980.567) * (-977.720) (-983.448) (-977.238) [-977.866] -- 0:00:50 137500 -- [-981.182] (-976.786) (-977.796) (-979.418) * [-977.869] (-978.471) (-976.435) (-977.050) -- 0:00:50 138000 -- (-977.537) (-980.497) [-979.227] (-977.230) * (-977.537) (-981.047) [-978.590] (-978.523) -- 0:00:49 138500 -- [-977.041] (-979.345) (-977.414) (-977.430) * (-977.835) (-979.883) [-979.304] (-977.802) -- 0:00:49 139000 -- (-977.376) (-978.443) [-977.317] (-977.735) * [-979.727] (-981.050) (-977.790) (-977.558) -- 0:00:49 139500 -- (-979.849) (-979.452) (-981.149) [-979.229] * (-977.557) (-980.975) (-981.066) [-977.602] -- 0:00:49 140000 -- (-981.101) [-980.745] (-978.758) (-978.188) * (-978.626) [-978.009] (-981.188) (-981.893) -- 0:00:49 Average standard deviation of split frequencies: 0.025036 140500 -- [-984.864] (-979.853) (-978.435) (-978.360) * (-978.794) (-977.057) [-978.582] (-983.102) -- 0:00:55 141000 -- [-979.303] (-986.124) (-976.795) (-980.388) * [-980.512] (-976.606) (-985.322) (-979.815) -- 0:00:54 141500 -- (-978.271) (-980.087) [-979.077] (-977.116) * (-978.934) (-978.469) (-977.650) [-978.009] -- 0:00:54 142000 -- (-978.794) [-977.667] (-979.565) (-977.356) * (-977.893) (-979.048) [-978.433] (-978.350) -- 0:00:54 142500 -- (-976.887) (-977.243) (-979.122) [-976.571] * (-979.227) [-977.536] (-979.373) (-977.871) -- 0:00:54 143000 -- (-976.921) (-978.333) (-979.902) [-977.860] * [-981.224] (-981.330) (-981.674) (-978.988) -- 0:00:53 143500 -- (-978.306) (-979.131) [-978.055] (-977.498) * [-977.810] (-982.027) (-978.143) (-979.617) -- 0:00:53 144000 -- [-976.071] (-977.721) (-979.384) (-976.053) * [-976.965] (-980.824) (-979.039) (-977.910) -- 0:00:53 144500 -- [-977.754] (-980.826) (-980.340) (-980.999) * (-978.302) (-979.550) (-979.988) [-979.540] -- 0:00:53 145000 -- (-977.341) (-977.823) [-980.152] (-980.020) * (-978.885) (-977.945) (-981.193) [-977.945] -- 0:00:53 Average standard deviation of split frequencies: 0.024754 145500 -- (-976.878) (-979.430) [-981.374] (-976.916) * [-977.571] (-978.921) (-978.417) (-979.149) -- 0:00:52 146000 -- (-977.750) [-979.169] (-977.471) (-978.015) * (-977.196) [-978.641] (-979.405) (-978.310) -- 0:00:52 146500 -- (-976.982) (-978.838) (-977.130) [-976.914] * (-979.858) (-978.631) (-977.021) [-978.651] -- 0:00:52 147000 -- (-978.091) (-978.003) [-976.353] (-976.852) * (-981.755) [-979.579] (-977.373) (-980.957) -- 0:00:52 147500 -- [-981.295] (-977.821) (-977.200) (-976.138) * [-976.190] (-976.854) (-975.995) (-980.243) -- 0:00:52 148000 -- (-978.892) (-979.157) [-977.329] (-978.106) * [-976.542] (-979.389) (-975.982) (-981.773) -- 0:00:51 148500 -- (-977.891) (-980.826) (-979.674) [-977.691] * (-978.674) [-978.880] (-976.786) (-978.320) -- 0:00:51 149000 -- [-980.047] (-979.935) (-980.529) (-979.344) * (-978.368) (-977.600) (-979.402) [-979.744] -- 0:00:51 149500 -- (-979.797) [-976.964] (-980.791) (-978.782) * (-977.385) [-977.661] (-981.573) (-981.323) -- 0:00:51 150000 -- (-978.012) (-976.679) (-982.800) [-977.686] * [-976.104] (-978.676) (-983.606) (-983.067) -- 0:00:51 Average standard deviation of split frequencies: 0.024536 150500 -- [-980.513] (-976.259) (-983.075) (-978.595) * (-978.557) (-976.999) (-980.123) [-978.163] -- 0:00:50 151000 -- (-975.924) [-976.942] (-979.139) (-977.859) * (-978.449) [-976.750] (-977.149) (-979.278) -- 0:00:50 151500 -- (-976.180) [-979.659] (-979.180) (-978.141) * (-979.795) (-979.206) [-978.166] (-978.469) -- 0:00:50 152000 -- (-976.977) [-980.539] (-984.206) (-977.862) * (-985.528) [-976.614] (-978.326) (-976.553) -- 0:00:50 152500 -- (-977.655) [-978.235] (-978.381) (-978.891) * (-979.195) (-980.133) (-980.753) [-976.358] -- 0:00:50 153000 -- (-979.302) [-975.793] (-977.400) (-978.843) * (-979.161) [-976.414] (-978.411) (-976.846) -- 0:00:49 153500 -- (-978.252) (-977.419) [-977.442] (-977.244) * (-980.324) (-978.166) [-977.613] (-978.773) -- 0:00:49 154000 -- (-976.630) (-977.726) [-976.511] (-976.648) * (-977.958) (-976.006) [-976.370] (-982.841) -- 0:00:49 154500 -- (-976.130) [-977.232] (-977.240) (-980.575) * (-978.010) [-978.536] (-977.106) (-978.081) -- 0:00:49 155000 -- (-977.832) (-976.902) [-983.020] (-977.451) * (-980.769) [-976.710] (-980.011) (-977.553) -- 0:00:49 Average standard deviation of split frequencies: 0.022743 155500 -- (-976.277) (-981.813) (-978.707) [-978.215] * (-977.914) (-979.281) [-979.029] (-978.547) -- 0:00:48 156000 -- (-979.207) (-977.027) [-978.731] (-981.059) * (-977.021) (-976.391) (-979.768) [-979.426] -- 0:00:48 156500 -- [-980.951] (-978.549) (-978.494) (-977.797) * (-976.534) [-982.542] (-982.913) (-977.330) -- 0:00:53 157000 -- [-980.877] (-979.765) (-980.384) (-977.067) * (-976.037) (-976.605) [-976.662] (-979.275) -- 0:00:53 157500 -- (-978.693) (-977.102) (-980.347) [-976.068] * (-976.918) [-978.037] (-981.806) (-978.424) -- 0:00:53 158000 -- [-977.821] (-978.248) (-980.263) (-979.060) * (-976.887) [-978.625] (-977.644) (-981.219) -- 0:00:53 158500 -- (-980.123) (-978.358) (-979.175) [-977.798] * [-977.671] (-976.761) (-976.966) (-982.877) -- 0:00:53 159000 -- (-978.473) [-977.849] (-981.887) (-977.312) * (-978.008) (-976.955) [-978.520] (-982.397) -- 0:00:52 159500 -- (-979.382) (-983.507) [-976.624] (-978.661) * (-977.984) (-979.484) (-978.277) [-982.679] -- 0:00:52 160000 -- [-980.430] (-977.456) (-978.434) (-976.083) * (-976.688) (-982.232) [-977.286] (-981.619) -- 0:00:52 Average standard deviation of split frequencies: 0.022739 160500 -- [-977.871] (-980.205) (-979.311) (-976.145) * (-979.567) (-978.034) (-979.982) [-978.051] -- 0:00:52 161000 -- [-979.161] (-979.794) (-979.067) (-976.326) * (-979.571) (-977.258) (-977.523) [-978.323] -- 0:00:52 161500 -- (-977.580) [-976.496] (-976.838) (-976.249) * (-977.835) [-976.809] (-977.523) (-981.023) -- 0:00:51 162000 -- [-977.951] (-980.685) (-976.242) (-978.876) * [-978.121] (-978.371) (-978.376) (-981.863) -- 0:00:51 162500 -- (-980.693) (-981.476) [-977.501] (-979.694) * (-976.572) (-981.008) [-976.982] (-980.600) -- 0:00:51 163000 -- (-984.528) [-978.022] (-976.606) (-977.009) * [-978.083] (-978.925) (-977.721) (-979.867) -- 0:00:51 163500 -- [-977.375] (-977.336) (-977.346) (-980.265) * [-978.754] (-978.089) (-977.481) (-976.781) -- 0:00:51 164000 -- (-977.568) [-978.871] (-977.160) (-981.648) * (-978.013) (-977.035) [-976.508] (-980.451) -- 0:00:50 164500 -- (-988.233) (-978.349) (-977.947) [-981.001] * (-976.933) (-977.383) [-976.189] (-978.078) -- 0:00:50 165000 -- (-976.802) [-982.331] (-978.072) (-977.633) * (-979.878) (-980.586) [-976.507] (-976.552) -- 0:00:50 Average standard deviation of split frequencies: 0.022313 165500 -- (-982.230) [-980.183] (-977.805) (-977.977) * [-981.067] (-979.127) (-978.174) (-979.346) -- 0:00:50 166000 -- [-980.071] (-980.191) (-977.846) (-977.496) * (-983.137) (-977.302) [-977.710] (-979.145) -- 0:00:50 166500 -- (-979.167) (-981.176) [-979.398] (-976.819) * (-980.337) [-977.226] (-979.090) (-976.963) -- 0:00:50 167000 -- [-979.167] (-978.599) (-978.248) (-976.305) * (-980.977) (-979.369) (-978.564) [-978.928] -- 0:00:49 167500 -- (-981.623) (-978.306) [-976.383] (-977.456) * [-981.400] (-981.313) (-978.392) (-983.061) -- 0:00:49 168000 -- (-980.634) (-980.682) (-977.784) [-978.874] * (-976.723) [-977.430] (-977.720) (-982.229) -- 0:00:49 168500 -- (-982.303) (-978.205) [-976.264] (-976.828) * [-978.682] (-979.082) (-978.262) (-977.162) -- 0:00:49 169000 -- (-981.412) [-977.961] (-976.829) (-976.676) * (-980.863) (-979.711) (-980.787) [-977.702] -- 0:00:49 169500 -- (-977.419) [-976.960] (-976.967) (-977.244) * (-978.472) (-977.889) (-979.924) [-977.078] -- 0:00:48 170000 -- (-977.001) (-977.878) (-978.367) [-979.010] * [-978.930] (-976.681) (-981.889) (-977.108) -- 0:00:48 Average standard deviation of split frequencies: 0.022755 170500 -- (-980.466) [-976.112] (-979.271) (-976.704) * (-978.520) (-978.749) (-978.817) [-977.229] -- 0:00:48 171000 -- (-979.972) (-978.801) [-980.553] (-978.134) * (-977.705) (-978.803) (-978.897) [-979.146] -- 0:00:48 171500 -- (-978.149) (-977.387) [-977.682] (-978.446) * (-979.725) (-981.379) (-979.869) [-979.219] -- 0:00:48 172000 -- [-978.944] (-979.758) (-981.004) (-976.313) * (-979.847) (-976.936) (-978.444) [-976.047] -- 0:00:52 172500 -- (-976.627) [-978.638] (-979.093) (-976.867) * (-983.570) (-976.898) (-977.946) [-977.138] -- 0:00:52 173000 -- (-976.720) (-980.367) (-977.981) [-976.563] * (-978.967) (-985.910) [-976.805] (-976.516) -- 0:00:52 173500 -- (-977.043) (-978.062) (-976.612) [-980.150] * (-976.741) (-981.316) (-976.534) [-978.641] -- 0:00:52 174000 -- (-977.960) (-978.179) (-977.645) [-978.573] * (-978.984) (-981.787) [-977.476] (-977.960) -- 0:00:52 174500 -- [-976.824] (-977.873) (-977.023) (-977.710) * (-977.973) (-977.416) (-977.924) [-977.613] -- 0:00:52 175000 -- (-977.474) (-977.096) (-976.644) [-977.760] * (-979.971) (-978.335) (-978.075) [-978.394] -- 0:00:51 Average standard deviation of split frequencies: 0.024701 175500 -- (-978.909) [-978.606] (-977.479) (-977.546) * [-981.532] (-979.730) (-977.312) (-978.921) -- 0:00:51 176000 -- [-977.910] (-979.470) (-978.608) (-978.311) * (-983.222) (-980.909) (-977.542) [-976.476] -- 0:00:51 176500 -- [-977.834] (-976.989) (-977.527) (-976.744) * (-979.313) (-978.193) [-977.638] (-978.907) -- 0:00:51 177000 -- [-978.909] (-978.502) (-978.067) (-976.444) * (-976.561) (-977.819) [-976.741] (-977.010) -- 0:00:51 177500 -- (-977.575) (-979.311) (-977.145) [-977.472] * (-977.685) (-978.148) [-979.931] (-977.526) -- 0:00:50 178000 -- (-976.632) [-977.920] (-977.962) (-976.802) * (-986.488) (-977.053) (-978.198) [-977.939] -- 0:00:50 178500 -- (-976.875) (-977.411) (-977.546) [-975.966] * (-979.928) (-975.919) (-980.317) [-977.059] -- 0:00:50 179000 -- (-977.727) (-976.918) [-978.296] (-977.143) * [-977.393] (-976.733) (-979.643) (-977.890) -- 0:00:50 179500 -- (-978.643) (-977.639) (-977.863) [-977.352] * (-977.641) [-977.395] (-976.860) (-978.628) -- 0:00:50 180000 -- (-977.710) (-977.672) [-976.046] (-975.990) * (-979.143) (-977.563) [-976.749] (-979.541) -- 0:00:50 Average standard deviation of split frequencies: 0.024643 180500 -- (-979.616) (-982.760) [-978.731] (-980.856) * (-978.319) (-978.691) [-976.530] (-976.960) -- 0:00:49 181000 -- (-976.867) (-978.538) (-977.372) [-982.029] * (-981.781) [-977.953] (-977.714) (-976.646) -- 0:00:49 181500 -- [-978.726] (-978.779) (-979.604) (-978.373) * (-975.998) (-979.692) (-977.978) [-976.937] -- 0:00:49 182000 -- [-979.921] (-976.876) (-980.200) (-977.190) * (-976.396) [-977.816] (-976.045) (-980.463) -- 0:00:49 182500 -- (-981.708) (-978.811) (-981.477) [-977.952] * (-978.781) [-977.255] (-976.432) (-978.402) -- 0:00:49 183000 -- (-982.766) [-978.080] (-979.236) (-976.697) * (-978.794) (-976.961) (-977.462) [-976.888] -- 0:00:49 183500 -- (-980.407) (-976.925) (-980.113) [-977.835] * (-977.719) (-976.167) [-976.005] (-977.618) -- 0:00:48 184000 -- (-981.954) (-978.913) (-980.960) [-978.054] * (-977.153) [-978.110] (-977.182) (-979.767) -- 0:00:48 184500 -- [-979.615] (-977.894) (-978.703) (-980.433) * (-976.526) (-981.796) (-979.460) [-978.447] -- 0:00:48 185000 -- (-977.325) (-981.802) (-976.562) [-979.127] * (-976.148) (-981.302) (-980.789) [-977.917] -- 0:00:48 Average standard deviation of split frequencies: 0.025626 185500 -- (-979.349) (-980.334) [-976.731] (-980.347) * [-978.175] (-980.508) (-979.736) (-978.831) -- 0:00:48 186000 -- (-977.324) (-977.564) [-980.416] (-978.446) * (-980.472) (-977.388) (-978.875) [-977.863] -- 0:00:48 186500 -- (-978.660) (-978.678) (-977.970) [-979.335] * (-980.282) [-978.441] (-978.303) (-978.200) -- 0:00:47 187000 -- [-982.237] (-982.451) (-978.995) (-980.850) * (-979.324) (-977.239) (-977.890) [-977.392] -- 0:00:47 187500 -- (-979.162) (-979.522) (-979.141) [-978.017] * (-978.936) (-979.254) [-976.802] (-978.632) -- 0:00:47 188000 -- (-977.340) [-979.215] (-980.558) (-979.126) * (-978.484) (-979.648) [-976.596] (-977.426) -- 0:00:51 188500 -- (-977.098) (-977.758) [-978.058] (-980.115) * (-977.246) (-978.371) [-975.952] (-977.291) -- 0:00:51 189000 -- [-976.104] (-978.546) (-977.562) (-976.855) * (-977.181) (-977.113) [-976.254] (-978.965) -- 0:00:51 189500 -- (-979.279) [-978.383] (-977.606) (-976.806) * [-976.141] (-976.554) (-977.377) (-982.750) -- 0:00:51 190000 -- (-978.893) [-983.065] (-979.004) (-977.028) * [-976.178] (-977.571) (-976.946) (-978.493) -- 0:00:51 Average standard deviation of split frequencies: 0.024037 190500 -- [-976.737] (-981.763) (-979.031) (-978.938) * (-981.534) [-978.024] (-977.483) (-977.406) -- 0:00:50 191000 -- (-978.164) (-977.180) [-976.769] (-979.457) * (-977.315) (-979.174) [-979.373] (-977.700) -- 0:00:50 191500 -- (-978.711) (-976.696) [-977.953] (-977.543) * [-976.755] (-978.051) (-976.857) (-978.464) -- 0:00:50 192000 -- (-980.786) [-976.936] (-977.953) (-978.695) * (-978.489) (-980.051) (-977.694) [-981.935] -- 0:00:50 192500 -- (-977.411) (-977.178) (-977.933) [-977.209] * (-978.164) [-979.128] (-977.505) (-977.522) -- 0:00:50 193000 -- (-986.509) (-976.936) [-981.525] (-979.989) * (-979.484) (-978.296) (-977.150) [-977.305] -- 0:00:50 193500 -- (-985.541) [-977.452] (-977.648) (-976.844) * [-976.790] (-980.289) (-983.372) (-978.269) -- 0:00:50 194000 -- (-981.584) [-977.411] (-977.356) (-977.627) * [-980.290] (-981.142) (-981.334) (-976.941) -- 0:00:49 194500 -- (-976.762) (-978.294) (-978.114) [-978.316] * (-977.833) [-980.586] (-982.196) (-976.325) -- 0:00:49 195000 -- [-978.319] (-977.983) (-978.880) (-976.822) * (-978.415) (-981.080) [-978.341] (-977.342) -- 0:00:49 Average standard deviation of split frequencies: 0.020254 195500 -- (-976.743) (-977.410) [-978.653] (-976.922) * (-978.140) (-979.390) [-977.764] (-980.549) -- 0:00:49 196000 -- (-977.189) (-976.264) (-976.798) [-977.668] * (-980.876) [-977.341] (-980.136) (-978.846) -- 0:00:49 196500 -- [-977.055] (-976.140) (-979.150) (-981.627) * [-976.155] (-981.549) (-979.280) (-979.738) -- 0:00:49 197000 -- (-978.959) (-979.609) (-980.639) [-980.466] * [-977.624] (-980.364) (-976.071) (-980.555) -- 0:00:48 197500 -- [-979.218] (-978.645) (-978.918) (-979.964) * (-976.948) [-976.959] (-977.465) (-979.839) -- 0:00:48 198000 -- (-977.761) (-976.917) [-977.524] (-977.785) * (-977.474) [-976.246] (-978.367) (-978.000) -- 0:00:48 198500 -- [-977.488] (-979.722) (-977.658) (-977.425) * [-976.916] (-978.259) (-984.006) (-977.677) -- 0:00:48 199000 -- [-976.227] (-976.764) (-977.641) (-977.881) * (-976.373) [-978.289] (-981.848) (-979.160) -- 0:00:48 199500 -- (-975.857) (-982.155) [-977.561] (-977.420) * [-978.746] (-978.896) (-979.176) (-977.228) -- 0:00:48 200000 -- (-978.814) (-977.036) (-976.868) [-979.027] * [-977.012] (-977.481) (-977.804) (-976.283) -- 0:00:48 Average standard deviation of split frequencies: 0.022056 200500 -- [-981.057] (-978.309) (-976.410) (-981.748) * [-977.156] (-977.646) (-978.263) (-983.355) -- 0:00:47 201000 -- (-983.827) (-978.799) [-979.669] (-978.999) * (-977.972) [-977.171] (-978.079) (-978.676) -- 0:00:47 201500 -- (-985.175) (-977.888) [-980.887] (-979.702) * (-978.984) [-977.266] (-979.797) (-980.399) -- 0:00:47 202000 -- (-977.486) [-976.822] (-978.185) (-979.803) * [-978.080] (-978.376) (-977.719) (-985.155) -- 0:00:47 202500 -- [-976.663] (-977.907) (-977.806) (-976.650) * (-976.876) [-979.341] (-977.249) (-977.520) -- 0:00:47 203000 -- (-979.124) (-978.714) [-979.386] (-975.874) * [-976.829] (-978.623) (-977.388) (-977.467) -- 0:00:47 203500 -- (-982.131) (-976.957) (-978.942) [-977.257] * [-979.261] (-977.386) (-977.753) (-977.531) -- 0:00:46 204000 -- (-984.308) [-978.981] (-979.342) (-978.014) * (-979.599) (-978.303) [-980.933] (-976.675) -- 0:00:50 204500 -- (-977.117) (-981.351) (-980.816) [-980.591] * (-977.660) (-979.171) (-976.926) [-976.154] -- 0:00:50 205000 -- (-977.792) (-977.478) [-977.379] (-976.977) * (-976.922) (-978.901) [-976.048] (-976.155) -- 0:00:50 Average standard deviation of split frequencies: 0.022248 205500 -- [-976.756] (-977.330) (-977.636) (-978.597) * (-976.649) (-979.984) (-978.166) [-977.683] -- 0:00:50 206000 -- (-979.867) [-979.507] (-980.843) (-977.031) * (-976.909) (-979.837) [-977.388] (-981.655) -- 0:00:50 206500 -- (-979.688) (-978.037) (-977.262) [-980.936] * (-977.523) (-980.620) [-977.257] (-983.297) -- 0:00:49 207000 -- (-976.876) (-978.743) (-978.252) [-976.793] * (-978.269) (-978.048) [-977.141] (-980.560) -- 0:00:49 207500 -- [-976.981] (-980.149) (-978.563) (-980.330) * (-979.145) [-977.258] (-976.860) (-976.720) -- 0:00:49 208000 -- (-977.005) [-978.929] (-980.856) (-980.065) * (-976.980) (-979.780) (-981.003) [-979.899] -- 0:00:49 208500 -- [-978.012] (-980.109) (-979.781) (-980.328) * (-977.105) (-976.055) [-977.141] (-981.394) -- 0:00:49 209000 -- (-980.428) (-977.918) (-977.603) [-979.684] * (-979.674) [-976.545] (-977.907) (-978.045) -- 0:00:49 209500 -- (-987.933) (-979.880) [-977.621] (-977.680) * (-979.731) [-977.260] (-979.130) (-977.004) -- 0:00:49 210000 -- (-984.657) [-976.542] (-981.908) (-977.837) * [-977.393] (-978.051) (-981.135) (-978.084) -- 0:00:48 Average standard deviation of split frequencies: 0.019315 210500 -- (-983.396) [-978.137] (-979.614) (-978.257) * (-978.750) (-977.144) (-977.156) [-976.854] -- 0:00:48 211000 -- (-980.465) [-977.702] (-979.863) (-978.840) * (-978.748) [-976.461] (-977.421) (-977.299) -- 0:00:48 211500 -- [-977.636] (-976.518) (-980.957) (-978.631) * (-978.219) [-978.165] (-978.443) (-979.079) -- 0:00:48 212000 -- [-979.962] (-976.992) (-980.101) (-976.076) * (-978.537) (-981.166) (-978.750) [-976.437] -- 0:00:48 212500 -- (-979.477) (-977.331) (-981.156) [-975.930] * (-977.272) (-984.711) [-977.664] (-976.976) -- 0:00:48 213000 -- (-980.400) (-976.255) (-981.731) [-975.844] * (-979.311) (-977.862) [-978.142] (-980.690) -- 0:00:48 213500 -- (-979.751) [-976.796] (-975.964) (-980.885) * [-978.415] (-976.542) (-977.096) (-981.003) -- 0:00:47 214000 -- (-977.338) (-979.534) [-977.057] (-980.832) * (-979.835) (-976.478) [-979.677] (-983.824) -- 0:00:47 214500 -- (-977.858) [-978.201] (-978.465) (-977.456) * (-984.977) (-977.332) (-981.160) [-978.597] -- 0:00:47 215000 -- [-977.908] (-977.091) (-979.021) (-978.262) * (-980.015) (-977.265) (-979.630) [-976.099] -- 0:00:47 Average standard deviation of split frequencies: 0.019297 215500 -- (-984.559) [-977.619] (-982.979) (-976.591) * (-979.171) (-978.027) (-981.621) [-976.996] -- 0:00:47 216000 -- (-978.843) (-982.605) (-976.702) [-976.830] * (-980.695) (-978.244) (-980.927) [-977.929] -- 0:00:47 216500 -- [-983.720] (-980.535) (-981.403) (-978.395) * [-976.488] (-977.089) (-977.659) (-977.856) -- 0:00:47 217000 -- (-976.806) (-977.304) [-976.379] (-977.216) * [-977.055] (-980.666) (-977.338) (-981.917) -- 0:00:46 217500 -- (-977.407) (-977.910) (-978.494) [-976.932] * (-981.103) (-979.454) [-976.718] (-980.653) -- 0:00:46 218000 -- (-978.883) [-976.487] (-981.437) (-977.025) * [-977.892] (-977.679) (-977.520) (-978.646) -- 0:00:46 218500 -- [-978.744] (-977.969) (-979.133) (-976.263) * (-977.673) (-977.324) [-977.224] (-979.842) -- 0:00:46 219000 -- (-976.571) (-977.826) (-977.631) [-976.087] * [-977.168] (-976.807) (-976.901) (-980.102) -- 0:00:46 219500 -- (-976.168) (-977.166) (-976.810) [-976.290] * [-977.023] (-976.303) (-976.953) (-979.696) -- 0:00:46 220000 -- (-976.764) (-977.131) [-980.473] (-976.356) * (-979.035) (-979.437) (-977.467) [-979.107] -- 0:00:49 Average standard deviation of split frequencies: 0.019226 220500 -- (-976.866) (-977.598) [-977.647] (-978.167) * [-979.959] (-978.418) (-977.376) (-977.823) -- 0:00:49 221000 -- (-978.055) (-979.432) (-983.171) [-979.636] * [-976.495] (-976.780) (-979.744) (-978.358) -- 0:00:49 221500 -- (-976.666) (-983.490) (-980.027) [-980.649] * (-978.376) [-976.645] (-976.908) (-978.745) -- 0:00:49 222000 -- (-976.449) (-979.561) (-981.239) [-980.747] * (-976.695) (-977.241) [-977.536] (-976.870) -- 0:00:49 222500 -- [-977.446] (-980.724) (-982.772) (-976.504) * (-977.412) (-977.242) (-978.109) [-977.545] -- 0:00:48 223000 -- (-977.064) (-976.751) [-983.007] (-978.514) * (-980.883) (-979.321) [-981.736] (-978.414) -- 0:00:48 223500 -- (-976.687) (-977.667) (-980.783) [-976.066] * (-977.418) [-978.001] (-980.557) (-979.147) -- 0:00:48 224000 -- (-976.360) (-977.544) (-977.386) [-976.462] * [-976.848] (-977.246) (-981.590) (-977.874) -- 0:00:48 224500 -- (-976.729) (-977.544) (-977.254) [-976.462] * [-976.435] (-977.256) (-981.124) (-977.522) -- 0:00:48 225000 -- (-977.656) (-979.913) (-976.717) [-976.622] * (-979.759) (-979.096) (-981.074) [-977.531] -- 0:00:48 Average standard deviation of split frequencies: 0.018251 225500 -- (-977.504) (-977.406) [-976.653] (-978.394) * (-979.456) [-976.811] (-979.568) (-978.502) -- 0:00:48 226000 -- [-978.301] (-977.583) (-977.047) (-977.445) * (-977.997) (-976.906) (-978.222) [-977.794] -- 0:00:47 226500 -- (-977.192) [-977.519] (-978.334) (-978.756) * (-977.058) (-976.864) [-977.321] (-979.139) -- 0:00:47 227000 -- (-978.638) (-983.214) (-977.094) [-982.618] * (-976.901) (-976.716) [-978.302] (-976.800) -- 0:00:47 227500 -- [-977.013] (-977.906) (-977.609) (-977.905) * (-981.099) (-976.094) (-978.978) [-978.768] -- 0:00:47 228000 -- [-977.817] (-976.972) (-981.790) (-977.836) * (-978.284) [-976.470] (-977.494) (-980.238) -- 0:00:47 228500 -- [-977.005] (-976.926) (-976.794) (-977.756) * [-980.612] (-976.368) (-976.706) (-982.138) -- 0:00:47 229000 -- (-980.197) [-976.903] (-977.766) (-977.908) * [-977.932] (-978.081) (-976.108) (-980.918) -- 0:00:47 229500 -- [-978.178] (-981.788) (-977.946) (-981.320) * [-980.176] (-977.620) (-975.987) (-980.341) -- 0:00:47 230000 -- (-977.370) (-980.430) [-977.350] (-981.095) * (-975.886) [-978.653] (-976.712) (-982.157) -- 0:00:46 Average standard deviation of split frequencies: 0.018802 230500 -- (-979.084) (-976.751) [-977.814] (-978.497) * (-976.951) (-977.681) (-980.420) [-977.448] -- 0:00:46 231000 -- (-979.408) (-976.402) (-977.141) [-977.059] * (-983.575) (-976.989) (-977.160) [-977.369] -- 0:00:46 231500 -- (-977.676) (-977.037) [-977.538] (-977.617) * (-980.118) (-977.994) [-976.977] (-978.832) -- 0:00:46 232000 -- (-977.682) (-977.052) [-976.773] (-977.035) * [-977.885] (-978.534) (-976.159) (-978.199) -- 0:00:46 232500 -- (-980.498) [-977.261] (-984.616) (-976.951) * [-977.848] (-976.084) (-976.047) (-976.287) -- 0:00:46 233000 -- (-977.211) (-980.784) (-980.330) [-977.632] * (-979.118) (-976.393) (-976.935) [-981.866] -- 0:00:46 233500 -- [-976.862] (-977.128) (-976.724) (-982.676) * (-977.687) [-978.190] (-979.499) (-977.415) -- 0:00:45 234000 -- (-978.740) (-977.230) [-980.236] (-986.491) * (-979.563) (-982.432) (-979.038) [-977.145] -- 0:00:45 234500 -- [-976.246] (-981.029) (-977.616) (-978.294) * (-976.956) (-977.253) [-978.981] (-977.415) -- 0:00:45 235000 -- (-978.758) [-976.731] (-977.655) (-978.751) * [-976.139] (-976.433) (-976.887) (-978.262) -- 0:00:45 Average standard deviation of split frequencies: 0.018177 235500 -- (-981.937) [-977.439] (-977.557) (-977.367) * (-978.303) (-979.091) [-978.881] (-975.843) -- 0:00:45 236000 -- (-979.079) [-980.267] (-982.327) (-977.465) * (-977.680) [-976.509] (-980.323) (-977.781) -- 0:00:45 236500 -- (-980.736) (-978.166) (-984.635) [-977.381] * (-979.072) [-977.234] (-978.001) (-977.435) -- 0:00:48 237000 -- (-980.733) (-977.774) [-976.554] (-979.101) * (-979.369) (-976.020) [-977.075] (-978.049) -- 0:00:48 237500 -- [-977.745] (-978.408) (-976.700) (-978.334) * (-979.698) (-977.355) [-977.201] (-978.984) -- 0:00:48 238000 -- [-977.266] (-978.381) (-978.154) (-978.129) * (-976.894) (-977.046) [-980.141] (-979.034) -- 0:00:48 238500 -- (-977.612) (-981.187) [-978.420] (-976.706) * (-976.656) [-976.695] (-977.522) (-977.093) -- 0:00:47 239000 -- (-976.668) (-980.905) [-976.174] (-979.160) * (-981.803) (-978.398) (-980.310) [-978.364] -- 0:00:47 239500 -- (-976.346) [-976.946] (-976.897) (-977.711) * (-978.417) (-979.043) (-980.559) [-976.880] -- 0:00:47 240000 -- (-978.788) (-976.675) (-982.656) [-977.232] * (-979.580) (-977.223) (-977.583) [-977.132] -- 0:00:47 Average standard deviation of split frequencies: 0.019484 240500 -- (-981.125) [-976.994] (-980.565) (-977.316) * (-977.388) (-978.486) [-977.241] (-976.831) -- 0:00:47 241000 -- [-977.066] (-977.514) (-977.012) (-976.632) * (-981.553) (-977.708) [-978.514] (-981.336) -- 0:00:47 241500 -- (-979.167) (-979.403) [-979.149] (-976.940) * (-981.047) (-978.897) (-979.028) [-980.014] -- 0:00:47 242000 -- (-978.023) (-980.760) [-977.970] (-976.940) * (-981.121) (-977.167) [-977.310] (-979.396) -- 0:00:46 242500 -- (-977.222) (-979.319) (-979.499) [-978.360] * (-978.871) (-978.278) [-977.650] (-981.036) -- 0:00:46 243000 -- [-977.719] (-977.401) (-978.019) (-977.830) * (-985.574) (-977.139) (-977.248) [-978.861] -- 0:00:46 243500 -- [-979.257] (-976.762) (-979.764) (-980.646) * (-983.267) (-976.725) [-976.558] (-976.986) -- 0:00:46 244000 -- [-976.643] (-985.010) (-981.948) (-978.203) * (-980.830) [-977.493] (-977.704) (-976.136) -- 0:00:46 244500 -- (-976.563) [-985.653] (-980.494) (-978.234) * (-980.980) (-976.494) (-977.664) [-978.335] -- 0:00:46 245000 -- [-976.518] (-983.553) (-983.140) (-978.967) * [-986.776] (-977.025) (-977.510) (-976.317) -- 0:00:46 Average standard deviation of split frequencies: 0.019264 245500 -- (-976.587) (-977.932) [-978.035] (-979.732) * (-983.231) (-976.372) (-977.580) [-982.528] -- 0:00:46 246000 -- [-980.535] (-977.549) (-979.394) (-978.711) * (-978.046) [-976.346] (-977.611) (-979.022) -- 0:00:45 246500 -- (-975.925) (-978.023) [-977.596] (-977.751) * (-978.490) [-976.170] (-977.724) (-980.957) -- 0:00:45 247000 -- [-977.121] (-978.441) (-976.012) (-978.190) * [-976.433] (-976.547) (-977.213) (-980.004) -- 0:00:45 247500 -- [-976.748] (-979.594) (-976.904) (-976.741) * [-979.126] (-975.981) (-980.243) (-976.846) -- 0:00:45 248000 -- (-977.863) (-979.422) (-976.788) [-979.497] * (-977.393) [-979.317] (-978.345) (-976.738) -- 0:00:45 248500 -- (-977.296) (-978.337) (-978.389) [-978.600] * (-978.379) [-977.169] (-980.399) (-980.024) -- 0:00:45 249000 -- (-978.055) [-978.158] (-980.069) (-976.493) * (-978.284) (-980.165) [-980.880] (-978.243) -- 0:00:45 249500 -- [-978.171] (-978.157) (-981.590) (-979.257) * (-982.458) (-979.846) (-981.052) [-981.975] -- 0:00:45 250000 -- [-978.429] (-978.236) (-979.473) (-977.455) * (-977.739) (-980.696) (-977.078) [-980.902] -- 0:00:45 Average standard deviation of split frequencies: 0.019103 250500 -- [-982.380] (-978.377) (-978.642) (-977.400) * (-978.898) [-981.047] (-978.218) (-976.207) -- 0:00:44 251000 -- (-979.364) (-978.797) (-981.843) [-979.644] * (-980.154) (-986.231) (-977.279) [-976.795] -- 0:00:44 251500 -- [-976.583] (-977.578) (-979.447) (-978.537) * (-985.719) (-980.423) [-978.746] (-975.949) -- 0:00:44 252000 -- [-978.415] (-978.629) (-978.264) (-979.723) * (-982.174) [-980.763] (-977.368) (-975.919) -- 0:00:44 252500 -- (-977.512) [-981.505] (-977.481) (-976.860) * (-978.769) [-978.470] (-978.148) (-978.036) -- 0:00:47 253000 -- (-978.343) [-977.697] (-977.050) (-978.992) * (-979.254) [-977.264] (-977.874) (-980.912) -- 0:00:47 253500 -- (-981.255) (-976.545) [-978.500] (-979.867) * (-977.508) [-980.188] (-977.705) (-977.871) -- 0:00:47 254000 -- [-976.113] (-980.706) (-979.283) (-976.958) * [-976.635] (-976.943) (-981.120) (-979.292) -- 0:00:46 254500 -- (-976.613) [-978.161] (-978.289) (-977.506) * [-977.151] (-979.030) (-980.125) (-976.123) -- 0:00:46 255000 -- [-976.502] (-978.443) (-982.156) (-976.922) * (-976.290) (-976.785) (-979.657) [-977.593] -- 0:00:46 Average standard deviation of split frequencies: 0.019822 255500 -- (-978.949) [-979.561] (-979.205) (-977.207) * (-976.169) [-976.551] (-977.713) (-978.249) -- 0:00:46 256000 -- [-976.263] (-978.543) (-978.546) (-980.130) * [-977.907] (-977.337) (-980.375) (-978.178) -- 0:00:46 256500 -- (-977.742) (-978.641) [-977.722] (-979.112) * (-977.480) [-979.183] (-976.768) (-984.615) -- 0:00:46 257000 -- [-979.088] (-977.695) (-977.428) (-977.521) * (-976.501) (-980.945) (-977.982) [-979.498] -- 0:00:46 257500 -- [-977.709] (-976.906) (-976.652) (-978.202) * (-977.183) (-982.458) (-980.417) [-978.283] -- 0:00:46 258000 -- (-977.925) (-978.052) [-976.617] (-979.647) * [-978.461] (-982.464) (-976.969) (-978.229) -- 0:00:46 258500 -- [-976.796] (-977.852) (-977.156) (-977.859) * [-977.892] (-980.359) (-978.757) (-978.692) -- 0:00:45 259000 -- (-978.340) (-978.411) (-977.639) [-976.725] * (-978.576) (-983.315) (-980.025) [-976.912] -- 0:00:45 259500 -- [-977.184] (-978.258) (-976.266) (-979.472) * [-976.683] (-977.615) (-981.595) (-980.464) -- 0:00:45 260000 -- [-976.794] (-977.781) (-977.067) (-978.169) * [-976.792] (-978.501) (-987.209) (-977.924) -- 0:00:45 Average standard deviation of split frequencies: 0.021099 260500 -- (-979.446) (-977.194) [-979.003] (-977.880) * (-977.708) [-977.600] (-988.735) (-976.679) -- 0:00:45 261000 -- (-978.540) (-978.554) (-978.992) [-977.795] * (-981.076) [-976.854] (-984.720) (-977.913) -- 0:00:45 261500 -- [-978.665] (-977.690) (-976.797) (-982.178) * (-975.891) (-987.389) (-979.685) [-977.543] -- 0:00:45 262000 -- (-979.129) (-977.428) (-978.108) [-979.006] * (-978.591) (-982.259) (-979.673) [-977.637] -- 0:00:45 262500 -- (-979.088) (-977.435) [-977.523] (-984.460) * (-977.912) (-982.691) [-978.357] (-978.148) -- 0:00:44 263000 -- (-979.940) (-975.841) (-977.110) [-979.119] * (-984.802) (-979.004) (-978.010) [-979.120] -- 0:00:44 263500 -- (-978.747) (-979.180) (-976.765) [-978.029] * (-977.853) [-978.763] (-977.857) (-977.914) -- 0:00:44 264000 -- (-981.922) [-977.353] (-979.818) (-978.340) * (-975.994) [-978.474] (-977.054) (-979.277) -- 0:00:44 264500 -- (-979.985) [-980.337] (-978.890) (-978.765) * [-979.085] (-976.074) (-981.660) (-976.736) -- 0:00:44 265000 -- (-980.927) (-977.469) [-976.054] (-976.496) * (-979.412) (-978.972) [-977.087] (-978.247) -- 0:00:44 Average standard deviation of split frequencies: 0.021168 265500 -- (-982.919) (-976.479) [-979.514] (-977.250) * (-979.737) [-978.406] (-976.702) (-979.575) -- 0:00:44 266000 -- (-980.304) (-977.456) [-978.513] (-977.115) * (-978.808) [-977.936] (-978.111) (-980.148) -- 0:00:44 266500 -- [-978.259] (-977.913) (-978.521) (-980.040) * [-976.783] (-978.732) (-978.078) (-980.134) -- 0:00:44 267000 -- [-979.067] (-977.920) (-978.107) (-979.242) * (-976.526) (-977.254) (-978.736) [-979.367] -- 0:00:43 267500 -- (-979.298) [-980.395] (-988.303) (-979.738) * (-980.639) (-981.071) (-979.717) [-979.033] -- 0:00:43 268000 -- (-979.585) (-979.898) (-981.606) [-978.129] * [-983.181] (-977.555) (-979.835) (-978.892) -- 0:00:43 268500 -- (-981.112) [-976.835] (-980.140) (-977.344) * (-981.688) (-976.576) (-980.726) [-978.280] -- 0:00:43 269000 -- (-977.922) [-978.809] (-977.812) (-978.870) * (-980.749) (-977.635) (-978.410) [-979.295] -- 0:00:46 269500 -- (-977.008) (-976.363) (-977.146) [-976.915] * (-976.413) (-983.548) (-978.391) [-977.039] -- 0:00:46 270000 -- [-976.991] (-979.034) (-977.183) (-976.360) * (-976.836) (-979.320) [-978.031] (-977.413) -- 0:00:45 Average standard deviation of split frequencies: 0.021383 270500 -- (-977.184) (-976.475) (-976.948) [-977.702] * [-978.245] (-978.712) (-980.388) (-976.825) -- 0:00:45 271000 -- (-977.095) (-978.737) (-976.751) [-981.347] * (-981.263) (-978.442) (-977.958) [-976.308] -- 0:00:45 271500 -- [-979.488] (-979.645) (-977.183) (-979.670) * [-977.834] (-978.795) (-977.865) (-977.790) -- 0:00:45 272000 -- (-978.048) (-979.230) [-978.066] (-977.782) * (-977.789) (-976.897) (-977.578) [-978.122] -- 0:00:45 272500 -- (-978.393) [-975.954] (-979.699) (-979.625) * (-978.131) (-975.857) (-978.009) [-977.010] -- 0:00:45 273000 -- (-979.626) (-975.954) (-977.687) [-977.208] * (-976.327) [-976.401] (-977.321) (-977.201) -- 0:00:45 273500 -- [-978.096] (-976.769) (-981.399) (-979.967) * [-977.480] (-976.125) (-976.626) (-977.042) -- 0:00:45 274000 -- [-976.860] (-982.092) (-979.433) (-978.626) * (-977.474) [-977.033] (-976.123) (-977.152) -- 0:00:45 274500 -- [-976.122] (-976.956) (-978.059) (-977.941) * (-976.183) (-978.641) (-976.341) [-976.624] -- 0:00:44 275000 -- (-975.968) (-979.025) (-981.838) [-977.540] * (-977.335) (-979.226) (-978.067) [-976.620] -- 0:00:44 Average standard deviation of split frequencies: 0.020686 275500 -- [-975.905] (-981.754) (-977.453) (-977.945) * [-978.978] (-976.705) (-978.227) (-977.307) -- 0:00:44 276000 -- (-977.382) (-982.200) [-979.200] (-977.199) * [-977.705] (-976.344) (-979.899) (-978.614) -- 0:00:44 276500 -- [-977.559] (-978.034) (-979.739) (-980.304) * [-978.717] (-980.091) (-979.803) (-979.339) -- 0:00:44 277000 -- [-980.726] (-980.130) (-978.589) (-978.780) * (-977.931) (-982.232) [-980.093] (-978.595) -- 0:00:44 277500 -- (-980.726) [-978.001] (-977.945) (-978.980) * (-977.708) (-979.927) (-979.489) [-977.731] -- 0:00:44 278000 -- (-982.938) [-978.860] (-978.055) (-981.066) * (-979.602) [-980.131] (-976.778) (-982.856) -- 0:00:44 278500 -- (-977.421) (-976.916) (-977.116) [-976.433] * (-982.887) (-979.274) (-977.372) [-979.583] -- 0:00:44 279000 -- (-977.783) [-977.091] (-978.087) (-976.597) * (-979.874) (-979.752) [-977.558] (-979.702) -- 0:00:43 279500 -- [-977.608] (-978.824) (-979.451) (-977.961) * (-978.257) [-978.472] (-976.336) (-979.299) -- 0:00:43 280000 -- (-976.216) [-978.185] (-979.135) (-981.800) * (-979.449) (-979.733) (-976.334) [-976.609] -- 0:00:43 Average standard deviation of split frequencies: 0.019875 280500 -- [-976.925] (-977.817) (-980.880) (-981.188) * (-978.093) (-978.777) [-977.427] (-978.525) -- 0:00:43 281000 -- (-979.894) [-978.911] (-979.309) (-979.463) * (-976.575) (-980.951) [-978.810] (-978.012) -- 0:00:43 281500 -- (-980.127) (-977.492) (-976.952) [-976.366] * (-976.834) [-979.231] (-982.774) (-976.701) -- 0:00:43 282000 -- (-980.790) (-979.874) [-977.333] (-979.427) * (-984.507) (-979.477) [-977.678] (-977.959) -- 0:00:43 282500 -- [-976.565] (-979.372) (-980.424) (-977.021) * (-978.434) (-978.634) [-975.811] (-977.970) -- 0:00:43 283000 -- [-979.451] (-978.336) (-978.358) (-978.787) * (-976.779) [-976.385] (-977.334) (-980.012) -- 0:00:43 283500 -- (-978.317) (-979.573) (-977.369) [-979.601] * (-976.809) [-977.149] (-979.117) (-978.173) -- 0:00:42 284000 -- [-977.858] (-979.854) (-977.927) (-978.113) * (-977.172) [-978.126] (-978.128) (-976.508) -- 0:00:42 284500 -- (-977.299) (-978.929) (-983.301) [-977.557] * (-980.380) [-980.134] (-979.361) (-980.585) -- 0:00:42 285000 -- (-979.427) (-980.365) (-979.123) [-978.180] * (-977.641) (-979.588) (-977.374) [-976.603] -- 0:00:45 Average standard deviation of split frequencies: 0.018131 285500 -- (-980.197) (-978.313) (-980.506) [-979.266] * (-977.140) [-978.746] (-977.319) (-980.086) -- 0:00:45 286000 -- (-978.015) (-978.123) (-982.099) [-979.474] * (-985.007) (-980.668) [-976.831] (-978.745) -- 0:00:44 286500 -- [-976.722] (-979.269) (-978.088) (-977.881) * (-976.644) [-982.660] (-977.555) (-977.945) -- 0:00:44 287000 -- (-978.073) (-981.785) [-980.228] (-978.507) * (-977.447) [-978.117] (-979.354) (-976.236) -- 0:00:44 287500 -- (-978.670) [-976.691] (-977.639) (-978.078) * (-980.216) (-978.579) (-978.134) [-976.155] -- 0:00:44 288000 -- (-978.461) [-976.023] (-979.511) (-976.535) * (-981.594) (-978.009) (-977.455) [-977.873] -- 0:00:44 288500 -- (-978.388) (-977.869) (-977.303) [-977.401] * (-981.951) (-976.147) (-981.834) [-976.607] -- 0:00:44 289000 -- [-978.724] (-976.643) (-977.289) (-977.496) * (-978.644) (-980.532) [-976.357] (-976.954) -- 0:00:44 289500 -- (-976.584) [-977.768] (-978.219) (-980.574) * (-977.507) (-976.709) [-977.689] (-978.401) -- 0:00:44 290000 -- [-977.988] (-977.012) (-979.090) (-978.641) * (-981.212) (-977.052) [-978.317] (-978.059) -- 0:00:44 Average standard deviation of split frequencies: 0.019462 290500 -- (-982.612) [-976.863] (-979.160) (-977.040) * [-979.260] (-978.166) (-976.890) (-977.350) -- 0:00:43 291000 -- (-979.191) [-976.550] (-977.546) (-977.244) * (-981.998) [-977.194] (-977.245) (-979.626) -- 0:00:43 291500 -- (-977.817) [-976.717] (-977.088) (-977.221) * [-978.007] (-979.054) (-977.588) (-980.656) -- 0:00:43 292000 -- (-979.702) [-977.256] (-977.455) (-979.916) * (-977.892) [-977.466] (-978.258) (-978.072) -- 0:00:43 292500 -- (-980.607) [-977.189] (-978.628) (-982.223) * (-980.305) [-976.926] (-975.977) (-975.845) -- 0:00:43 293000 -- (-978.198) (-977.230) [-978.511] (-978.057) * (-980.011) [-977.675] (-976.376) (-978.168) -- 0:00:43 293500 -- (-978.768) [-977.422] (-980.521) (-977.297) * (-977.548) [-976.832] (-976.139) (-980.055) -- 0:00:43 294000 -- (-979.398) (-978.761) [-976.172] (-981.194) * (-977.475) [-977.340] (-978.020) (-977.229) -- 0:00:43 294500 -- (-986.934) (-977.570) [-976.788] (-979.758) * (-980.873) (-977.918) (-981.714) [-976.317] -- 0:00:43 295000 -- (-980.491) [-977.443] (-980.315) (-977.580) * (-978.325) (-977.032) (-979.238) [-976.351] -- 0:00:43 Average standard deviation of split frequencies: 0.018514 295500 -- (-979.219) [-979.020] (-976.834) (-978.672) * (-978.451) (-976.011) (-980.934) [-976.518] -- 0:00:42 296000 -- (-978.633) (-977.654) (-977.407) [-976.147] * (-977.377) (-976.481) (-981.592) [-978.549] -- 0:00:42 296500 -- [-979.885] (-978.244) (-978.204) (-976.266) * (-977.054) (-977.741) [-981.202] (-979.009) -- 0:00:42 297000 -- [-976.980] (-977.419) (-978.004) (-977.976) * (-980.466) [-977.866] (-978.996) (-978.794) -- 0:00:42 297500 -- (-978.129) (-980.301) [-978.376] (-978.845) * [-979.129] (-976.857) (-979.667) (-978.043) -- 0:00:42 298000 -- (-977.833) [-980.004] (-977.047) (-979.469) * (-981.380) [-977.036] (-978.727) (-976.623) -- 0:00:42 298500 -- (-979.601) [-979.226] (-977.384) (-979.153) * (-979.902) (-977.178) (-980.532) [-976.450] -- 0:00:42 299000 -- [-977.155] (-977.798) (-979.474) (-977.706) * (-979.833) (-977.545) [-977.428] (-976.865) -- 0:00:42 299500 -- (-978.236) [-977.152] (-977.645) (-978.735) * (-979.031) [-980.877] (-977.544) (-979.226) -- 0:00:42 300000 -- (-978.079) (-976.814) [-976.995] (-980.830) * (-977.956) (-977.825) [-976.401] (-979.397) -- 0:00:42 Average standard deviation of split frequencies: 0.017932 300500 -- (-976.576) (-976.353) [-977.760] (-978.285) * (-979.247) [-982.593] (-977.723) (-977.365) -- 0:00:41 301000 -- [-977.026] (-979.435) (-980.064) (-978.322) * [-978.122] (-979.674) (-976.842) (-983.200) -- 0:00:44 301500 -- (-978.833) (-977.197) (-985.058) [-979.243] * (-977.842) (-979.054) [-977.465] (-982.645) -- 0:00:44 302000 -- (-976.996) (-979.212) (-979.203) [-979.584] * (-980.275) (-977.255) (-978.764) [-979.979] -- 0:00:43 302500 -- (-977.615) (-978.482) (-978.942) [-977.714] * (-984.355) [-977.436] (-978.519) (-980.546) -- 0:00:43 303000 -- (-976.237) [-977.369] (-979.810) (-978.081) * (-980.124) (-976.979) (-977.505) [-976.095] -- 0:00:43 303500 -- [-977.643] (-980.726) (-977.579) (-976.672) * (-977.036) [-979.899] (-977.274) (-977.161) -- 0:00:43 304000 -- (-976.963) [-978.468] (-978.550) (-980.601) * (-977.418) (-978.290) [-978.548] (-977.193) -- 0:00:43 304500 -- [-980.726] (-977.381) (-979.123) (-977.456) * (-976.509) [-977.474] (-979.832) (-978.145) -- 0:00:43 305000 -- [-981.865] (-977.742) (-980.157) (-977.678) * (-980.992) [-976.396] (-979.776) (-977.171) -- 0:00:43 Average standard deviation of split frequencies: 0.017235 305500 -- [-979.881] (-977.154) (-980.784) (-977.250) * (-978.190) (-979.324) (-980.358) [-976.231] -- 0:00:43 306000 -- (-980.859) (-979.312) [-977.827] (-982.152) * [-978.247] (-978.268) (-979.411) (-976.887) -- 0:00:43 306500 -- [-977.931] (-977.827) (-980.383) (-979.304) * [-977.699] (-979.374) (-977.871) (-976.732) -- 0:00:42 307000 -- (-978.471) [-977.361] (-979.229) (-977.992) * [-981.136] (-979.499) (-977.108) (-982.946) -- 0:00:42 307500 -- [-977.814] (-979.053) (-978.840) (-978.135) * (-978.222) [-977.948] (-980.220) (-976.434) -- 0:00:42 308000 -- [-980.229] (-976.241) (-977.591) (-978.128) * (-977.438) (-980.108) [-978.831] (-977.258) -- 0:00:42 308500 -- (-979.661) (-977.012) [-978.780] (-975.886) * (-977.691) [-977.366] (-979.911) (-976.310) -- 0:00:42 309000 -- (-981.422) (-979.943) (-978.861) [-977.203] * (-977.250) (-978.248) [-978.876] (-976.606) -- 0:00:42 309500 -- [-977.584] (-978.636) (-987.496) (-976.454) * (-979.150) [-976.275] (-980.364) (-980.096) -- 0:00:42 310000 -- (-976.840) (-976.855) (-986.828) [-977.984] * (-978.050) (-976.506) (-978.458) [-977.187] -- 0:00:42 Average standard deviation of split frequencies: 0.017227 310500 -- [-980.452] (-979.434) (-981.202) (-976.615) * (-977.058) [-976.102] (-977.398) (-977.486) -- 0:00:42 311000 -- (-980.236) (-976.887) (-981.666) [-978.483] * (-976.302) [-977.790] (-977.733) (-978.309) -- 0:00:42 311500 -- (-977.163) (-976.246) (-979.092) [-981.137] * (-978.989) (-979.204) (-976.985) [-978.062] -- 0:00:41 312000 -- (-980.831) [-979.818] (-977.100) (-978.347) * (-978.675) [-976.541] (-978.096) (-981.931) -- 0:00:41 312500 -- (-979.282) [-977.095] (-977.100) (-979.164) * (-981.715) (-976.250) (-977.656) [-976.509] -- 0:00:41 313000 -- (-979.458) (-976.922) (-977.801) [-978.164] * (-980.451) (-977.339) [-977.362] (-978.384) -- 0:00:41 313500 -- [-977.711] (-981.123) (-977.885) (-983.484) * (-976.328) [-978.095] (-976.957) (-976.611) -- 0:00:41 314000 -- (-976.645) (-981.688) [-976.968] (-977.905) * (-977.845) [-979.394] (-982.146) (-977.113) -- 0:00:41 314500 -- (-979.021) (-977.283) (-976.667) [-977.219] * (-978.699) (-979.331) [-978.510] (-979.613) -- 0:00:41 315000 -- [-979.077] (-975.997) (-979.132) (-976.240) * (-979.734) (-979.322) (-978.449) [-980.065] -- 0:00:41 Average standard deviation of split frequencies: 0.016327 315500 -- (-977.407) (-976.193) [-976.284] (-976.666) * (-979.124) (-977.690) (-980.574) [-980.439] -- 0:00:41 316000 -- [-976.607] (-981.252) (-976.992) (-977.029) * [-977.980] (-980.722) (-976.793) (-982.707) -- 0:00:41 316500 -- [-976.467] (-978.429) (-976.498) (-978.227) * (-979.421) (-978.957) (-977.079) [-977.365] -- 0:00:41 317000 -- [-977.428] (-981.663) (-977.035) (-977.659) * (-978.727) [-976.879] (-976.292) (-979.071) -- 0:00:43 317500 -- [-976.911] (-980.889) (-980.730) (-977.519) * (-978.927) (-977.894) (-978.028) [-979.203] -- 0:00:42 318000 -- (-977.407) (-981.014) (-980.224) [-978.902] * (-981.444) (-976.748) [-978.521] (-979.076) -- 0:00:42 318500 -- [-976.934] (-976.733) (-979.624) (-978.312) * (-980.147) [-976.608] (-978.770) (-981.784) -- 0:00:42 319000 -- (-977.769) [-976.393] (-978.338) (-981.137) * (-982.064) (-979.177) [-979.769] (-980.693) -- 0:00:42 319500 -- [-976.484] (-976.381) (-979.451) (-981.755) * (-979.403) (-976.836) [-980.367] (-978.395) -- 0:00:42 320000 -- [-977.003] (-977.785) (-977.623) (-984.673) * [-979.050] (-977.442) (-978.830) (-980.017) -- 0:00:42 Average standard deviation of split frequencies: 0.015436 320500 -- (-977.168) [-978.375] (-977.874) (-981.575) * (-980.920) [-976.970] (-977.147) (-980.568) -- 0:00:42 321000 -- (-977.378) (-978.656) [-977.873] (-977.916) * (-976.563) (-979.042) [-978.982] (-980.025) -- 0:00:42 321500 -- (-977.631) (-977.463) (-977.553) [-976.806] * (-977.024) [-976.562] (-978.592) (-977.601) -- 0:00:42 322000 -- (-979.028) [-977.065] (-976.674) (-976.808) * (-976.680) (-976.741) (-980.583) [-980.014] -- 0:00:42 322500 -- [-980.898] (-977.046) (-976.563) (-976.185) * [-976.495] (-979.563) (-977.540) (-980.720) -- 0:00:42 323000 -- (-982.685) [-976.495] (-977.408) (-976.774) * (-977.576) (-983.457) [-976.034] (-977.669) -- 0:00:41 323500 -- (-976.571) (-976.479) (-977.306) [-977.845] * (-976.292) [-977.529] (-976.368) (-983.194) -- 0:00:41 324000 -- [-976.715] (-978.675) (-976.625) (-976.800) * (-979.570) (-976.352) (-977.265) [-978.625] -- 0:00:41 324500 -- (-976.742) (-978.260) [-976.401] (-978.799) * (-978.184) (-976.039) (-976.455) [-976.707] -- 0:00:41 325000 -- (-976.578) [-978.644] (-976.051) (-980.831) * (-979.029) [-978.628] (-978.155) (-976.513) -- 0:00:41 Average standard deviation of split frequencies: 0.014942 325500 -- (-981.731) [-977.233] (-976.103) (-977.073) * (-979.274) [-978.513] (-977.006) (-977.475) -- 0:00:41 326000 -- (-978.839) (-978.166) [-976.277] (-976.548) * (-976.363) (-977.637) (-977.384) [-977.001] -- 0:00:41 326500 -- (-979.925) [-976.406] (-976.324) (-977.852) * (-976.456) [-977.453] (-977.884) (-976.676) -- 0:00:41 327000 -- (-979.166) (-976.346) [-980.809] (-979.408) * (-978.254) [-980.341] (-978.889) (-981.096) -- 0:00:41 327500 -- (-979.322) [-976.570] (-978.513) (-978.282) * (-978.107) [-977.288] (-977.635) (-980.959) -- 0:00:41 328000 -- (-977.053) (-979.906) [-980.069] (-976.883) * (-980.860) (-980.219) [-978.946] (-977.164) -- 0:00:40 328500 -- (-976.362) (-977.212) [-978.312] (-976.511) * (-981.038) (-980.162) [-979.780] (-977.651) -- 0:00:40 329000 -- [-978.202] (-977.058) (-979.432) (-975.934) * (-981.040) [-976.827] (-976.501) (-979.366) -- 0:00:40 329500 -- [-976.694] (-979.600) (-978.904) (-981.391) * [-977.119] (-976.251) (-980.454) (-980.301) -- 0:00:40 330000 -- (-976.683) (-980.924) [-980.272] (-981.032) * (-977.254) (-979.979) (-977.763) [-979.258] -- 0:00:40 Average standard deviation of split frequencies: 0.013939 330500 -- (-977.463) (-978.447) [-978.313] (-980.039) * (-977.092) [-978.282] (-976.969) (-981.371) -- 0:00:40 331000 -- (-976.684) (-981.267) [-977.972] (-979.005) * [-980.001] (-978.790) (-978.071) (-977.549) -- 0:00:40 331500 -- (-977.589) (-979.407) (-977.281) [-977.053] * (-977.689) (-978.235) [-976.688] (-979.316) -- 0:00:40 332000 -- (-976.749) (-977.981) (-978.160) [-976.628] * (-977.603) (-978.279) [-976.773] (-979.689) -- 0:00:40 332500 -- (-977.851) (-979.084) (-981.428) [-977.115] * (-979.460) [-977.567] (-977.170) (-984.034) -- 0:00:40 333000 -- (-977.995) (-980.916) (-980.033) [-978.050] * (-979.705) [-976.826] (-978.189) (-978.201) -- 0:00:42 333500 -- (-980.800) (-978.347) [-978.988] (-981.719) * (-980.971) (-978.912) (-979.902) [-978.093] -- 0:00:41 334000 -- (-978.792) [-977.076] (-978.793) (-981.659) * (-977.664) (-979.330) (-977.174) [-979.450] -- 0:00:41 334500 -- (-987.292) (-979.563) [-978.992] (-977.863) * (-977.032) (-981.212) (-977.760) [-978.520] -- 0:00:41 335000 -- (-981.574) (-978.431) [-979.147] (-978.363) * [-977.179] (-982.752) (-979.463) (-978.834) -- 0:00:41 Average standard deviation of split frequencies: 0.014773 335500 -- (-976.658) [-978.286] (-982.178) (-977.415) * [-976.957] (-979.098) (-980.760) (-980.689) -- 0:00:41 336000 -- [-978.448] (-977.477) (-980.177) (-977.209) * (-978.805) (-978.958) (-978.234) [-980.908] -- 0:00:41 336500 -- (-978.972) [-980.344] (-979.512) (-979.546) * (-980.290) (-981.684) (-977.006) [-979.054] -- 0:00:41 337000 -- (-977.554) (-980.742) (-980.834) [-977.120] * (-979.868) [-979.877] (-979.057) (-976.968) -- 0:00:41 337500 -- [-976.097] (-980.289) (-977.086) (-976.897) * [-978.259] (-976.765) (-980.386) (-983.027) -- 0:00:41 338000 -- (-976.949) [-977.357] (-978.483) (-976.221) * (-977.505) [-979.162] (-978.940) (-978.082) -- 0:00:41 338500 -- (-977.172) (-977.613) [-979.291] (-982.010) * (-977.937) (-978.781) [-977.938] (-985.863) -- 0:00:41 339000 -- [-978.179] (-979.998) (-979.632) (-976.755) * (-977.242) (-980.667) (-979.031) [-979.021] -- 0:00:40 339500 -- [-976.868] (-979.440) (-977.629) (-977.554) * (-977.044) [-980.197] (-977.656) (-979.721) -- 0:00:40 340000 -- (-980.844) (-982.605) (-977.869) [-979.386] * (-976.606) (-980.575) [-979.670] (-978.793) -- 0:00:40 Average standard deviation of split frequencies: 0.016086 340500 -- (-977.551) (-979.677) [-980.961] (-977.633) * (-977.973) [-976.550] (-978.864) (-978.302) -- 0:00:40 341000 -- (-976.972) (-977.283) [-977.012] (-977.125) * (-977.082) [-977.766] (-976.411) (-979.724) -- 0:00:40 341500 -- (-980.981) (-978.314) [-976.960] (-979.813) * [-977.603] (-976.949) (-976.861) (-976.463) -- 0:00:40 342000 -- [-978.525] (-980.585) (-978.197) (-981.314) * [-977.956] (-977.806) (-979.538) (-976.999) -- 0:00:40 342500 -- (-978.175) (-978.367) [-978.644] (-980.223) * (-979.346) [-979.088] (-978.034) (-977.170) -- 0:00:40 343000 -- (-979.902) (-978.978) [-980.860] (-978.985) * (-981.136) [-977.092] (-977.298) (-983.016) -- 0:00:40 343500 -- (-978.037) (-977.511) (-979.899) [-978.422] * (-981.372) (-980.040) (-977.460) [-979.313] -- 0:00:40 344000 -- [-979.250] (-977.741) (-982.419) (-979.166) * (-980.430) (-980.187) (-976.884) [-976.967] -- 0:00:40 344500 -- [-979.638] (-977.682) (-976.205) (-977.349) * (-978.082) (-980.377) [-976.613] (-982.844) -- 0:00:39 345000 -- (-982.675) (-978.214) [-977.386] (-977.507) * (-978.900) (-979.814) [-978.184] (-979.076) -- 0:00:39 Average standard deviation of split frequencies: 0.014628 345500 -- (-977.613) (-978.778) [-977.191] (-978.037) * (-979.193) (-978.033) (-977.351) [-977.158] -- 0:00:39 346000 -- (-978.692) [-977.644] (-975.890) (-976.270) * (-977.044) (-978.358) (-977.897) [-978.903] -- 0:00:39 346500 -- (-977.823) [-977.029] (-977.819) (-976.231) * (-976.807) [-979.572] (-977.899) (-980.968) -- 0:00:39 347000 -- (-981.145) (-976.913) [-979.707] (-976.770) * [-977.913] (-977.038) (-977.251) (-978.496) -- 0:00:39 347500 -- [-978.853] (-976.098) (-980.116) (-978.675) * (-979.396) [-981.070] (-978.115) (-977.450) -- 0:00:39 348000 -- (-978.692) (-977.786) (-976.978) [-980.562] * (-978.235) (-978.833) (-979.820) [-977.899] -- 0:00:39 348500 -- (-979.359) [-977.785] (-981.029) (-979.880) * (-979.062) [-979.147] (-979.348) (-977.473) -- 0:00:39 349000 -- (-980.682) (-981.535) [-976.544] (-977.110) * [-982.833] (-978.348) (-978.471) (-982.001) -- 0:00:39 349500 -- (-981.503) (-976.750) (-977.245) [-979.717] * (-977.289) [-977.787] (-978.137) (-976.722) -- 0:00:40 350000 -- (-980.678) (-976.817) [-976.515] (-976.316) * (-977.637) [-976.303] (-976.945) (-978.346) -- 0:00:40 Average standard deviation of split frequencies: 0.015636 350500 -- (-984.243) (-976.662) [-978.694] (-977.103) * [-978.092] (-981.476) (-976.968) (-979.642) -- 0:00:40 351000 -- (-979.690) (-977.305) (-980.919) [-977.702] * [-978.492] (-979.670) (-976.693) (-978.996) -- 0:00:40 351500 -- (-978.665) [-978.773] (-977.541) (-977.976) * (-979.802) (-979.214) [-976.048] (-977.340) -- 0:00:40 352000 -- (-978.498) (-980.874) (-977.560) [-977.246] * (-977.941) (-983.561) [-979.376] (-978.126) -- 0:00:40 352500 -- (-977.397) (-980.564) (-976.382) [-977.090] * (-979.769) (-982.885) [-978.418] (-976.766) -- 0:00:40 353000 -- (-977.418) (-982.672) (-977.142) [-979.072] * (-976.736) [-978.211] (-977.043) (-983.322) -- 0:00:40 353500 -- (-976.410) (-976.726) [-976.122] (-981.525) * (-976.931) (-978.444) [-979.213] (-977.251) -- 0:00:40 354000 -- (-976.761) (-980.494) [-977.128] (-977.810) * (-976.507) (-978.419) (-981.097) [-978.369] -- 0:00:40 354500 -- (-977.409) (-979.047) [-981.272] (-977.670) * (-976.894) (-979.313) (-978.502) [-980.432] -- 0:00:40 355000 -- [-977.712] (-980.401) (-981.487) (-980.681) * (-981.060) (-979.896) (-980.062) [-978.064] -- 0:00:39 Average standard deviation of split frequencies: 0.016202 355500 -- (-982.184) [-980.261] (-979.009) (-978.872) * [-976.919] (-985.450) (-976.153) (-976.983) -- 0:00:39 356000 -- [-976.935] (-977.885) (-977.880) (-979.690) * (-982.038) (-980.117) [-977.738] (-977.250) -- 0:00:39 356500 -- [-979.144] (-978.033) (-977.640) (-984.212) * (-982.058) (-983.478) [-980.718] (-979.180) -- 0:00:39 357000 -- [-978.778] (-976.846) (-977.811) (-978.990) * (-979.153) [-981.446] (-977.096) (-978.079) -- 0:00:39 357500 -- (-979.049) (-976.801) (-980.184) [-979.531] * [-977.849] (-980.573) (-976.822) (-979.684) -- 0:00:39 358000 -- (-976.330) [-976.324] (-979.714) (-978.306) * (-977.616) (-984.337) [-976.570] (-978.832) -- 0:00:39 358500 -- (-976.876) (-978.139) [-977.948] (-978.718) * (-979.532) (-979.031) [-978.643] (-977.935) -- 0:00:39 359000 -- (-976.964) (-978.058) [-976.704] (-978.202) * (-978.087) [-978.816] (-977.494) (-978.273) -- 0:00:39 359500 -- (-977.446) [-977.823] (-979.073) (-978.203) * (-982.504) (-981.402) [-978.822] (-979.025) -- 0:00:39 360000 -- [-979.253] (-979.251) (-983.786) (-977.336) * (-976.473) (-978.186) [-976.453] (-977.239) -- 0:00:39 Average standard deviation of split frequencies: 0.014916 360500 -- [-982.606] (-978.302) (-979.312) (-981.301) * [-978.224] (-976.918) (-979.253) (-979.989) -- 0:00:39 361000 -- (-978.327) (-978.190) (-977.338) [-980.335] * (-977.484) [-977.193] (-976.824) (-976.321) -- 0:00:38 361500 -- (-977.496) (-978.073) (-978.586) [-976.995] * (-977.644) [-978.305] (-977.937) (-980.362) -- 0:00:38 362000 -- [-977.953] (-984.613) (-981.061) (-976.340) * [-979.085] (-976.940) (-976.910) (-982.465) -- 0:00:38 362500 -- (-977.530) (-979.440) [-977.947] (-976.380) * (-979.408) (-975.859) (-981.080) [-978.091] -- 0:00:38 363000 -- (-976.373) [-976.581] (-977.862) (-977.565) * [-979.682] (-980.348) (-978.366) (-978.141) -- 0:00:38 363500 -- (-976.974) [-976.714] (-980.642) (-987.180) * (-981.130) (-977.536) (-982.763) [-978.774] -- 0:00:38 364000 -- (-976.082) [-977.201] (-978.681) (-981.820) * (-981.013) (-977.172) (-976.942) [-978.850] -- 0:00:38 364500 -- (-977.696) [-978.481] (-976.343) (-977.321) * (-983.315) (-978.048) (-977.487) [-979.699] -- 0:00:38 365000 -- (-978.648) (-976.982) (-978.063) [-978.235] * (-979.345) (-977.917) [-978.699] (-977.474) -- 0:00:38 Average standard deviation of split frequencies: 0.014395 365500 -- (-977.432) (-979.835) [-980.107] (-976.657) * (-977.017) (-977.636) (-977.977) [-979.303] -- 0:00:39 366000 -- (-976.209) [-978.722] (-977.476) (-976.473) * (-976.430) (-977.373) (-976.482) [-980.100] -- 0:00:39 366500 -- (-978.048) (-978.666) [-977.975] (-981.119) * [-978.805] (-981.510) (-976.168) (-979.558) -- 0:00:39 367000 -- (-978.048) (-979.234) (-979.163) [-978.149] * [-979.084] (-978.395) (-976.168) (-979.933) -- 0:00:39 367500 -- [-977.941] (-979.958) (-979.632) (-980.740) * (-979.303) (-978.986) (-979.106) [-976.232] -- 0:00:39 368000 -- (-981.743) (-981.625) (-978.385) [-979.282] * (-977.741) (-977.042) (-977.601) [-983.900] -- 0:00:39 368500 -- (-981.896) [-981.093] (-977.797) (-979.312) * [-977.966] (-978.983) (-977.055) (-981.335) -- 0:00:39 369000 -- (-978.308) (-979.769) (-976.750) [-977.186] * (-976.292) (-983.150) [-979.442] (-979.275) -- 0:00:39 369500 -- [-977.976] (-980.699) (-977.344) (-979.794) * [-977.129] (-977.611) (-977.397) (-976.918) -- 0:00:39 370000 -- [-976.770] (-977.829) (-978.283) (-981.273) * (-979.487) (-979.377) (-980.148) [-976.993] -- 0:00:39 Average standard deviation of split frequencies: 0.013566 370500 -- [-977.009] (-976.862) (-978.336) (-978.136) * [-978.962] (-978.114) (-977.701) (-977.213) -- 0:00:39 371000 -- (-979.383) (-979.215) [-981.077] (-978.300) * (-977.387) (-977.524) [-981.168] (-976.945) -- 0:00:38 371500 -- (-976.631) (-979.088) (-980.965) [-979.158] * (-979.953) (-981.492) (-978.366) [-979.487] -- 0:00:38 372000 -- (-979.650) (-977.273) (-980.735) [-978.093] * (-979.749) (-983.966) (-979.977) [-977.773] -- 0:00:38 372500 -- [-977.162] (-976.393) (-979.347) (-976.841) * [-976.223] (-981.033) (-976.046) (-977.662) -- 0:00:38 373000 -- (-980.713) [-979.860] (-977.587) (-977.760) * (-976.708) (-980.074) (-978.038) [-976.678] -- 0:00:38 373500 -- (-978.466) (-983.429) (-982.779) [-977.643] * [-977.863] (-978.134) (-976.994) (-976.250) -- 0:00:38 374000 -- [-977.543] (-977.029) (-976.245) (-981.068) * (-976.490) [-977.246] (-977.416) (-976.289) -- 0:00:38 374500 -- [-978.634] (-978.172) (-977.737) (-980.638) * (-979.520) (-978.169) (-976.774) [-976.536] -- 0:00:38 375000 -- (-980.669) [-976.131] (-977.330) (-981.119) * (-977.420) (-976.281) [-976.559] (-977.409) -- 0:00:38 Average standard deviation of split frequencies: 0.014627 375500 -- [-981.505] (-976.426) (-980.161) (-980.797) * (-978.108) (-976.129) [-978.190] (-979.394) -- 0:00:38 376000 -- (-979.552) [-976.541] (-979.465) (-978.580) * [-977.568] (-977.412) (-982.605) (-978.534) -- 0:00:38 376500 -- (-978.419) (-976.620) [-977.802] (-977.341) * (-976.401) (-976.375) (-983.721) [-978.466] -- 0:00:38 377000 -- (-980.518) (-979.761) [-981.200] (-977.988) * (-978.591) [-977.628] (-978.183) (-978.677) -- 0:00:38 377500 -- (-979.277) (-979.531) (-979.812) [-976.628] * [-977.418] (-976.881) (-983.609) (-980.600) -- 0:00:37 378000 -- (-979.184) (-981.442) (-980.110) [-976.785] * (-977.926) (-982.686) [-977.211] (-979.144) -- 0:00:37 378500 -- [-979.294] (-982.724) (-982.856) (-976.387) * (-979.547) [-982.054] (-983.288) (-978.876) -- 0:00:37 379000 -- (-980.527) (-980.573) [-977.784] (-977.440) * (-978.020) (-980.047) (-979.078) [-978.976] -- 0:00:37 379500 -- [-980.856] (-979.343) (-976.989) (-979.646) * (-978.333) [-977.970] (-976.934) (-979.168) -- 0:00:37 380000 -- (-979.612) [-977.506] (-976.567) (-982.003) * (-978.627) (-977.213) [-978.916] (-977.237) -- 0:00:37 Average standard deviation of split frequencies: 0.014516 380500 -- (-978.554) (-979.182) [-976.324] (-979.808) * (-978.507) (-978.832) [-978.616] (-977.479) -- 0:00:37 381000 -- [-980.293] (-981.124) (-978.190) (-980.617) * (-980.173) [-977.739] (-981.946) (-980.202) -- 0:00:37 381500 -- [-977.251] (-976.914) (-976.668) (-978.919) * [-976.764] (-977.786) (-978.024) (-980.081) -- 0:00:38 382000 -- [-978.026] (-980.789) (-978.377) (-979.215) * (-979.540) [-978.634] (-980.354) (-977.711) -- 0:00:38 382500 -- [-977.411] (-977.470) (-977.321) (-977.560) * (-979.583) (-979.076) [-976.563] (-983.063) -- 0:00:38 383000 -- (-981.931) [-976.289] (-976.479) (-986.654) * (-978.224) (-979.747) [-976.589] (-982.139) -- 0:00:38 383500 -- (-985.226) (-976.901) (-977.032) [-979.186] * [-978.187] (-978.927) (-976.146) (-978.824) -- 0:00:38 384000 -- (-980.363) [-978.007] (-976.402) (-978.385) * [-979.372] (-978.141) (-980.323) (-978.061) -- 0:00:38 384500 -- (-978.720) (-977.270) [-976.856] (-978.279) * (-977.486) (-979.121) (-978.806) [-980.667] -- 0:00:38 385000 -- [-977.592] (-977.350) (-977.718) (-978.433) * (-977.173) (-979.453) (-979.242) [-977.221] -- 0:00:38 Average standard deviation of split frequencies: 0.014859 385500 -- [-978.007] (-976.781) (-979.274) (-979.018) * (-978.724) (-977.352) (-976.496) [-977.094] -- 0:00:38 386000 -- (-979.779) (-976.663) (-978.942) [-978.458] * (-981.022) (-977.094) [-977.206] (-978.264) -- 0:00:38 386500 -- (-980.200) (-977.240) (-980.514) [-978.215] * (-981.105) (-978.707) (-979.260) [-980.503] -- 0:00:38 387000 -- [-980.287] (-979.393) (-977.572) (-976.788) * [-976.927] (-981.091) (-978.542) (-979.488) -- 0:00:38 387500 -- (-985.604) [-977.849] (-976.847) (-977.759) * (-978.657) [-978.559] (-976.950) (-979.096) -- 0:00:37 388000 -- [-977.235] (-979.840) (-978.902) (-977.596) * [-978.837] (-980.334) (-977.832) (-977.114) -- 0:00:37 388500 -- (-976.672) (-979.201) (-980.109) [-981.000] * (-978.004) [-976.629] (-983.088) (-981.804) -- 0:00:37 389000 -- [-977.903] (-980.524) (-980.628) (-976.563) * (-980.462) (-978.740) [-977.363] (-977.683) -- 0:00:37 389500 -- [-979.314] (-983.776) (-977.946) (-979.985) * (-978.595) (-978.824) (-978.717) [-977.341] -- 0:00:37 390000 -- [-977.578] (-980.737) (-976.856) (-980.375) * (-977.049) [-977.834] (-977.913) (-982.528) -- 0:00:37 Average standard deviation of split frequencies: 0.013609 390500 -- (-978.430) (-977.448) (-978.206) [-979.076] * [-976.889] (-978.449) (-977.012) (-978.335) -- 0:00:37 391000 -- (-978.426) [-979.413] (-978.417) (-978.081) * (-977.673) (-980.717) (-977.600) [-978.749] -- 0:00:37 391500 -- (-979.990) (-978.948) (-981.348) [-978.948] * (-978.759) [-977.160] (-978.473) (-982.634) -- 0:00:37 392000 -- (-977.553) [-979.392] (-977.113) (-977.033) * (-978.244) (-979.267) (-981.578) [-977.467] -- 0:00:37 392500 -- [-980.850] (-978.265) (-979.131) (-978.779) * (-978.513) (-978.753) (-977.801) [-979.239] -- 0:00:37 393000 -- [-978.093] (-978.118) (-979.133) (-982.874) * [-980.454] (-980.533) (-979.968) (-977.616) -- 0:00:37 393500 -- [-982.209] (-980.377) (-978.750) (-976.985) * (-981.283) [-980.017] (-979.007) (-980.045) -- 0:00:36 394000 -- [-977.942] (-977.779) (-977.863) (-976.622) * (-977.332) [-977.021] (-976.942) (-982.339) -- 0:00:36 394500 -- (-982.018) (-976.953) [-979.215] (-978.400) * (-980.532) [-977.760] (-979.120) (-977.284) -- 0:00:36 395000 -- [-977.747] (-977.714) (-984.210) (-979.294) * (-981.568) (-977.719) (-979.628) [-977.285] -- 0:00:36 Average standard deviation of split frequencies: 0.014550 395500 -- (-980.626) (-979.640) (-981.043) [-977.214] * [-979.535] (-976.922) (-979.316) (-977.285) -- 0:00:36 396000 -- (-981.622) (-977.584) [-977.800] (-979.237) * (-981.605) [-976.841] (-980.172) (-977.562) -- 0:00:36 396500 -- (-983.397) (-978.747) [-976.627] (-978.745) * [-976.319] (-978.218) (-982.230) (-976.761) -- 0:00:36 397000 -- (-979.772) (-978.755) [-978.457] (-980.834) * (-980.824) [-981.139] (-979.434) (-980.442) -- 0:00:36 397500 -- (-977.498) (-980.253) (-977.952) [-978.294] * (-979.705) (-979.293) [-980.181] (-976.582) -- 0:00:37 398000 -- (-979.736) (-977.066) [-977.657] (-979.502) * (-979.586) [-976.541] (-981.579) (-981.100) -- 0:00:37 398500 -- (-980.499) (-977.315) (-977.632) [-977.625] * (-982.728) (-977.186) (-977.856) [-977.994] -- 0:00:37 399000 -- (-977.736) (-978.545) (-975.954) [-980.878] * (-979.742) (-984.948) (-976.555) [-976.932] -- 0:00:37 399500 -- (-976.499) (-978.166) (-977.992) [-980.713] * [-977.554] (-981.403) (-976.622) (-976.738) -- 0:00:37 400000 -- [-976.092] (-979.525) (-980.719) (-977.399) * [-977.493] (-979.829) (-980.743) (-978.103) -- 0:00:37 Average standard deviation of split frequencies: 0.014184 400500 -- (-977.405) (-976.830) [-976.689] (-976.300) * (-979.532) (-978.225) (-977.753) [-977.994] -- 0:00:37 401000 -- (-979.617) (-978.432) [-977.153] (-977.406) * [-978.821] (-979.421) (-976.723) (-977.888) -- 0:00:37 401500 -- (-979.384) (-979.872) [-977.991] (-978.468) * [-979.089] (-978.614) (-977.927) (-976.445) -- 0:00:37 402000 -- (-978.771) [-978.150] (-978.606) (-976.237) * (-975.789) (-977.382) [-978.275] (-978.651) -- 0:00:37 402500 -- (-978.990) (-980.059) (-978.208) [-976.267] * [-975.789] (-978.230) (-977.593) (-979.331) -- 0:00:37 403000 -- (-977.047) (-980.438) (-978.956) [-976.858] * (-983.230) [-978.627] (-979.883) (-977.042) -- 0:00:37 403500 -- [-981.663] (-978.792) (-981.492) (-982.586) * (-982.431) (-976.880) (-981.008) [-977.621] -- 0:00:36 404000 -- (-983.781) (-978.478) (-977.223) [-976.797] * (-981.022) (-977.150) (-979.498) [-979.616] -- 0:00:36 404500 -- (-984.135) (-979.452) (-977.972) [-976.904] * (-977.949) [-977.311] (-979.035) (-981.317) -- 0:00:36 405000 -- (-976.981) (-979.292) (-977.671) [-976.977] * (-977.555) (-976.916) (-978.659) [-979.818] -- 0:00:36 Average standard deviation of split frequencies: 0.015033 405500 -- (-976.776) (-981.261) [-978.973] (-978.905) * (-977.938) [-979.846] (-983.457) (-978.770) -- 0:00:36 406000 -- (-976.230) (-980.138) [-981.248] (-978.326) * [-977.400] (-976.281) (-978.939) (-978.707) -- 0:00:36 406500 -- (-977.185) [-977.170] (-979.323) (-977.163) * [-977.581] (-977.365) (-978.814) (-979.608) -- 0:00:36 407000 -- (-977.032) (-977.515) (-978.661) [-976.558] * (-977.677) [-976.471] (-976.075) (-978.326) -- 0:00:36 407500 -- [-978.872] (-976.865) (-979.074) (-977.570) * (-981.211) [-977.625] (-976.556) (-976.761) -- 0:00:36 408000 -- (-977.071) (-977.293) [-977.264] (-977.099) * [-977.695] (-978.449) (-979.472) (-976.339) -- 0:00:36 408500 -- (-977.311) (-977.286) (-977.264) [-976.433] * (-977.259) (-982.726) [-978.778] (-976.566) -- 0:00:36 409000 -- (-984.326) [-976.238] (-975.755) (-976.724) * (-978.604) [-977.252] (-977.637) (-978.005) -- 0:00:36 409500 -- (-979.497) [-976.617] (-976.360) (-977.038) * (-979.052) [-977.456] (-977.942) (-979.703) -- 0:00:36 410000 -- (-980.547) (-976.409) [-978.733] (-978.363) * (-977.488) [-976.304] (-980.610) (-978.272) -- 0:00:35 Average standard deviation of split frequencies: 0.013966 410500 -- (-978.910) (-981.783) (-978.576) [-978.798] * (-981.953) (-976.931) [-978.447] (-977.277) -- 0:00:35 411000 -- (-978.822) [-981.981] (-979.728) (-979.997) * (-978.230) (-980.256) (-977.241) [-977.294] -- 0:00:35 411500 -- (-977.817) (-982.417) [-976.530] (-977.043) * (-976.721) (-978.681) (-977.240) [-978.143] -- 0:00:35 412000 -- (-976.935) [-979.960] (-978.430) (-977.148) * (-979.556) (-977.265) [-978.718] (-976.484) -- 0:00:35 412500 -- (-978.476) [-978.703] (-979.382) (-978.552) * (-977.004) [-977.781] (-977.247) (-976.332) -- 0:00:35 413000 -- (-977.080) (-977.468) [-979.195] (-977.445) * (-976.994) [-976.825] (-979.491) (-977.122) -- 0:00:35 413500 -- (-978.676) (-979.147) (-979.040) [-979.862] * (-977.156) (-977.612) (-981.210) [-978.092] -- 0:00:36 414000 -- (-977.182) (-979.706) [-978.104] (-976.057) * (-978.400) (-979.781) (-981.116) [-978.533] -- 0:00:36 414500 -- (-977.375) (-977.864) [-977.326] (-979.988) * (-983.518) (-978.767) (-976.617) [-977.907] -- 0:00:36 415000 -- (-978.129) (-978.622) [-978.258] (-983.290) * (-981.455) (-984.080) [-976.535] (-977.660) -- 0:00:36 Average standard deviation of split frequencies: 0.014102 415500 -- (-978.965) (-976.577) [-976.728] (-976.720) * (-977.419) (-979.871) [-976.515] (-976.653) -- 0:00:36 416000 -- (-978.313) (-976.032) (-979.588) [-976.645] * (-979.312) [-977.794] (-978.222) (-978.689) -- 0:00:36 416500 -- (-978.786) (-977.512) [-981.147] (-976.622) * (-979.436) (-978.001) (-979.449) [-977.812] -- 0:00:36 417000 -- (-978.938) (-978.851) (-978.872) [-976.499] * (-978.401) (-981.706) [-977.541] (-981.237) -- 0:00:36 417500 -- (-977.810) [-978.081] (-982.824) (-979.615) * [-976.858] (-984.979) (-978.304) (-984.229) -- 0:00:36 418000 -- (-987.149) (-977.073) [-976.255] (-981.311) * (-976.196) (-989.510) [-977.651] (-979.645) -- 0:00:36 418500 -- (-981.902) [-977.109] (-976.352) (-976.847) * (-976.238) (-981.483) [-976.795] (-982.656) -- 0:00:36 419000 -- (-980.725) (-980.036) (-976.430) [-976.287] * [-977.934] (-979.603) (-978.790) (-977.028) -- 0:00:36 419500 -- (-977.169) (-977.266) (-976.979) [-976.888] * [-976.805] (-976.803) (-979.763) (-978.056) -- 0:00:35 420000 -- (-980.811) [-978.059] (-983.083) (-978.565) * (-980.840) (-976.979) (-984.010) [-980.381] -- 0:00:35 Average standard deviation of split frequencies: 0.014988 420500 -- (-977.386) [-979.099] (-977.962) (-980.066) * (-979.782) [-980.630] (-985.726) (-978.332) -- 0:00:35 421000 -- (-981.198) [-979.661] (-977.354) (-982.324) * [-979.610] (-979.436) (-982.207) (-980.786) -- 0:00:35 421500 -- (-979.594) (-979.950) [-977.208] (-978.895) * (-979.497) (-980.153) (-982.958) [-976.963] -- 0:00:35 422000 -- [-976.201] (-983.015) (-976.962) (-977.692) * (-977.450) (-977.497) [-980.741] (-978.401) -- 0:00:35 422500 -- (-977.060) (-978.473) [-977.936] (-977.142) * (-976.253) [-978.088] (-981.135) (-977.720) -- 0:00:35 423000 -- [-979.134] (-977.328) (-980.057) (-977.862) * (-975.946) (-977.890) (-980.285) [-977.860] -- 0:00:35 423500 -- (-982.382) (-977.349) (-976.968) [-977.492] * [-977.082] (-978.491) (-979.007) (-978.272) -- 0:00:35 424000 -- (-979.488) [-976.629] (-982.320) (-980.087) * [-977.624] (-980.299) (-978.899) (-978.289) -- 0:00:35 424500 -- [-979.709] (-980.318) (-981.708) (-978.748) * (-978.273) (-983.600) (-978.326) [-977.962] -- 0:00:35 425000 -- (-977.057) (-976.816) (-977.408) [-978.018] * [-980.682] (-976.892) (-977.661) (-978.635) -- 0:00:35 Average standard deviation of split frequencies: 0.014125 425500 -- (-979.461) [-976.602] (-977.137) (-978.454) * [-978.949] (-976.849) (-978.092) (-980.724) -- 0:00:35 426000 -- [-977.424] (-977.668) (-977.050) (-977.711) * (-982.436) (-977.219) [-976.870] (-980.411) -- 0:00:35 426500 -- (-978.657) (-977.159) [-976.890] (-979.657) * (-978.045) (-977.239) [-976.570] (-980.458) -- 0:00:34 427000 -- (-981.731) [-977.408] (-981.104) (-981.459) * (-978.560) (-977.087) [-977.249] (-979.896) -- 0:00:34 427500 -- (-977.589) (-979.278) (-975.928) [-978.385] * (-978.616) (-978.203) (-977.084) [-977.679] -- 0:00:34 428000 -- (-979.045) (-977.509) (-979.677) [-977.705] * (-979.404) [-975.966] (-979.338) (-980.821) -- 0:00:34 428500 -- (-976.818) (-979.054) (-984.182) [-979.828] * (-978.552) [-976.386] (-976.420) (-981.112) -- 0:00:34 429000 -- (-977.092) (-978.362) [-977.919] (-977.979) * [-976.978] (-980.830) (-977.138) (-980.567) -- 0:00:34 429500 -- [-976.300] (-978.096) (-976.323) (-977.638) * (-977.615) (-979.275) (-982.452) [-978.175] -- 0:00:34 430000 -- [-977.650] (-980.650) (-978.419) (-979.278) * (-978.535) (-977.086) (-977.508) [-981.085] -- 0:00:35 Average standard deviation of split frequencies: 0.015393 430500 -- (-978.380) [-976.619] (-978.367) (-977.481) * (-978.987) [-976.913] (-979.522) (-980.630) -- 0:00:35 431000 -- (-977.273) [-978.150] (-978.343) (-977.610) * (-978.039) [-976.488] (-977.173) (-985.877) -- 0:00:35 431500 -- (-978.450) [-977.634] (-980.931) (-978.621) * (-977.016) [-976.494] (-980.205) (-981.710) -- 0:00:35 432000 -- (-976.602) (-976.847) (-979.769) [-976.202] * (-976.778) (-982.181) [-976.810] (-978.365) -- 0:00:35 432500 -- (-976.910) [-976.510] (-981.633) (-976.223) * (-976.778) (-980.092) [-977.010] (-978.890) -- 0:00:35 433000 -- [-977.548] (-979.423) (-979.168) (-976.939) * [-978.030] (-978.710) (-978.867) (-978.211) -- 0:00:35 433500 -- (-976.924) [-978.420] (-976.812) (-976.871) * (-978.807) (-982.967) (-976.880) [-978.934] -- 0:00:35 434000 -- (-980.614) [-977.505] (-977.281) (-979.506) * (-979.714) (-982.492) [-978.723] (-977.872) -- 0:00:35 434500 -- (-979.482) [-978.433] (-979.200) (-978.142) * (-979.952) (-976.728) [-978.585] (-978.449) -- 0:00:35 435000 -- [-977.474] (-979.260) (-978.999) (-979.760) * (-977.212) (-979.010) (-985.406) [-977.283] -- 0:00:35 Average standard deviation of split frequencies: 0.015073 435500 -- (-977.969) (-978.349) (-978.956) [-979.316] * (-978.884) (-976.959) [-983.346] (-978.797) -- 0:00:34 436000 -- [-977.587] (-978.353) (-980.199) (-977.831) * (-978.802) (-978.573) [-979.818] (-978.142) -- 0:00:34 436500 -- (-978.626) [-976.959] (-978.900) (-977.628) * [-978.932] (-980.649) (-976.743) (-980.230) -- 0:00:34 437000 -- (-979.385) [-976.711] (-978.285) (-977.993) * (-979.213) [-980.248] (-978.553) (-977.089) -- 0:00:34 437500 -- (-978.470) (-979.343) [-978.039] (-977.684) * [-977.285] (-976.709) (-980.238) (-976.289) -- 0:00:34 438000 -- [-982.084] (-978.015) (-976.486) (-978.296) * [-976.468] (-981.176) (-979.160) (-977.550) -- 0:00:34 438500 -- (-978.141) (-980.546) (-976.743) [-977.755] * (-978.914) [-980.534] (-979.451) (-977.148) -- 0:00:34 439000 -- (-977.739) (-979.133) [-977.812] (-979.628) * (-976.966) (-978.466) [-976.679] (-975.808) -- 0:00:34 439500 -- (-976.942) [-979.081] (-976.805) (-977.007) * (-978.314) [-978.448] (-978.476) (-975.920) -- 0:00:34 440000 -- (-976.622) (-978.069) (-980.197) [-977.330] * [-976.554] (-979.711) (-978.334) (-976.817) -- 0:00:34 Average standard deviation of split frequencies: 0.014033 440500 -- (-977.668) [-977.687] (-979.343) (-976.901) * [-977.377] (-977.098) (-975.989) (-981.045) -- 0:00:34 441000 -- (-977.555) (-981.180) (-977.742) [-976.909] * (-977.484) (-976.902) (-983.027) [-978.783] -- 0:00:34 441500 -- (-977.691) [-978.298] (-980.802) (-977.480) * (-981.107) [-977.330] (-979.869) (-980.505) -- 0:00:34 442000 -- [-976.435] (-977.689) (-982.248) (-979.457) * (-977.581) (-981.407) (-982.497) [-978.837] -- 0:00:34 442500 -- (-979.097) [-978.165] (-980.494) (-978.992) * (-982.161) (-977.830) (-983.324) [-978.652] -- 0:00:34 443000 -- (-979.592) (-980.110) (-980.948) [-976.300] * (-979.585) [-976.461] (-979.569) (-978.708) -- 0:00:33 443500 -- [-979.503] (-977.086) (-985.089) (-978.220) * [-979.230] (-976.803) (-978.856) (-978.210) -- 0:00:33 444000 -- (-977.730) [-978.386] (-981.452) (-977.907) * (-981.392) (-976.718) [-977.931] (-976.012) -- 0:00:33 444500 -- (-979.235) (-976.680) (-985.035) [-978.197] * (-978.745) [-978.299] (-976.407) (-976.043) -- 0:00:33 445000 -- (-977.964) (-976.856) (-978.408) [-977.803] * [-978.497] (-980.059) (-981.625) (-976.093) -- 0:00:33 Average standard deviation of split frequencies: 0.013181 445500 -- (-981.622) [-976.797] (-984.239) (-980.225) * (-977.203) (-976.241) [-977.922] (-977.422) -- 0:00:33 446000 -- (-978.155) [-976.646] (-978.401) (-978.224) * (-978.403) (-976.564) (-980.748) [-979.623] -- 0:00:34 446500 -- [-979.421] (-976.630) (-976.654) (-978.911) * (-979.194) (-976.239) (-981.796) [-980.421] -- 0:00:34 447000 -- (-982.327) (-976.481) [-977.563] (-980.746) * (-979.699) [-976.239] (-978.597) (-979.258) -- 0:00:34 447500 -- (-978.011) (-976.645) (-980.681) [-981.239] * (-977.377) [-976.234] (-981.315) (-976.852) -- 0:00:34 448000 -- (-976.706) (-977.012) (-978.927) [-977.563] * (-978.897) (-978.018) [-982.615] (-979.814) -- 0:00:34 448500 -- (-978.068) (-976.399) [-980.343] (-985.725) * (-976.391) (-976.566) (-980.589) [-976.273] -- 0:00:34 449000 -- (-978.832) (-976.904) (-984.647) [-981.772] * [-976.666] (-980.902) (-977.006) (-977.934) -- 0:00:34 449500 -- (-978.392) [-979.847] (-983.514) (-977.857) * (-978.831) [-977.324] (-977.006) (-978.832) -- 0:00:34 450000 -- (-980.090) (-977.364) (-976.716) [-976.888] * (-979.236) [-978.137] (-976.840) (-980.345) -- 0:00:34 Average standard deviation of split frequencies: 0.012491 450500 -- (-977.025) [-976.336] (-980.933) (-978.846) * [-980.642] (-977.976) (-979.403) (-978.640) -- 0:00:34 451000 -- (-976.709) (-978.084) (-978.891) [-978.082] * (-981.283) [-976.950] (-982.505) (-978.803) -- 0:00:34 451500 -- (-980.410) (-977.445) (-977.303) [-979.393] * (-980.699) [-978.123] (-981.516) (-977.357) -- 0:00:34 452000 -- (-976.831) (-978.748) [-977.897] (-977.840) * (-979.394) (-978.869) (-976.408) [-976.014] -- 0:00:33 452500 -- (-978.571) [-978.192] (-977.924) (-976.338) * (-982.663) (-976.939) (-976.387) [-975.965] -- 0:00:33 453000 -- (-978.414) (-978.499) [-976.728] (-977.440) * (-978.035) (-976.756) [-979.836] (-977.761) -- 0:00:33 453500 -- (-976.353) (-979.822) [-979.237] (-979.155) * [-978.417] (-977.301) (-980.295) (-977.357) -- 0:00:33 454000 -- (-978.122) (-977.473) (-976.424) [-979.199] * (-980.855) [-977.001] (-978.663) (-979.975) -- 0:00:33 454500 -- (-980.574) (-976.525) [-977.293] (-976.810) * [-980.130] (-976.574) (-979.885) (-980.624) -- 0:00:33 455000 -- (-978.787) [-976.109] (-977.293) (-978.009) * (-977.016) (-978.336) (-979.123) [-982.414] -- 0:00:33 Average standard deviation of split frequencies: 0.012284 455500 -- (-977.275) (-978.704) [-978.159] (-978.663) * [-977.679] (-981.026) (-983.266) (-977.673) -- 0:00:33 456000 -- (-979.007) (-976.994) (-977.815) [-977.274] * (-977.825) (-978.572) [-977.940] (-976.759) -- 0:00:33 456500 -- (-978.526) [-978.853] (-980.322) (-977.862) * [-979.799] (-978.566) (-979.259) (-977.485) -- 0:00:33 457000 -- (-978.777) (-978.523) (-979.262) [-978.409] * (-976.983) (-980.415) (-979.685) [-979.919] -- 0:00:33 457500 -- [-978.739] (-978.637) (-979.098) (-978.064) * (-976.656) [-978.255] (-978.803) (-981.550) -- 0:00:33 458000 -- (-980.629) [-981.276] (-983.228) (-978.370) * (-976.838) [-979.062] (-979.837) (-982.303) -- 0:00:33 458500 -- (-979.504) [-978.442] (-980.053) (-976.749) * (-980.602) [-977.235] (-979.438) (-977.878) -- 0:00:33 459000 -- (-976.938) (-977.097) [-978.259] (-977.843) * (-983.202) (-980.916) (-977.697) [-977.019] -- 0:00:33 459500 -- [-980.185] (-978.887) (-979.225) (-976.376) * (-977.566) [-977.675] (-978.160) (-976.392) -- 0:00:32 460000 -- (-978.199) (-977.386) [-979.905] (-976.796) * (-977.187) (-981.517) (-977.531) [-977.087] -- 0:00:32 Average standard deviation of split frequencies: 0.013062 460500 -- [-978.311] (-978.884) (-980.055) (-979.576) * [-977.778] (-980.336) (-977.827) (-976.785) -- 0:00:32 461000 -- [-977.417] (-981.234) (-984.930) (-982.358) * (-978.739) (-982.324) [-976.820] (-977.293) -- 0:00:32 461500 -- (-979.055) [-978.690] (-987.686) (-976.320) * (-980.434) [-979.182] (-980.894) (-977.127) -- 0:00:32 462000 -- (-978.004) (-977.913) [-977.554] (-978.482) * (-977.094) [-977.705] (-980.531) (-978.311) -- 0:00:33 462500 -- (-978.698) [-977.984] (-976.822) (-979.144) * (-976.920) (-980.212) [-981.076] (-978.768) -- 0:00:33 463000 -- (-980.214) (-976.541) (-976.474) [-977.158] * [-977.519] (-978.499) (-979.464) (-978.625) -- 0:00:33 463500 -- (-978.346) [-981.089] (-980.053) (-979.197) * (-977.448) (-975.992) (-979.201) [-977.522] -- 0:00:33 464000 -- (-976.679) (-980.190) (-979.214) [-978.582] * (-978.277) (-979.413) (-979.591) [-976.905] -- 0:00:33 464500 -- (-977.521) (-981.771) [-978.556] (-980.931) * (-978.611) (-981.589) (-979.696) [-976.793] -- 0:00:33 465000 -- (-977.753) (-983.356) [-978.147] (-982.509) * (-980.278) [-979.704] (-979.590) (-975.919) -- 0:00:33 Average standard deviation of split frequencies: 0.012757 465500 -- [-977.059] (-978.361) (-977.585) (-978.114) * (-976.890) (-980.846) (-979.941) [-977.137] -- 0:00:33 466000 -- (-977.501) (-979.249) [-980.327] (-980.231) * (-978.653) [-980.861] (-979.481) (-977.437) -- 0:00:33 466500 -- (-980.429) [-977.008] (-979.025) (-980.307) * [-982.336] (-977.327) (-977.821) (-977.053) -- 0:00:33 467000 -- [-978.396] (-980.791) (-978.174) (-977.847) * (-981.773) (-976.777) [-977.380] (-979.566) -- 0:00:33 467500 -- (-977.785) [-981.238] (-976.425) (-977.610) * [-979.713] (-977.094) (-978.442) (-977.348) -- 0:00:33 468000 -- (-979.471) (-977.597) (-977.132) [-978.262] * (-979.960) (-978.553) (-978.502) [-977.565] -- 0:00:32 468500 -- (-977.571) (-978.722) [-976.908] (-980.061) * (-980.175) (-977.506) [-978.353] (-980.251) -- 0:00:32 469000 -- (-977.048) (-978.251) [-978.295] (-983.183) * (-979.665) [-978.465] (-977.685) (-978.022) -- 0:00:32 469500 -- (-976.480) (-981.395) [-981.540] (-980.899) * (-980.705) (-979.094) [-976.695] (-978.151) -- 0:00:32 470000 -- (-977.315) (-978.702) [-978.699] (-984.244) * [-977.974] (-979.880) (-978.770) (-980.639) -- 0:00:32 Average standard deviation of split frequencies: 0.013197 470500 -- (-977.424) (-978.165) [-978.274] (-977.517) * (-979.614) [-978.055] (-976.964) (-980.401) -- 0:00:32 471000 -- (-978.483) (-979.415) (-980.046) [-981.084] * [-977.404] (-978.889) (-983.492) (-975.930) -- 0:00:32 471500 -- [-976.270] (-981.162) (-981.981) (-979.070) * (-976.075) (-979.891) [-978.048] (-977.320) -- 0:00:32 472000 -- (-978.000) (-982.395) (-979.380) [-977.634] * [-976.064] (-979.476) (-976.859) (-977.798) -- 0:00:32 472500 -- (-976.206) (-977.972) (-983.063) [-976.651] * (-976.378) (-978.587) (-978.045) [-976.471] -- 0:00:32 473000 -- (-976.443) [-976.343] (-984.746) (-978.105) * (-977.393) (-977.365) (-977.325) [-978.375] -- 0:00:32 473500 -- (-978.303) (-980.232) [-976.494] (-978.859) * (-977.666) (-978.027) [-976.677] (-977.541) -- 0:00:32 474000 -- (-979.813) (-979.337) (-979.150) [-980.483] * [-977.620] (-978.113) (-979.368) (-978.401) -- 0:00:32 474500 -- (-979.955) (-976.433) [-976.944] (-979.030) * [-979.960] (-977.430) (-976.933) (-979.252) -- 0:00:32 475000 -- (-977.658) [-978.557] (-977.039) (-977.609) * [-977.780] (-978.943) (-978.593) (-977.055) -- 0:00:32 Average standard deviation of split frequencies: 0.013493 475500 -- [-976.788] (-983.063) (-979.070) (-979.062) * [-977.339] (-979.510) (-977.901) (-977.088) -- 0:00:31 476000 -- (-983.783) [-980.023] (-976.280) (-977.924) * [-976.991] (-978.588) (-977.484) (-978.136) -- 0:00:31 476500 -- [-978.878] (-978.358) (-981.028) (-978.038) * (-977.982) (-980.310) (-977.927) [-979.037] -- 0:00:31 477000 -- [-977.992] (-977.020) (-976.909) (-981.659) * (-978.596) (-979.847) (-984.066) [-977.833] -- 0:00:31 477500 -- (-978.901) (-979.286) (-977.307) [-976.785] * (-978.548) (-977.839) (-979.316) [-976.541] -- 0:00:32 478000 -- (-976.989) (-978.189) (-979.424) [-976.470] * (-978.984) [-978.104] (-976.337) (-977.458) -- 0:00:32 478500 -- [-976.948] (-977.302) (-977.256) (-976.761) * (-980.561) (-978.325) (-976.726) [-977.379] -- 0:00:32 479000 -- (-976.795) (-976.390) [-979.917] (-977.858) * (-978.151) [-979.215] (-979.369) (-976.145) -- 0:00:32 479500 -- (-976.887) [-978.171] (-977.985) (-977.863) * (-979.390) (-978.755) (-978.528) [-977.457] -- 0:00:32 480000 -- (-976.826) [-977.905] (-980.552) (-977.384) * (-980.315) [-977.505] (-978.217) (-984.982) -- 0:00:32 Average standard deviation of split frequencies: 0.013599 480500 -- [-978.397] (-979.169) (-977.637) (-980.500) * (-980.306) (-977.754) [-977.982] (-980.740) -- 0:00:32 481000 -- (-980.601) (-978.736) [-977.925] (-980.806) * (-977.526) (-978.295) (-977.267) [-977.134] -- 0:00:32 481500 -- [-978.647] (-980.954) (-976.485) (-978.247) * (-982.901) (-978.893) (-977.345) [-978.134] -- 0:00:32 482000 -- (-976.287) (-981.569) [-980.730] (-978.614) * (-982.683) (-977.153) [-977.316] (-979.696) -- 0:00:32 482500 -- (-982.851) (-977.474) (-978.593) [-978.083] * (-981.304) [-978.548] (-976.661) (-980.796) -- 0:00:32 483000 -- (-978.441) (-977.983) (-977.028) [-977.855] * [-978.357] (-976.645) (-976.785) (-980.172) -- 0:00:32 483500 -- [-977.700] (-977.075) (-978.145) (-976.388) * (-977.165) [-976.326] (-978.401) (-979.440) -- 0:00:32 484000 -- (-977.180) [-977.718] (-981.817) (-977.134) * (-976.849) (-977.147) [-977.079] (-977.938) -- 0:00:31 484500 -- (-977.964) (-978.951) [-979.587] (-977.207) * (-978.577) (-977.808) [-979.106] (-979.158) -- 0:00:31 485000 -- (-977.391) (-978.824) (-979.373) [-977.281] * (-981.460) [-980.637] (-978.093) (-978.415) -- 0:00:31 Average standard deviation of split frequencies: 0.013276 485500 -- (-978.295) (-978.191) [-976.934] (-977.701) * [-984.292] (-977.340) (-978.051) (-977.424) -- 0:00:31 486000 -- (-977.468) (-979.401) [-976.960] (-977.716) * (-978.579) (-978.674) [-978.340] (-977.120) -- 0:00:31 486500 -- (-977.595) [-979.440] (-977.680) (-982.700) * (-979.094) (-979.550) [-976.477] (-980.203) -- 0:00:31 487000 -- (-976.886) (-976.960) (-980.145) [-977.759] * (-976.662) (-978.687) (-980.132) [-976.296] -- 0:00:31 487500 -- [-977.935] (-976.754) (-980.401) (-980.521) * (-980.608) (-978.866) [-977.857] (-978.166) -- 0:00:31 488000 -- [-978.849] (-977.859) (-976.683) (-977.363) * (-983.067) [-977.907] (-982.742) (-979.197) -- 0:00:31 488500 -- [-977.254] (-977.437) (-976.633) (-980.292) * (-980.407) (-977.262) (-980.692) [-977.343] -- 0:00:31 489000 -- (-982.070) [-978.554] (-977.734) (-978.942) * [-978.498] (-977.657) (-980.227) (-981.347) -- 0:00:31 489500 -- [-976.756] (-977.247) (-979.724) (-981.667) * [-977.363] (-980.386) (-979.202) (-981.878) -- 0:00:31 490000 -- [-978.042] (-977.246) (-977.914) (-983.598) * (-976.488) [-978.333] (-977.227) (-979.998) -- 0:00:31 Average standard deviation of split frequencies: 0.013090 490500 -- [-977.943] (-976.564) (-976.891) (-980.947) * [-980.378] (-978.276) (-978.118) (-978.673) -- 0:00:31 491000 -- [-977.641] (-976.666) (-975.873) (-977.408) * (-978.321) (-980.799) (-978.273) [-977.117] -- 0:00:31 491500 -- (-981.057) (-977.057) [-975.873] (-980.095) * (-976.458) (-980.440) (-978.324) [-978.886] -- 0:00:31 492000 -- (-984.313) [-977.732] (-977.951) (-981.133) * (-976.936) (-976.732) [-977.553] (-978.022) -- 0:00:30 492500 -- (-978.158) (-983.957) [-977.371] (-978.259) * (-979.544) [-978.095] (-980.344) (-981.081) -- 0:00:30 493000 -- [-978.005] (-986.049) (-976.174) (-977.299) * (-979.173) (-975.957) (-977.361) [-981.494] -- 0:00:30 493500 -- [-983.581] (-980.830) (-977.689) (-977.850) * (-976.474) (-976.534) (-977.370) [-978.137] -- 0:00:30 494000 -- (-977.836) (-977.986) [-978.114] (-980.110) * (-976.951) [-978.308] (-977.607) (-977.799) -- 0:00:31 494500 -- [-978.221] (-978.437) (-977.752) (-978.189) * (-978.673) (-978.130) (-980.000) [-978.239] -- 0:00:31 495000 -- [-979.729] (-979.139) (-976.386) (-983.273) * (-976.622) (-977.636) (-976.469) [-981.001] -- 0:00:31 Average standard deviation of split frequencies: 0.012652 495500 -- (-978.991) (-981.432) (-976.766) [-976.764] * (-980.237) (-978.420) [-978.550] (-977.843) -- 0:00:31 496000 -- (-982.964) (-981.706) (-980.225) [-976.007] * (-981.632) (-976.582) (-982.015) [-977.466] -- 0:00:31 496500 -- [-976.469] (-978.027) (-979.742) (-976.647) * [-977.225] (-976.578) (-977.328) (-977.757) -- 0:00:31 497000 -- (-978.334) [-977.467] (-978.664) (-978.496) * [-975.908] (-976.322) (-978.827) (-977.115) -- 0:00:31 497500 -- [-977.921] (-977.885) (-979.999) (-978.008) * (-978.204) (-976.709) [-978.519] (-980.647) -- 0:00:31 498000 -- (-976.767) [-977.586] (-977.060) (-977.055) * (-979.660) (-976.496) (-976.354) [-977.598] -- 0:00:31 498500 -- (-976.924) (-978.528) (-979.362) [-978.297] * (-977.250) (-976.483) [-983.101] (-980.552) -- 0:00:31 499000 -- (-978.367) (-977.948) [-976.901] (-981.312) * (-978.655) [-976.600] (-981.627) (-977.001) -- 0:00:31 499500 -- (-977.437) [-978.410] (-979.698) (-980.998) * (-978.946) [-977.014] (-977.466) (-980.013) -- 0:00:31 500000 -- (-978.131) (-983.606) (-976.335) [-977.171] * (-979.649) (-977.178) (-977.919) [-978.218] -- 0:00:31 Average standard deviation of split frequencies: 0.012742 500500 -- (-979.757) [-978.448] (-976.946) (-977.314) * [-980.905] (-977.517) (-978.198) (-978.079) -- 0:00:30 501000 -- [-979.236] (-977.156) (-979.256) (-976.245) * (-977.880) (-977.512) (-979.054) [-976.766] -- 0:00:30 501500 -- (-979.769) [-976.519] (-980.564) (-977.763) * (-976.787) (-979.911) [-978.245] (-978.676) -- 0:00:30 502000 -- [-978.193] (-978.003) (-977.208) (-976.596) * [-979.114] (-978.998) (-980.209) (-976.918) -- 0:00:30 502500 -- (-977.349) (-977.854) [-976.751] (-976.997) * [-979.462] (-978.618) (-978.985) (-978.647) -- 0:00:30 503000 -- (-977.030) (-977.792) (-977.460) [-976.868] * (-980.078) (-979.911) [-978.337] (-977.103) -- 0:00:30 503500 -- [-977.398] (-978.256) (-976.661) (-979.132) * (-979.588) (-978.880) (-979.420) [-978.702] -- 0:00:30 504000 -- (-979.872) (-979.600) [-976.795] (-981.632) * (-983.327) (-982.941) (-981.459) [-976.740] -- 0:00:30 504500 -- [-982.567] (-977.564) (-981.346) (-982.421) * [-976.521] (-980.796) (-980.624) (-978.844) -- 0:00:30 505000 -- (-980.885) (-983.676) [-976.218] (-980.853) * [-976.530] (-976.920) (-978.971) (-977.549) -- 0:00:30 Average standard deviation of split frequencies: 0.012794 505500 -- [-977.484] (-980.416) (-979.217) (-976.209) * [-976.111] (-978.648) (-977.113) (-977.384) -- 0:00:30 506000 -- (-981.322) (-978.758) (-980.827) [-977.162] * (-977.738) [-979.119] (-976.632) (-978.166) -- 0:00:30 506500 -- (-979.560) [-977.782] (-977.226) (-977.203) * (-980.702) (-979.528) [-976.460] (-981.787) -- 0:00:30 507000 -- [-977.567] (-978.016) (-977.011) (-977.338) * (-978.512) [-979.308] (-978.972) (-977.727) -- 0:00:30 507500 -- [-976.520] (-976.592) (-976.904) (-976.547) * [-978.709] (-977.109) (-981.892) (-978.447) -- 0:00:30 508000 -- (-976.444) (-979.533) (-976.807) [-976.748] * (-975.969) [-977.426] (-980.403) (-976.746) -- 0:00:30 508500 -- (-977.213) (-979.571) (-978.877) [-976.953] * [-976.730] (-978.392) (-977.224) (-976.661) -- 0:00:29 509000 -- (-977.329) [-977.962] (-976.762) (-978.453) * [-980.541] (-978.152) (-977.973) (-978.706) -- 0:00:29 509500 -- (-976.946) (-978.070) [-977.206] (-977.999) * (-978.550) (-982.343) [-977.777] (-977.243) -- 0:00:29 510000 -- (-978.664) (-978.241) [-980.154] (-978.297) * (-978.517) [-978.258] (-978.010) (-984.250) -- 0:00:30 Average standard deviation of split frequencies: 0.012801 510500 -- (-979.106) (-978.037) (-978.318) [-977.695] * [-980.811] (-977.706) (-978.442) (-980.274) -- 0:00:30 511000 -- [-980.931] (-978.774) (-977.493) (-979.195) * (-977.980) [-978.420] (-978.135) (-978.105) -- 0:00:30 511500 -- (-987.859) (-976.579) [-976.750] (-980.437) * (-978.869) (-977.304) [-980.094] (-977.106) -- 0:00:30 512000 -- (-981.266) (-979.380) [-977.349] (-982.271) * [-978.690] (-980.260) (-979.733) (-977.305) -- 0:00:30 512500 -- [-978.295] (-977.835) (-980.948) (-981.154) * (-976.959) [-977.513] (-977.648) (-978.875) -- 0:00:30 513000 -- [-978.880] (-980.455) (-977.073) (-977.837) * (-979.361) (-977.702) (-979.188) [-978.573] -- 0:00:30 513500 -- (-978.522) (-977.631) [-982.288] (-977.326) * (-980.059) (-978.633) (-980.922) [-978.253] -- 0:00:30 514000 -- (-981.000) (-977.509) (-976.397) [-978.302] * (-978.335) (-979.970) [-976.697] (-980.573) -- 0:00:30 514500 -- (-976.392) [-978.079] (-976.246) (-977.319) * (-977.451) [-976.537] (-978.885) (-977.772) -- 0:00:30 515000 -- [-976.982] (-978.945) (-978.308) (-980.030) * (-977.182) [-978.076] (-976.582) (-978.421) -- 0:00:30 Average standard deviation of split frequencies: 0.012607 515500 -- [-977.098] (-978.620) (-978.965) (-978.999) * (-977.182) (-976.287) [-976.583] (-977.087) -- 0:00:30 516000 -- [-976.240] (-980.507) (-978.241) (-978.243) * [-980.760] (-977.080) (-978.418) (-979.008) -- 0:00:30 516500 -- (-976.947) (-976.925) (-980.701) [-982.694] * (-976.461) (-981.605) [-979.071] (-982.847) -- 0:00:29 517000 -- [-978.919] (-976.474) (-980.200) (-976.717) * (-977.775) (-978.067) [-976.108] (-978.012) -- 0:00:29 517500 -- (-981.086) (-978.279) (-977.988) [-978.078] * (-979.105) [-979.162] (-980.583) (-978.186) -- 0:00:29 518000 -- [-978.467] (-978.111) (-977.116) (-978.433) * (-983.440) (-980.072) [-978.562] (-977.637) -- 0:00:29 518500 -- (-980.044) (-983.461) [-978.516] (-977.399) * (-976.489) [-978.628] (-978.700) (-978.720) -- 0:00:29 519000 -- (-980.860) (-977.915) [-978.172] (-981.782) * (-980.593) (-976.996) [-978.363] (-980.383) -- 0:00:29 519500 -- [-981.036] (-976.858) (-979.391) (-980.418) * (-980.153) (-976.876) (-979.234) [-980.499] -- 0:00:29 520000 -- (-976.256) (-975.808) (-979.892) [-978.723] * (-978.186) [-976.494] (-978.861) (-980.856) -- 0:00:29 Average standard deviation of split frequencies: 0.013339 520500 -- [-979.863] (-976.765) (-977.021) (-978.186) * (-977.296) (-976.541) (-979.414) [-977.685] -- 0:00:29 521000 -- (-980.965) (-977.546) [-978.937] (-978.193) * (-976.662) [-976.919] (-979.606) (-978.339) -- 0:00:29 521500 -- (-979.784) [-980.065] (-984.950) (-981.764) * [-977.954] (-977.872) (-976.211) (-977.312) -- 0:00:29 522000 -- (-976.035) (-976.191) [-976.939] (-981.076) * (-979.958) (-977.162) (-976.815) [-977.018] -- 0:00:29 522500 -- [-977.803] (-977.265) (-979.157) (-976.826) * (-978.408) [-977.705] (-978.979) (-979.379) -- 0:00:29 523000 -- (-978.265) [-979.620] (-977.421) (-978.685) * (-978.109) (-976.812) (-978.831) [-978.696] -- 0:00:29 523500 -- [-978.256] (-978.578) (-977.211) (-977.439) * (-980.493) [-976.705] (-979.313) (-979.381) -- 0:00:29 524000 -- [-978.257] (-976.254) (-977.460) (-979.719) * (-977.132) (-976.296) (-978.329) [-976.147] -- 0:00:29 524500 -- [-977.797] (-978.053) (-977.499) (-978.846) * (-983.139) [-976.190] (-977.892) (-977.230) -- 0:00:29 525000 -- [-979.829] (-978.368) (-979.715) (-978.132) * (-978.723) [-978.637] (-976.769) (-981.863) -- 0:00:28 Average standard deviation of split frequencies: 0.012607 525500 -- (-978.086) (-977.450) (-978.690) [-979.283] * (-977.642) [-980.254] (-978.669) (-980.154) -- 0:00:28 526000 -- (-979.020) (-977.002) (-978.854) [-979.330] * (-976.885) [-977.145] (-979.033) (-977.997) -- 0:00:29 526500 -- (-977.255) (-977.673) [-977.664] (-979.575) * (-980.675) [-977.082] (-978.221) (-980.968) -- 0:00:29 527000 -- (-978.512) (-979.676) [-978.121] (-978.689) * [-978.416] (-977.275) (-978.923) (-977.930) -- 0:00:29 527500 -- [-976.316] (-979.432) (-982.389) (-983.550) * [-978.767] (-977.352) (-978.883) (-979.034) -- 0:00:29 528000 -- [-979.219] (-978.629) (-977.716) (-981.646) * (-977.672) (-978.003) (-978.087) [-978.304] -- 0:00:29 528500 -- (-976.406) (-977.974) [-977.200] (-979.594) * [-980.104] (-978.188) (-978.398) (-977.438) -- 0:00:29 529000 -- (-976.174) [-977.259] (-984.818) (-980.251) * (-978.404) (-977.849) [-978.717] (-982.866) -- 0:00:29 529500 -- [-976.466] (-980.588) (-988.581) (-977.652) * (-977.760) (-978.384) (-979.160) [-977.361] -- 0:00:29 530000 -- (-979.083) (-976.757) (-984.883) [-978.673] * (-977.390) [-978.894] (-976.967) (-978.144) -- 0:00:29 Average standard deviation of split frequencies: 0.012673 530500 -- (-978.853) [-977.801] (-988.635) (-980.854) * (-977.513) [-978.237] (-977.585) (-977.902) -- 0:00:29 531000 -- [-979.653] (-978.033) (-984.088) (-977.149) * (-977.831) [-977.858] (-976.480) (-980.053) -- 0:00:29 531500 -- (-983.750) (-979.717) [-977.493] (-978.873) * [-983.310] (-977.352) (-978.573) (-978.164) -- 0:00:29 532000 -- (-986.210) (-978.918) (-979.160) [-979.318] * (-979.467) (-979.051) (-977.129) [-976.166] -- 0:00:29 532500 -- (-980.308) [-978.685] (-977.524) (-979.359) * (-979.617) (-977.921) [-976.921] (-976.969) -- 0:00:28 533000 -- (-980.213) [-976.729] (-976.873) (-977.717) * (-981.200) (-977.179) [-977.161] (-977.095) -- 0:00:28 533500 -- (-978.417) (-978.729) [-977.032] (-978.008) * (-978.589) (-981.065) [-977.704] (-980.069) -- 0:00:28 534000 -- [-977.430] (-981.812) (-976.735) (-981.304) * [-977.896] (-977.634) (-977.868) (-978.140) -- 0:00:28 534500 -- [-979.428] (-978.008) (-980.815) (-980.300) * (-977.510) (-977.150) (-978.466) [-977.426] -- 0:00:28 535000 -- (-978.606) [-977.626] (-979.102) (-983.223) * (-980.830) (-976.395) (-978.100) [-978.365] -- 0:00:28 Average standard deviation of split frequencies: 0.013134 535500 -- [-979.018] (-978.219) (-978.965) (-978.825) * [-978.832] (-977.012) (-976.504) (-978.297) -- 0:00:28 536000 -- (-977.018) (-978.467) [-978.806] (-979.272) * (-978.698) (-976.887) (-979.765) [-977.607] -- 0:00:28 536500 -- (-984.560) (-981.974) [-977.699] (-977.212) * (-979.630) (-977.117) [-978.971] (-979.587) -- 0:00:28 537000 -- [-976.684] (-979.070) (-977.396) (-976.930) * (-981.875) (-978.168) [-980.311] (-979.732) -- 0:00:28 537500 -- [-979.088] (-977.079) (-977.523) (-977.029) * (-977.973) (-977.937) [-982.883] (-978.013) -- 0:00:28 538000 -- (-977.849) (-977.753) (-976.601) [-979.534] * (-976.633) [-979.601] (-978.107) (-982.063) -- 0:00:28 538500 -- (-984.893) [-979.406] (-976.208) (-977.327) * (-976.158) (-978.031) (-977.117) [-979.101] -- 0:00:28 539000 -- (-977.343) [-981.605] (-976.731) (-976.933) * [-977.875] (-983.311) (-978.116) (-979.640) -- 0:00:28 539500 -- (-976.923) (-976.853) (-977.218) [-977.343] * (-978.242) (-978.181) [-976.711] (-977.945) -- 0:00:28 540000 -- (-976.457) (-976.021) [-978.185] (-977.780) * (-980.435) (-978.100) (-977.494) [-977.539] -- 0:00:28 Average standard deviation of split frequencies: 0.013137 540500 -- (-976.637) (-982.359) [-977.458] (-976.953) * (-980.843) [-977.513] (-977.449) (-981.418) -- 0:00:28 541000 -- (-983.525) [-981.723] (-977.257) (-981.499) * [-982.944] (-977.952) (-977.702) (-980.147) -- 0:00:27 541500 -- (-979.318) (-978.896) [-978.823] (-977.965) * (-976.304) (-981.584) [-978.193] (-977.428) -- 0:00:27 542000 -- [-978.210] (-976.945) (-977.701) (-981.670) * (-979.223) (-980.266) [-977.162] (-980.739) -- 0:00:28 542500 -- (-976.929) [-977.889] (-978.185) (-980.174) * (-977.550) (-979.878) (-978.066) [-979.513] -- 0:00:28 543000 -- [-978.352] (-979.057) (-980.157) (-977.550) * (-977.499) (-980.713) (-976.736) [-976.548] -- 0:00:28 543500 -- [-980.120] (-979.501) (-980.011) (-979.824) * (-979.171) (-976.665) (-977.717) [-976.647] -- 0:00:28 544000 -- (-977.193) (-978.021) (-980.485) [-976.888] * (-976.677) (-977.844) (-978.018) [-976.997] -- 0:00:28 544500 -- (-977.421) (-977.478) [-983.117] (-977.121) * (-980.514) (-981.561) (-978.617) [-976.771] -- 0:00:28 545000 -- (-978.414) (-981.851) [-976.299] (-977.052) * (-980.668) (-979.596) [-977.993] (-976.930) -- 0:00:28 Average standard deviation of split frequencies: 0.012548 545500 -- [-978.624] (-984.054) (-976.624) (-976.174) * (-978.435) (-980.157) (-982.743) [-985.000] -- 0:00:28 546000 -- (-980.448) (-979.731) (-978.075) [-975.882] * [-979.813] (-979.032) (-981.565) (-978.678) -- 0:00:28 546500 -- (-984.534) (-980.805) (-977.094) [-976.573] * (-980.334) [-978.649] (-979.727) (-981.597) -- 0:00:28 547000 -- [-980.803] (-982.562) (-977.312) (-977.578) * [-977.397] (-981.803) (-978.169) (-979.767) -- 0:00:28 547500 -- (-979.203) [-980.499] (-976.461) (-977.910) * (-981.946) (-981.509) [-977.427] (-977.220) -- 0:00:28 548000 -- [-977.740] (-979.529) (-978.929) (-979.872) * (-978.336) [-978.622] (-980.616) (-979.169) -- 0:00:28 548500 -- (-980.145) [-978.293] (-976.828) (-979.500) * (-980.811) [-977.630] (-977.773) (-979.190) -- 0:00:27 549000 -- (-977.687) [-979.008] (-982.657) (-976.399) * (-978.984) (-980.759) [-977.082] (-977.964) -- 0:00:27 549500 -- (-980.174) [-978.371] (-979.496) (-976.750) * (-978.621) (-981.054) (-978.780) [-979.054] -- 0:00:27 550000 -- (-977.433) (-978.119) (-977.695) [-977.203] * (-982.097) [-979.569] (-983.879) (-977.209) -- 0:00:27 Average standard deviation of split frequencies: 0.012156 550500 -- (-977.387) (-979.455) [-977.554] (-976.792) * (-979.294) (-980.101) (-977.939) [-984.508] -- 0:00:27 551000 -- (-978.392) (-982.964) [-977.564] (-979.868) * (-978.790) [-978.565] (-977.341) (-977.698) -- 0:00:27 551500 -- (-979.155) [-980.667] (-987.713) (-976.217) * (-979.052) (-976.792) (-977.841) [-978.546] -- 0:00:27 552000 -- (-981.225) (-976.597) (-978.411) [-976.712] * (-977.601) (-978.857) [-979.240] (-980.194) -- 0:00:27 552500 -- (-980.775) [-978.017] (-978.134) (-987.096) * (-980.094) (-979.486) [-977.268] (-979.149) -- 0:00:27 553000 -- (-977.840) (-977.254) [-978.569] (-981.234) * (-983.045) (-977.667) [-976.750] (-979.884) -- 0:00:27 553500 -- [-977.565] (-977.174) (-977.679) (-978.492) * (-978.062) (-978.327) (-979.001) [-976.805] -- 0:00:27 554000 -- [-976.721] (-978.663) (-983.199) (-978.862) * (-977.085) [-979.975] (-978.930) (-978.781) -- 0:00:27 554500 -- [-977.608] (-977.866) (-980.056) (-977.688) * (-977.598) (-976.051) (-979.354) [-977.484] -- 0:00:27 555000 -- (-978.500) (-981.169) (-978.495) [-979.148] * (-982.356) [-977.425] (-978.510) (-978.828) -- 0:00:27 Average standard deviation of split frequencies: 0.011022 555500 -- [-982.285] (-980.144) (-977.526) (-983.002) * (-977.894) (-978.591) (-977.297) [-977.813] -- 0:00:27 556000 -- (-977.923) (-979.363) [-978.969] (-978.000) * (-981.226) [-980.450] (-979.699) (-977.561) -- 0:00:27 556500 -- (-977.092) (-983.129) [-977.760] (-981.375) * (-980.949) (-978.932) (-983.504) [-977.186] -- 0:00:27 557000 -- (-977.761) [-980.791] (-977.383) (-981.784) * (-977.503) (-979.140) (-980.998) [-976.311] -- 0:00:27 557500 -- (-976.698) (-977.043) [-978.938] (-983.403) * [-977.361] (-981.350) (-976.903) (-977.691) -- 0:00:27 558000 -- (-979.000) (-978.503) [-979.670] (-979.557) * (-977.924) (-978.580) [-980.795] (-977.045) -- 0:00:27 558500 -- (-979.423) (-979.617) (-977.690) [-977.697] * (-976.220) (-976.370) [-977.796] (-981.699) -- 0:00:27 559000 -- (-979.169) (-976.872) [-977.718] (-978.793) * (-982.754) [-978.102] (-978.140) (-982.411) -- 0:00:27 559500 -- (-980.615) (-977.012) [-977.276] (-978.844) * [-977.132] (-977.746) (-978.979) (-979.552) -- 0:00:27 560000 -- [-982.833] (-979.073) (-982.496) (-978.727) * (-979.728) (-979.850) [-976.148] (-978.982) -- 0:00:27 Average standard deviation of split frequencies: 0.011715 560500 -- (-976.600) [-977.285] (-984.043) (-982.579) * (-984.602) (-980.298) [-978.145] (-977.533) -- 0:00:27 561000 -- (-976.084) (-976.689) (-977.416) [-976.006] * (-980.005) (-980.036) [-981.633] (-977.457) -- 0:00:27 561500 -- (-977.124) (-976.294) (-978.908) [-977.633] * [-977.502] (-978.784) (-978.839) (-978.494) -- 0:00:27 562000 -- (-978.048) (-980.442) (-977.810) [-980.115] * (-981.365) [-980.723] (-980.327) (-976.364) -- 0:00:27 562500 -- (-977.698) (-980.158) [-978.653] (-985.697) * (-985.033) [-976.885] (-978.242) (-978.748) -- 0:00:27 563000 -- (-977.301) (-979.623) [-977.631] (-978.758) * (-976.894) (-976.602) [-976.866] (-976.602) -- 0:00:27 563500 -- (-977.168) (-978.291) (-976.340) [-978.468] * [-979.324] (-977.483) (-976.776) (-977.484) -- 0:00:27 564000 -- (-977.244) (-977.070) [-977.417] (-976.661) * (-976.917) (-978.738) [-977.654] (-977.203) -- 0:00:27 564500 -- (-976.377) [-978.500] (-977.855) (-976.669) * (-976.630) (-976.350) [-976.222] (-979.558) -- 0:00:27 565000 -- (-976.936) (-979.503) (-976.589) [-979.515] * [-979.458] (-976.333) (-976.315) (-979.541) -- 0:00:26 Average standard deviation of split frequencies: 0.011272 565500 -- (-980.335) (-977.694) (-980.351) [-980.412] * (-976.513) [-977.044] (-976.690) (-976.376) -- 0:00:26 566000 -- (-978.498) [-978.320] (-981.124) (-977.215) * (-980.965) [-980.952] (-983.244) (-978.628) -- 0:00:26 566500 -- [-978.460] (-976.801) (-979.795) (-977.231) * [-979.219] (-979.027) (-985.030) (-978.433) -- 0:00:26 567000 -- (-978.278) (-977.098) (-978.201) [-976.195] * (-977.824) (-976.291) (-978.321) [-978.106] -- 0:00:26 567500 -- (-976.906) (-977.320) (-978.288) [-977.974] * (-976.989) (-977.530) (-979.245) [-977.119] -- 0:00:26 568000 -- (-977.802) (-979.153) [-980.008] (-978.665) * (-977.545) (-976.784) [-980.588] (-979.401) -- 0:00:26 568500 -- (-977.797) (-979.550) (-981.651) [-978.043] * (-979.931) [-976.944] (-978.425) (-981.056) -- 0:00:26 569000 -- (-979.926) [-978.494] (-982.342) (-977.872) * (-979.714) (-977.212) [-978.500] (-978.034) -- 0:00:26 569500 -- (-980.636) (-982.499) (-979.191) [-980.307] * (-977.580) (-976.342) [-980.223] (-980.122) -- 0:00:26 570000 -- (-977.710) (-977.846) (-986.906) [-978.562] * (-980.233) (-977.745) [-977.429] (-978.829) -- 0:00:26 Average standard deviation of split frequencies: 0.010849 570500 -- (-978.074) (-984.523) (-978.591) [-976.801] * (-976.906) [-980.069] (-980.139) (-976.415) -- 0:00:26 571000 -- (-978.197) (-977.764) (-979.837) [-977.640] * (-978.234) (-976.879) (-980.827) [-977.656] -- 0:00:26 571500 -- (-980.142) (-979.530) [-978.493] (-977.829) * (-981.999) (-977.158) (-980.874) [-976.205] -- 0:00:26 572000 -- [-980.368] (-976.766) (-980.057) (-978.566) * (-978.639) (-977.369) (-976.456) [-977.128] -- 0:00:26 572500 -- [-980.184] (-977.280) (-976.031) (-977.845) * (-980.094) (-979.811) [-977.471] (-980.726) -- 0:00:26 573000 -- (-978.275) (-978.067) [-976.962] (-976.197) * (-978.768) (-977.039) [-977.045] (-979.424) -- 0:00:26 573500 -- [-976.965] (-975.776) (-976.399) (-977.815) * [-979.039] (-977.615) (-976.149) (-977.843) -- 0:00:26 574000 -- [-979.018] (-977.857) (-977.004) (-976.808) * (-976.697) (-977.989) (-978.897) [-977.058] -- 0:00:26 574500 -- (-980.400) (-976.496) (-979.565) [-978.051] * (-976.947) [-977.723] (-980.847) (-977.475) -- 0:00:26 575000 -- (-977.440) (-976.401) [-979.808] (-982.257) * (-977.716) (-977.640) [-980.297] (-978.500) -- 0:00:26 Average standard deviation of split frequencies: 0.010148 575500 -- (-979.780) (-977.493) [-980.701] (-978.092) * (-979.766) [-977.726] (-977.023) (-976.568) -- 0:00:26 576000 -- (-977.660) [-979.388] (-980.893) (-978.197) * (-981.707) (-978.962) (-976.685) [-978.071] -- 0:00:26 576500 -- (-977.235) [-978.913] (-980.792) (-979.070) * (-983.842) [-979.411] (-978.700) (-983.651) -- 0:00:26 577000 -- [-978.778] (-977.801) (-981.241) (-981.059) * (-981.579) (-978.578) (-977.223) [-981.156] -- 0:00:26 577500 -- (-976.663) (-980.463) [-979.291] (-981.964) * (-978.327) [-976.893] (-978.139) (-981.438) -- 0:00:26 578000 -- (-977.179) [-978.127] (-979.226) (-983.204) * [-976.843] (-979.735) (-978.546) (-979.807) -- 0:00:26 578500 -- (-977.956) [-976.930] (-978.589) (-977.196) * (-977.958) (-978.647) (-978.450) [-978.023] -- 0:00:26 579000 -- (-979.590) (-981.708) (-976.989) [-977.237] * (-980.204) [-979.839] (-979.763) (-977.827) -- 0:00:26 579500 -- (-977.371) (-977.620) [-979.383] (-980.966) * (-977.869) [-977.205] (-977.545) (-978.043) -- 0:00:26 580000 -- (-977.618) [-976.681] (-977.896) (-980.490) * (-976.146) (-977.369) (-978.478) [-981.347] -- 0:00:26 Average standard deviation of split frequencies: 0.010283 580500 -- (-981.723) (-977.576) [-978.418] (-979.105) * (-976.105) (-978.439) [-977.341] (-981.475) -- 0:00:26 581000 -- [-976.916] (-978.622) (-979.374) (-978.966) * (-981.047) (-980.421) [-980.211] (-981.143) -- 0:00:25 581500 -- (-976.991) (-977.318) [-976.682] (-981.453) * (-976.776) [-977.243] (-978.226) (-981.363) -- 0:00:25 582000 -- [-977.610] (-976.592) (-977.042) (-981.881) * (-975.907) [-978.579] (-978.239) (-980.309) -- 0:00:25 582500 -- (-980.108) [-978.677] (-976.621) (-977.435) * (-975.900) (-980.276) [-978.174] (-979.161) -- 0:00:25 583000 -- (-977.927) (-980.213) (-977.744) [-977.933] * (-976.586) (-980.715) (-978.143) [-977.014] -- 0:00:25 583500 -- (-980.156) [-978.514] (-979.777) (-977.703) * (-977.568) [-979.210] (-979.403) (-979.883) -- 0:00:25 584000 -- (-976.925) (-978.779) [-977.370] (-979.732) * [-977.760] (-983.259) (-978.048) (-983.275) -- 0:00:25 584500 -- (-977.667) (-980.124) [-976.870] (-985.909) * (-979.923) [-977.806] (-982.101) (-981.140) -- 0:00:25 585000 -- (-976.358) [-979.060] (-977.255) (-977.397) * [-978.333] (-978.147) (-982.523) (-982.102) -- 0:00:25 Average standard deviation of split frequencies: 0.010257 585500 -- (-978.759) (-979.355) [-977.669] (-978.551) * [-980.577] (-977.168) (-978.851) (-979.277) -- 0:00:25 586000 -- (-979.192) (-978.710) (-977.774) [-978.389] * (-978.679) (-978.293) (-983.214) [-979.184] -- 0:00:25 586500 -- (-981.707) (-979.383) (-979.478) [-979.308] * (-979.885) (-978.473) [-980.276] (-980.674) -- 0:00:25 587000 -- (-980.011) (-977.867) (-977.559) [-978.436] * (-980.133) [-979.203] (-979.101) (-980.490) -- 0:00:25 587500 -- (-979.010) [-976.966] (-981.875) (-977.500) * (-976.576) (-978.656) (-979.415) [-978.913] -- 0:00:25 588000 -- [-977.473] (-980.516) (-979.504) (-978.424) * (-976.473) (-979.002) (-980.442) [-978.943] -- 0:00:25 588500 -- [-979.335] (-978.477) (-978.625) (-976.127) * (-976.504) (-978.900) [-984.196] (-977.550) -- 0:00:25 589000 -- (-976.754) [-979.687] (-976.676) (-977.840) * (-976.377) (-979.455) [-977.557] (-976.967) -- 0:00:25 589500 -- (-978.020) [-983.150] (-980.185) (-978.165) * (-979.148) (-978.178) (-978.296) [-980.586] -- 0:00:25 590000 -- [-976.472] (-979.844) (-980.912) (-979.106) * (-977.690) (-978.632) [-977.320] (-976.842) -- 0:00:25 Average standard deviation of split frequencies: 0.009417 590500 -- (-986.784) [-977.933] (-979.718) (-980.652) * [-976.823] (-979.393) (-980.468) (-979.430) -- 0:00:25 591000 -- (-985.087) [-977.042] (-977.345) (-981.840) * [-977.792] (-982.959) (-977.900) (-976.869) -- 0:00:25 591500 -- [-980.411] (-977.311) (-977.852) (-978.798) * (-977.397) [-978.021] (-977.954) (-980.223) -- 0:00:25 592000 -- [-976.923] (-978.492) (-976.362) (-976.284) * (-981.131) [-978.885] (-978.076) (-976.377) -- 0:00:25 592500 -- [-979.342] (-977.485) (-978.006) (-977.496) * (-982.604) [-977.693] (-976.642) (-982.065) -- 0:00:25 593000 -- (-977.516) (-979.953) (-979.552) [-979.256] * (-978.212) (-979.145) [-977.181] (-979.529) -- 0:00:25 593500 -- (-977.082) [-980.767] (-978.918) (-979.843) * [-976.541] (-976.320) (-979.641) (-977.631) -- 0:00:25 594000 -- (-981.031) (-978.640) [-977.682] (-976.357) * (-976.742) [-977.073] (-979.021) (-977.635) -- 0:00:25 594500 -- [-976.825] (-978.517) (-981.629) (-977.190) * [-976.422] (-976.639) (-979.516) (-977.511) -- 0:00:25 595000 -- (-976.763) (-979.040) [-977.980] (-976.502) * (-976.646) (-981.154) [-978.271] (-977.723) -- 0:00:25 Average standard deviation of split frequencies: 0.010035 595500 -- (-978.913) (-979.174) [-979.121] (-976.813) * (-980.820) (-977.582) (-978.027) [-978.668] -- 0:00:25 596000 -- (-976.960) [-976.844] (-978.328) (-977.221) * (-978.906) [-978.040] (-981.063) (-980.074) -- 0:00:25 596500 -- [-977.761] (-979.711) (-977.732) (-980.241) * (-981.734) (-977.600) (-979.990) [-982.827] -- 0:00:25 597000 -- (-978.074) (-976.269) (-977.346) [-977.241] * (-980.302) (-980.138) (-983.441) [-977.761] -- 0:00:24 597500 -- [-977.619] (-976.989) (-976.800) (-976.364) * [-977.753] (-978.159) (-978.632) (-980.435) -- 0:00:24 598000 -- (-983.103) (-980.567) (-980.908) [-978.126] * (-976.884) (-978.648) [-981.810] (-979.411) -- 0:00:24 598500 -- (-978.651) (-979.622) (-980.929) [-979.611] * (-980.032) (-981.474) (-983.018) [-976.301] -- 0:00:24 599000 -- (-978.694) (-979.676) (-982.648) [-976.333] * (-980.114) [-976.319] (-977.581) (-981.368) -- 0:00:24 599500 -- (-977.707) (-983.909) (-978.888) [-978.305] * [-981.065] (-979.295) (-977.846) (-980.181) -- 0:00:24 600000 -- (-976.848) (-978.568) [-978.076] (-982.098) * (-982.063) [-983.445] (-982.450) (-976.803) -- 0:00:24 Average standard deviation of split frequencies: 0.009261 600500 -- (-978.992) (-979.548) [-978.856] (-977.871) * (-976.811) [-978.884] (-977.444) (-985.003) -- 0:00:24 601000 -- [-979.503] (-980.566) (-979.911) (-977.793) * [-977.658] (-980.356) (-986.202) (-977.077) -- 0:00:24 601500 -- (-981.142) [-977.632] (-977.916) (-977.223) * (-983.746) [-976.807] (-979.143) (-978.165) -- 0:00:24 602000 -- [-976.736] (-978.753) (-978.115) (-978.500) * (-983.459) (-981.949) [-980.201] (-980.215) -- 0:00:24 602500 -- (-979.311) [-978.746] (-979.757) (-980.742) * [-976.786] (-978.819) (-979.830) (-978.321) -- 0:00:24 603000 -- (-979.226) (-983.144) (-979.873) [-977.676] * (-986.037) [-979.505] (-979.736) (-978.358) -- 0:00:24 603500 -- [-976.719] (-985.406) (-977.220) (-984.309) * (-977.583) (-976.510) [-976.188] (-979.450) -- 0:00:24 604000 -- (-976.452) (-987.288) (-976.674) [-978.866] * [-976.121] (-977.962) (-977.235) (-976.430) -- 0:00:24 604500 -- [-978.033] (-976.783) (-976.314) (-978.193) * (-977.197) [-980.336] (-977.375) (-978.959) -- 0:00:24 605000 -- (-976.859) [-979.327] (-977.875) (-980.593) * (-978.463) (-979.272) [-980.249] (-981.843) -- 0:00:24 Average standard deviation of split frequencies: 0.009140 605500 -- (-976.136) (-978.535) [-978.711] (-978.027) * (-976.115) (-979.916) [-976.435] (-978.886) -- 0:00:24 606000 -- (-979.986) (-977.389) [-976.383] (-976.032) * (-977.624) (-977.737) (-978.464) [-976.564] -- 0:00:24 606500 -- (-979.337) (-978.035) (-978.116) [-976.182] * (-976.971) [-977.144] (-977.211) (-981.571) -- 0:00:24 607000 -- [-980.648] (-979.191) (-978.312) (-979.948) * (-977.273) (-978.055) [-979.903] (-983.543) -- 0:00:24 607500 -- (-983.713) (-977.205) (-977.611) [-979.204] * (-977.727) (-980.172) [-980.804] (-978.752) -- 0:00:24 608000 -- (-978.974) (-982.509) (-977.624) [-980.073] * (-979.189) (-978.865) (-980.312) [-977.203] -- 0:00:24 608500 -- [-977.685] (-980.623) (-976.219) (-979.195) * (-977.589) (-977.477) (-981.644) [-976.765] -- 0:00:24 609000 -- [-981.033] (-984.896) (-980.839) (-979.827) * (-976.502) (-981.074) [-977.181] (-981.289) -- 0:00:24 609500 -- (-979.077) [-980.115] (-976.817) (-978.000) * (-978.524) (-980.385) (-977.203) [-979.036] -- 0:00:24 610000 -- (-978.150) [-977.693] (-978.779) (-981.539) * (-980.508) (-980.328) [-978.193] (-978.771) -- 0:00:24 Average standard deviation of split frequencies: 0.009006 610500 -- (-977.804) [-977.270] (-981.864) (-976.727) * (-977.201) (-981.768) [-977.120] (-980.951) -- 0:00:24 611000 -- (-979.416) [-978.092] (-980.052) (-978.302) * (-977.004) (-981.144) [-978.469] (-977.956) -- 0:00:24 611500 -- (-977.353) (-976.715) (-984.681) [-979.346] * (-979.413) [-978.528] (-977.509) (-976.299) -- 0:00:24 612000 -- [-978.311] (-979.107) (-979.258) (-978.023) * (-981.117) [-978.122] (-977.589) (-980.711) -- 0:00:24 612500 -- (-978.244) [-980.913] (-980.868) (-979.407) * (-977.727) (-980.337) (-979.541) [-977.745] -- 0:00:24 613000 -- [-978.303] (-979.904) (-979.358) (-979.593) * (-977.309) (-976.165) [-977.877] (-978.253) -- 0:00:23 613500 -- [-978.471] (-979.080) (-982.963) (-977.070) * (-978.329) (-976.942) [-976.230] (-977.597) -- 0:00:23 614000 -- [-977.550] (-978.658) (-981.061) (-979.512) * (-980.014) [-977.832] (-977.145) (-978.153) -- 0:00:23 614500 -- [-977.308] (-978.559) (-981.434) (-977.372) * (-978.483) (-978.852) (-979.887) [-976.450] -- 0:00:23 615000 -- (-979.129) (-976.403) [-977.367] (-978.278) * (-977.695) [-979.654] (-977.712) (-976.953) -- 0:00:23 Average standard deviation of split frequencies: 0.009438 615500 -- (-980.159) (-976.787) [-980.372] (-977.878) * (-976.231) (-977.543) (-979.641) [-977.110] -- 0:00:23 616000 -- (-978.421) (-977.335) (-977.998) [-978.681] * (-978.190) (-977.429) (-977.104) [-976.583] -- 0:00:23 616500 -- (-978.326) [-978.615] (-980.595) (-976.886) * (-979.545) [-978.497] (-976.483) (-979.605) -- 0:00:23 617000 -- [-979.347] (-977.019) (-979.219) (-977.986) * (-977.005) (-979.916) [-978.336] (-978.223) -- 0:00:23 617500 -- (-977.092) [-980.023] (-977.135) (-977.986) * (-977.581) [-979.666] (-977.669) (-977.914) -- 0:00:23 618000 -- (-977.929) (-977.016) (-979.922) [-976.280] * (-980.209) [-983.488] (-978.310) (-977.021) -- 0:00:23 618500 -- (-977.993) (-976.851) [-977.432] (-978.307) * [-980.831] (-978.061) (-980.905) (-978.535) -- 0:00:23 619000 -- (-984.054) (-979.637) (-976.504) [-976.278] * [-977.938] (-977.907) (-978.866) (-977.840) -- 0:00:23 619500 -- (-977.413) (-980.639) (-977.126) [-978.821] * (-977.422) [-976.506] (-978.477) (-977.150) -- 0:00:23 620000 -- (-979.950) (-978.804) (-977.084) [-977.494] * (-977.540) (-982.861) (-981.973) [-978.242] -- 0:00:23 Average standard deviation of split frequencies: 0.009367 620500 -- [-979.062] (-977.718) (-978.017) (-977.897) * (-981.371) (-979.125) [-976.800] (-978.518) -- 0:00:23 621000 -- (-977.990) (-977.160) [-977.198] (-976.771) * (-980.332) [-978.927] (-977.369) (-979.368) -- 0:00:23 621500 -- (-979.245) [-977.739] (-978.978) (-981.772) * (-979.191) [-979.095] (-977.788) (-975.997) -- 0:00:23 622000 -- (-979.357) (-980.382) (-978.441) [-978.138] * (-978.310) (-978.578) [-976.477] (-976.361) -- 0:00:23 622500 -- (-976.868) (-978.557) (-978.884) [-977.574] * [-978.585] (-977.506) (-978.200) (-979.823) -- 0:00:23 623000 -- (-978.014) (-981.262) (-987.637) [-977.028] * (-978.885) (-976.009) [-976.630] (-979.249) -- 0:00:23 623500 -- [-976.744] (-978.409) (-980.621) (-977.609) * (-980.134) (-979.799) [-977.653] (-978.933) -- 0:00:23 624000 -- (-976.808) (-978.399) [-977.510] (-979.644) * (-980.394) [-976.892] (-986.837) (-977.838) -- 0:00:23 624500 -- [-977.940] (-979.270) (-977.480) (-979.334) * [-978.113] (-976.801) (-978.548) (-978.196) -- 0:00:23 625000 -- (-977.979) (-979.089) [-978.294] (-977.067) * (-979.472) (-978.688) [-978.281] (-980.918) -- 0:00:23 Average standard deviation of split frequencies: 0.009388 625500 -- [-978.047] (-978.307) (-978.074) (-977.874) * [-977.481] (-979.890) (-977.921) (-980.425) -- 0:00:23 626000 -- (-976.293) (-979.353) [-978.965] (-977.631) * (-978.993) (-979.848) (-982.745) [-977.379] -- 0:00:23 626500 -- (-976.728) [-980.089] (-977.256) (-978.065) * (-979.692) (-976.985) [-976.631] (-977.646) -- 0:00:23 627000 -- [-978.494] (-976.385) (-979.338) (-979.985) * (-979.190) (-976.372) [-977.689] (-982.611) -- 0:00:23 627500 -- (-984.096) (-976.620) (-979.959) [-977.873] * (-977.095) [-978.423] (-986.528) (-977.390) -- 0:00:23 628000 -- [-980.580] (-978.606) (-981.231) (-984.612) * (-978.517) (-977.495) [-980.323] (-978.725) -- 0:00:23 628500 -- (-979.314) (-979.345) (-980.880) [-981.691] * [-976.644] (-976.958) (-978.512) (-982.536) -- 0:00:23 629000 -- (-982.737) [-979.933] (-979.194) (-981.036) * (-977.576) (-978.938) [-978.726] (-976.596) -- 0:00:23 629500 -- (-980.143) [-979.761] (-981.480) (-977.829) * (-977.758) (-976.885) (-978.385) [-981.313] -- 0:00:22 630000 -- (-982.578) (-977.360) [-978.607] (-976.669) * (-978.122) (-979.420) [-976.948] (-977.057) -- 0:00:22 Average standard deviation of split frequencies: 0.009219 630500 -- (-980.088) (-978.155) [-977.551] (-978.046) * (-978.342) [-979.270] (-979.739) (-979.404) -- 0:00:22 631000 -- [-976.785] (-981.314) (-978.769) (-981.525) * (-979.316) (-979.474) [-979.648] (-980.930) -- 0:00:22 631500 -- (-981.980) (-979.074) (-978.695) [-976.841] * [-977.647] (-988.067) (-978.534) (-978.360) -- 0:00:22 632000 -- (-981.185) (-976.579) (-980.757) [-976.686] * [-978.069] (-984.207) (-983.375) (-976.740) -- 0:00:22 632500 -- (-984.507) [-979.116] (-978.447) (-980.867) * (-979.284) [-979.387] (-979.518) (-977.503) -- 0:00:22 633000 -- [-978.023] (-978.312) (-979.178) (-981.022) * [-979.231] (-978.307) (-977.706) (-980.043) -- 0:00:22 633500 -- (-976.305) [-977.224] (-978.369) (-982.005) * (-976.728) [-976.843] (-976.276) (-980.944) -- 0:00:22 634000 -- [-976.092] (-976.381) (-976.615) (-978.473) * (-977.932) (-979.164) (-976.300) [-977.272] -- 0:00:22 634500 -- (-976.083) (-979.908) [-978.052] (-976.986) * (-987.305) (-980.350) (-977.697) [-976.730] -- 0:00:22 635000 -- (-977.411) (-983.657) [-977.155] (-979.431) * (-980.321) (-976.871) [-976.977] (-977.720) -- 0:00:22 Average standard deviation of split frequencies: 0.009191 635500 -- (-980.648) [-979.526] (-976.238) (-977.552) * (-981.038) (-978.075) [-978.050] (-978.124) -- 0:00:22 636000 -- (-978.378) (-978.719) [-977.950] (-976.821) * (-980.668) (-978.666) (-978.827) [-982.919] -- 0:00:22 636500 -- (-980.866) [-977.921] (-976.858) (-976.280) * [-977.617] (-982.291) (-977.220) (-977.435) -- 0:00:22 637000 -- [-980.050] (-982.118) (-980.867) (-978.295) * (-977.515) [-977.981] (-977.507) (-976.843) -- 0:00:22 637500 -- (-980.161) (-977.675) (-980.111) [-978.456] * (-976.506) (-978.103) (-977.499) [-976.402] -- 0:00:22 638000 -- (-980.088) (-977.914) (-978.887) [-976.339] * [-976.361] (-977.021) (-980.456) (-977.846) -- 0:00:22 638500 -- (-977.389) (-976.827) [-976.928] (-980.014) * (-977.550) [-978.606] (-977.052) (-978.102) -- 0:00:22 639000 -- (-977.972) [-979.225] (-977.176) (-979.779) * (-977.890) [-976.681] (-976.296) (-978.871) -- 0:00:22 639500 -- (-976.944) [-981.680] (-978.651) (-978.043) * (-979.783) [-978.173] (-978.620) (-979.438) -- 0:00:22 640000 -- (-978.868) (-980.312) [-978.261] (-977.962) * (-978.168) (-978.698) [-980.315] (-978.718) -- 0:00:22 Average standard deviation of split frequencies: 0.009473 640500 -- (-977.113) (-981.740) (-977.932) [-977.415] * [-977.461] (-977.616) (-978.301) (-978.202) -- 0:00:22 641000 -- (-979.975) (-987.308) (-977.305) [-979.093] * [-977.561] (-978.365) (-979.003) (-980.217) -- 0:00:22 641500 -- [-976.530] (-977.747) (-977.401) (-980.153) * (-977.804) [-977.528] (-978.687) (-976.997) -- 0:00:22 642000 -- [-976.287] (-980.498) (-977.727) (-980.151) * (-982.380) (-980.487) [-978.029] (-979.041) -- 0:00:22 642500 -- (-976.822) (-979.811) (-983.354) [-977.979] * (-978.245) [-976.811] (-976.596) (-979.750) -- 0:00:22 643000 -- [-976.371] (-982.855) (-980.601) (-978.457) * [-978.514] (-978.724) (-980.160) (-980.488) -- 0:00:22 643500 -- [-977.151] (-980.006) (-978.573) (-980.582) * (-976.914) [-979.554] (-979.336) (-979.479) -- 0:00:22 644000 -- (-981.490) (-981.163) (-979.654) [-980.871] * [-977.585] (-977.665) (-977.939) (-980.854) -- 0:00:22 644500 -- [-980.773] (-979.476) (-977.240) (-976.424) * (-976.457) [-977.625] (-978.928) (-980.688) -- 0:00:22 645000 -- (-980.201) (-976.439) [-976.501] (-979.924) * (-977.138) [-977.521] (-977.272) (-977.514) -- 0:00:22 Average standard deviation of split frequencies: 0.009304 645500 -- (-978.362) [-978.226] (-981.231) (-977.632) * [-977.425] (-977.388) (-976.929) (-977.285) -- 0:00:21 646000 -- [-980.859] (-977.978) (-976.367) (-983.513) * (-978.733) (-979.055) (-977.191) [-976.797] -- 0:00:21 646500 -- (-976.792) [-979.078] (-978.321) (-979.580) * (-977.252) (-979.326) (-979.780) [-976.613] -- 0:00:21 647000 -- (-977.210) [-978.923] (-979.401) (-978.125) * (-977.791) (-980.802) [-978.037] (-979.182) -- 0:00:21 647500 -- (-980.132) (-979.262) [-977.342] (-978.901) * [-976.349] (-979.709) (-981.286) (-980.886) -- 0:00:21 648000 -- (-977.570) (-977.407) [-976.637] (-977.339) * (-976.398) (-977.049) (-980.188) [-983.344] -- 0:00:21 648500 -- (-979.538) [-977.350] (-978.478) (-977.752) * (-979.002) [-979.435] (-980.448) (-977.981) -- 0:00:21 649000 -- (-986.391) [-977.599] (-976.674) (-977.801) * (-977.206) [-980.431] (-978.269) (-982.598) -- 0:00:21 649500 -- (-977.775) [-978.020] (-976.364) (-978.119) * (-977.698) [-978.537] (-978.558) (-987.415) -- 0:00:21 650000 -- (-977.988) [-976.446] (-978.754) (-977.618) * (-979.176) (-981.904) [-976.660] (-979.806) -- 0:00:21 Average standard deviation of split frequencies: 0.009373 650500 -- [-978.165] (-976.393) (-977.786) (-978.076) * (-978.607) [-977.385] (-976.808) (-978.318) -- 0:00:21 651000 -- (-980.318) (-978.342) [-979.226] (-978.323) * (-979.467) [-979.149] (-978.579) (-976.503) -- 0:00:21 651500 -- (-978.775) [-977.668] (-978.998) (-979.284) * (-978.400) (-976.177) [-978.307] (-976.463) -- 0:00:21 652000 -- (-979.407) (-982.739) [-977.291] (-977.154) * (-977.160) [-978.543] (-976.996) (-977.518) -- 0:00:21 652500 -- (-977.543) (-983.324) (-979.013) [-977.394] * (-980.140) (-981.142) (-978.323) [-977.243] -- 0:00:21 653000 -- [-978.481] (-980.004) (-981.213) (-976.814) * (-977.606) (-976.306) [-976.615] (-976.329) -- 0:00:21 653500 -- (-977.409) [-977.989] (-979.143) (-981.479) * (-982.461) (-986.722) [-976.405] (-977.483) -- 0:00:21 654000 -- [-982.165] (-977.669) (-977.713) (-979.422) * (-982.862) (-977.054) (-976.461) [-977.806] -- 0:00:21 654500 -- (-981.633) [-976.584] (-980.945) (-987.535) * (-981.822) (-977.317) [-976.375] (-977.261) -- 0:00:21 655000 -- (-978.180) (-977.580) [-979.538] (-979.384) * (-977.144) (-978.103) (-979.265) [-978.384] -- 0:00:21 Average standard deviation of split frequencies: 0.009486 655500 -- (-981.778) (-980.226) [-979.767] (-980.128) * [-976.320] (-977.824) (-983.467) (-976.070) -- 0:00:21 656000 -- [-977.233] (-979.778) (-977.428) (-976.378) * (-980.916) [-980.678] (-978.902) (-978.182) -- 0:00:21 656500 -- [-977.658] (-977.897) (-980.721) (-978.749) * (-977.678) [-976.438] (-976.418) (-976.484) -- 0:00:21 657000 -- (-977.172) (-982.365) (-979.444) [-980.110] * (-977.036) (-976.885) [-976.051] (-976.622) -- 0:00:21 657500 -- [-975.997] (-978.987) (-979.017) (-977.143) * (-976.873) (-976.623) [-976.962] (-978.368) -- 0:00:21 658000 -- (-979.327) (-983.064) (-976.806) [-976.221] * (-978.361) (-977.317) (-977.908) [-979.268] -- 0:00:21 658500 -- [-980.772] (-982.283) (-978.715) (-977.304) * [-978.299] (-978.204) (-977.336) (-980.383) -- 0:00:21 659000 -- (-980.041) (-978.070) (-977.128) [-976.557] * (-976.987) (-983.317) [-977.201] (-978.718) -- 0:00:21 659500 -- (-978.165) (-977.167) (-978.003) [-977.104] * [-977.276] (-978.607) (-978.341) (-979.471) -- 0:00:21 660000 -- (-978.064) (-977.252) (-978.002) [-976.277] * (-981.032) (-979.518) (-979.603) [-980.263] -- 0:00:21 Average standard deviation of split frequencies: 0.009181 660500 -- (-981.103) (-977.850) (-978.892) [-976.451] * [-980.026] (-981.344) (-978.808) (-976.222) -- 0:00:21 661000 -- (-981.163) (-981.331) (-980.216) [-976.867] * [-978.808] (-977.829) (-978.680) (-978.566) -- 0:00:21 661500 -- (-979.943) (-979.279) (-977.168) [-981.229] * (-978.467) (-976.675) [-982.667] (-982.846) -- 0:00:20 662000 -- [-978.949] (-980.925) (-984.079) (-980.320) * (-977.323) [-979.535] (-984.864) (-982.707) -- 0:00:20 662500 -- (-978.458) (-978.892) [-979.130] (-976.926) * (-976.861) [-978.911] (-980.976) (-980.107) -- 0:00:20 663000 -- [-978.095] (-976.149) (-976.878) (-976.499) * [-978.352] (-976.240) (-979.093) (-977.983) -- 0:00:20 663500 -- (-979.498) [-977.145] (-978.738) (-978.117) * (-977.236) [-978.131] (-980.734) (-977.052) -- 0:00:20 664000 -- (-978.456) (-977.737) (-981.258) [-976.015] * [-976.766] (-981.874) (-979.108) (-976.337) -- 0:00:20 664500 -- (-976.274) (-977.300) [-976.850] (-977.649) * [-976.843] (-977.932) (-980.521) (-978.125) -- 0:00:20 665000 -- (-976.305) (-978.145) [-977.384] (-976.653) * (-980.243) (-979.718) [-980.927] (-976.726) -- 0:00:20 Average standard deviation of split frequencies: 0.009154 665500 -- (-977.491) [-980.158] (-976.927) (-983.147) * (-977.229) (-984.617) (-984.706) [-976.920] -- 0:00:20 666000 -- (-977.672) [-977.453] (-980.283) (-981.543) * (-976.402) (-980.451) (-980.777) [-976.512] -- 0:00:20 666500 -- (-977.356) [-981.824] (-977.892) (-977.381) * [-978.569] (-976.554) (-985.820) (-976.605) -- 0:00:20 667000 -- (-977.176) (-981.182) (-976.531) [-976.305] * (-976.706) (-976.495) (-979.822) [-976.405] -- 0:00:20 667500 -- (-975.956) (-979.700) (-976.315) [-980.711] * (-978.290) (-976.468) [-977.133] (-977.487) -- 0:00:20 668000 -- (-982.899) (-980.767) (-980.876) [-980.069] * (-977.724) (-979.711) (-976.743) [-976.660] -- 0:00:20 668500 -- [-977.487] (-977.017) (-981.529) (-977.309) * (-977.425) (-979.859) [-978.849] (-978.650) -- 0:00:20 669000 -- (-977.618) [-979.195] (-979.110) (-978.854) * [-976.837] (-980.357) (-978.111) (-977.989) -- 0:00:20 669500 -- (-977.188) (-978.836) [-977.330] (-981.590) * (-977.499) (-980.282) [-976.395] (-980.909) -- 0:00:20 670000 -- (-978.115) (-978.686) (-977.166) [-976.205] * (-978.986) (-984.971) (-977.844) [-978.254] -- 0:00:20 Average standard deviation of split frequencies: 0.009700 670500 -- (-981.146) (-977.369) [-975.994] (-977.004) * (-976.693) [-977.346] (-976.857) (-982.112) -- 0:00:20 671000 -- [-978.346] (-978.779) (-977.545) (-977.974) * (-977.451) (-981.684) [-979.564] (-983.233) -- 0:00:20 671500 -- (-979.245) (-976.453) (-977.343) [-976.543] * (-978.190) [-981.381] (-980.250) (-977.998) -- 0:00:20 672000 -- [-976.672] (-979.307) (-979.429) (-977.923) * (-980.117) [-980.844] (-976.879) (-978.577) -- 0:00:20 672500 -- (-979.863) (-978.391) [-978.878] (-977.403) * (-978.078) (-984.067) [-976.791] (-978.220) -- 0:00:20 673000 -- (-980.323) (-978.954) [-978.841] (-978.955) * (-977.032) (-976.781) [-977.738] (-980.011) -- 0:00:20 673500 -- [-977.403] (-977.718) (-980.300) (-978.812) * (-978.335) [-979.639] (-976.323) (-978.157) -- 0:00:20 674000 -- (-978.835) [-978.019] (-978.484) (-985.287) * (-981.103) (-985.688) [-980.953] (-979.260) -- 0:00:20 674500 -- [-977.124] (-983.181) (-979.080) (-980.228) * (-983.175) (-982.170) [-976.878] (-976.363) -- 0:00:20 675000 -- (-977.945) (-978.683) [-980.675] (-979.667) * (-981.370) (-979.108) [-979.098] (-978.813) -- 0:00:20 Average standard deviation of split frequencies: 0.009484 675500 -- (-979.238) (-976.482) [-978.671] (-978.369) * (-978.269) (-978.086) (-976.538) [-977.619] -- 0:00:20 676000 -- (-979.164) (-977.502) [-976.020] (-976.341) * (-977.501) [-977.444] (-980.583) (-976.923) -- 0:00:20 676500 -- (-980.142) [-977.251] (-977.402) (-977.165) * (-977.386) [-979.839] (-977.389) (-977.480) -- 0:00:20 677000 -- (-980.596) [-979.468] (-979.831) (-978.526) * (-979.989) [-977.211] (-980.163) (-977.431) -- 0:00:20 677500 -- [-978.621] (-979.402) (-977.507) (-976.878) * (-978.733) [-977.727] (-981.551) (-975.916) -- 0:00:19 678000 -- (-977.592) (-979.876) (-976.279) [-977.202] * (-976.996) [-977.440] (-977.465) (-979.671) -- 0:00:19 678500 -- (-977.807) (-978.449) (-977.819) [-980.570] * (-982.164) (-977.670) (-977.009) [-978.576] -- 0:00:19 679000 -- (-977.436) [-983.069] (-980.950) (-980.783) * (-978.224) (-988.145) (-979.266) [-978.018] -- 0:00:19 679500 -- (-976.866) [-978.287] (-978.703) (-977.394) * (-977.711) (-981.686) (-979.484) [-977.343] -- 0:00:19 680000 -- (-978.557) (-978.141) (-979.325) [-978.152] * (-981.092) (-978.485) (-979.273) [-978.806] -- 0:00:19 Average standard deviation of split frequencies: 0.009327 680500 -- [-981.851] (-976.541) (-977.605) (-976.772) * (-978.502) (-978.077) [-980.053] (-979.220) -- 0:00:19 681000 -- (-976.587) (-977.640) [-977.608] (-978.543) * (-978.678) (-979.013) [-977.175] (-977.979) -- 0:00:19 681500 -- [-977.985] (-978.249) (-983.433) (-979.430) * (-977.613) (-980.675) (-977.463) [-977.994] -- 0:00:19 682000 -- (-978.583) (-978.816) (-979.555) [-979.104] * (-977.778) (-980.717) [-982.669] (-977.003) -- 0:00:19 682500 -- (-983.144) (-976.045) [-976.941] (-977.421) * [-978.484] (-977.533) (-976.541) (-977.244) -- 0:00:19 683000 -- (-976.084) (-979.295) (-977.483) [-977.335] * (-979.195) (-980.599) [-976.022] (-977.195) -- 0:00:19 683500 -- (-979.450) (-978.761) [-976.850] (-980.880) * (-977.385) (-980.658) (-977.032) [-976.733] -- 0:00:19 684000 -- [-977.278] (-978.593) (-978.331) (-979.016) * (-976.053) (-980.099) (-979.259) [-976.180] -- 0:00:19 684500 -- (-981.684) (-978.631) [-978.193] (-976.099) * [-977.819] (-977.866) (-977.201) (-978.435) -- 0:00:19 685000 -- (-977.693) [-979.866] (-978.184) (-977.822) * [-978.465] (-979.214) (-976.117) (-978.853) -- 0:00:19 Average standard deviation of split frequencies: 0.010050 685500 -- (-977.575) (-978.885) (-980.872) [-977.769] * (-982.034) (-980.609) [-976.244] (-978.155) -- 0:00:19 686000 -- (-976.921) [-977.560] (-979.737) (-976.475) * (-984.135) [-978.129] (-977.882) (-978.734) -- 0:00:19 686500 -- (-978.832) (-978.322) [-981.212] (-981.126) * [-977.335] (-981.779) (-976.633) (-978.601) -- 0:00:19 687000 -- (-978.280) (-980.424) [-977.463] (-983.272) * (-978.795) (-979.147) (-978.053) [-979.962] -- 0:00:19 687500 -- [-978.852] (-979.029) (-978.321) (-982.692) * [-976.799] (-979.544) (-976.901) (-987.226) -- 0:00:19 688000 -- [-981.185] (-977.117) (-978.971) (-982.680) * [-978.276] (-984.679) (-977.931) (-976.580) -- 0:00:19 688500 -- (-978.662) [-982.003] (-978.386) (-980.302) * (-979.061) (-982.306) [-977.148] (-977.540) -- 0:00:19 689000 -- [-979.840] (-979.136) (-982.114) (-978.611) * (-980.608) (-987.318) [-979.314] (-978.219) -- 0:00:19 689500 -- (-980.321) (-977.557) [-980.509] (-979.409) * [-978.248] (-982.521) (-984.118) (-981.080) -- 0:00:19 690000 -- (-979.863) (-979.120) [-983.221] (-979.550) * (-978.336) (-979.871) [-978.950] (-976.991) -- 0:00:19 Average standard deviation of split frequencies: 0.009385 690500 -- (-983.370) [-978.184] (-979.217) (-979.878) * (-977.561) (-983.322) [-981.073] (-977.607) -- 0:00:19 691000 -- [-977.646] (-976.455) (-978.896) (-982.418) * [-979.713] (-985.857) (-981.563) (-977.960) -- 0:00:19 691500 -- [-978.802] (-982.435) (-982.335) (-982.095) * (-976.836) (-978.349) (-977.878) [-978.426] -- 0:00:19 692000 -- (-980.047) (-976.177) [-979.859] (-977.628) * (-976.715) (-976.806) (-979.353) [-976.203] -- 0:00:19 692500 -- (-980.063) [-977.099] (-978.754) (-978.974) * (-977.474) (-977.022) (-984.352) [-976.630] -- 0:00:19 693000 -- (-978.413) (-979.976) [-979.091] (-979.857) * [-977.428] (-981.806) (-977.698) (-977.227) -- 0:00:19 693500 -- [-976.968] (-978.961) (-981.533) (-977.670) * (-978.570) (-979.718) (-978.873) [-978.010] -- 0:00:19 694000 -- (-976.906) [-978.076] (-983.515) (-985.252) * (-978.315) (-979.075) [-978.617] (-978.893) -- 0:00:18 694500 -- (-977.348) (-978.119) [-983.292] (-979.679) * (-977.722) (-978.539) [-978.443] (-981.476) -- 0:00:18 695000 -- (-980.007) (-983.468) [-978.008] (-980.031) * (-979.126) (-978.021) (-979.162) [-977.214] -- 0:00:18 Average standard deviation of split frequencies: 0.009567 695500 -- [-980.923] (-984.773) (-977.826) (-978.742) * (-980.276) (-980.379) (-978.378) [-980.763] -- 0:00:18 696000 -- [-983.186] (-976.618) (-982.177) (-980.566) * [-978.377] (-982.312) (-978.411) (-978.946) -- 0:00:18 696500 -- (-980.405) (-977.384) [-981.067] (-979.447) * [-979.430] (-979.579) (-979.939) (-976.204) -- 0:00:18 697000 -- [-979.583] (-978.044) (-978.491) (-983.526) * [-981.457] (-979.351) (-977.984) (-976.999) -- 0:00:18 697500 -- (-978.284) [-978.237] (-977.535) (-976.582) * [-981.269] (-979.806) (-977.519) (-978.192) -- 0:00:18 698000 -- (-979.999) [-978.091] (-978.734) (-976.285) * (-978.928) (-977.725) (-980.093) [-979.938] -- 0:00:18 698500 -- (-982.233) (-978.705) (-978.569) [-976.741] * [-977.535] (-983.463) (-979.701) (-981.191) -- 0:00:18 699000 -- (-981.162) (-978.815) [-979.570] (-978.802) * [-979.036] (-982.201) (-978.706) (-976.821) -- 0:00:18 699500 -- [-977.579] (-980.438) (-976.090) (-976.144) * (-980.574) (-978.542) (-976.901) [-977.571] -- 0:00:18 700000 -- (-978.371) [-978.552] (-977.840) (-978.565) * [-977.713] (-979.552) (-976.683) (-981.575) -- 0:00:18 Average standard deviation of split frequencies: 0.009713 700500 -- [-980.338] (-977.655) (-977.146) (-977.558) * (-976.452) [-981.936] (-978.020) (-981.758) -- 0:00:18 701000 -- (-986.503) [-977.182] (-976.820) (-981.297) * [-976.839] (-981.893) (-978.288) (-976.625) -- 0:00:18 701500 -- (-982.948) (-978.930) (-980.951) [-977.385] * [-979.367] (-981.956) (-977.828) (-976.961) -- 0:00:18 702000 -- (-983.847) (-977.462) [-979.211] (-978.043) * (-978.365) (-978.070) (-977.615) [-976.436] -- 0:00:18 702500 -- (-978.744) (-976.919) (-976.650) [-979.215] * (-978.741) [-979.139] (-976.874) (-977.904) -- 0:00:18 703000 -- (-978.706) (-979.175) [-976.409] (-979.123) * (-977.767) (-976.543) (-976.567) [-981.941] -- 0:00:18 703500 -- (-979.047) (-982.595) (-977.113) [-976.372] * [-977.966] (-980.322) (-983.927) (-985.620) -- 0:00:18 704000 -- (-981.402) (-983.396) [-977.194] (-977.648) * (-977.170) (-983.413) [-977.764] (-978.740) -- 0:00:18 704500 -- [-976.243] (-978.556) (-978.369) (-977.541) * [-977.828] (-979.638) (-976.334) (-980.201) -- 0:00:18 705000 -- [-977.056] (-978.845) (-978.055) (-979.940) * (-980.117) (-980.281) [-977.733] (-977.902) -- 0:00:18 Average standard deviation of split frequencies: 0.009765 705500 -- (-977.182) (-982.253) [-978.778] (-978.931) * (-979.449) (-976.913) [-981.952] (-982.333) -- 0:00:18 706000 -- (-979.762) (-979.652) (-978.990) [-983.940] * (-978.002) (-976.212) (-982.246) [-977.745] -- 0:00:18 706500 -- (-978.598) (-978.118) (-984.736) [-980.349] * (-977.178) (-976.212) (-978.177) [-977.207] -- 0:00:18 707000 -- [-979.960] (-979.822) (-977.090) (-979.614) * (-977.328) [-977.550] (-978.808) (-977.037) -- 0:00:18 707500 -- (-978.336) (-976.271) [-976.835] (-981.750) * (-976.292) [-982.061] (-978.831) (-978.189) -- 0:00:18 708000 -- (-978.002) [-976.502] (-977.412) (-977.162) * [-976.222] (-978.082) (-976.418) (-978.005) -- 0:00:18 708500 -- [-976.879] (-977.369) (-978.441) (-977.501) * [-976.376] (-976.738) (-977.459) (-979.869) -- 0:00:18 709000 -- (-979.994) (-983.266) [-976.968] (-979.094) * (-977.809) (-983.630) [-977.418] (-978.095) -- 0:00:18 709500 -- (-977.293) [-979.115] (-977.488) (-978.194) * (-977.236) (-978.780) [-979.205] (-979.000) -- 0:00:18 710000 -- [-976.826] (-978.643) (-978.887) (-977.391) * (-978.937) (-977.352) [-977.648] (-980.935) -- 0:00:17 Average standard deviation of split frequencies: 0.009494 710500 -- [-977.354] (-979.453) (-980.420) (-978.554) * (-981.053) (-975.952) (-977.489) [-976.194] -- 0:00:17 711000 -- (-978.469) (-979.830) [-978.291] (-976.061) * (-981.456) (-976.540) [-979.569] (-977.993) -- 0:00:17 711500 -- [-976.319] (-977.738) (-977.249) (-976.130) * (-979.906) [-981.632] (-981.574) (-978.111) -- 0:00:17 712000 -- (-976.659) (-978.702) [-977.102] (-977.264) * (-976.566) (-979.647) (-981.535) [-977.763] -- 0:00:17 712500 -- [-976.723] (-982.312) (-977.112) (-976.801) * (-976.340) (-979.618) (-977.456) [-977.713] -- 0:00:17 713000 -- (-976.601) (-982.907) [-976.559] (-976.883) * (-978.274) [-978.247] (-979.263) (-976.817) -- 0:00:17 713500 -- [-979.576] (-979.932) (-976.428) (-980.980) * (-980.546) (-978.081) [-978.687] (-976.827) -- 0:00:17 714000 -- (-977.625) (-978.934) [-980.361] (-977.791) * (-977.623) [-979.299] (-979.249) (-976.751) -- 0:00:17 714500 -- (-979.547) (-976.476) (-978.641) [-980.587] * [-976.352] (-976.696) (-978.162) (-977.443) -- 0:00:17 715000 -- (-976.407) (-977.924) [-976.244] (-978.426) * (-977.544) [-976.370] (-980.541) (-978.130) -- 0:00:17 Average standard deviation of split frequencies: 0.009382 715500 -- (-978.014) (-977.767) [-976.573] (-978.804) * [-976.094] (-975.970) (-979.702) (-976.390) -- 0:00:17 716000 -- (-979.079) [-977.446] (-977.895) (-979.353) * [-980.505] (-976.290) (-978.391) (-976.078) -- 0:00:17 716500 -- (-982.170) (-977.670) [-976.485] (-980.486) * [-978.219] (-978.752) (-978.403) (-983.385) -- 0:00:17 717000 -- (-978.897) [-980.155] (-978.342) (-976.775) * [-976.537] (-978.583) (-977.508) (-977.041) -- 0:00:17 717500 -- [-978.333] (-978.810) (-977.795) (-975.984) * (-979.626) [-977.401] (-978.932) (-978.627) -- 0:00:17 718000 -- (-979.880) [-979.247] (-981.747) (-977.736) * (-977.420) [-977.368] (-979.172) (-975.997) -- 0:00:17 718500 -- (-980.758) (-977.265) (-977.713) [-977.095] * [-979.861] (-983.861) (-981.960) (-979.096) -- 0:00:17 719000 -- (-981.070) (-981.455) (-976.750) [-976.989] * (-983.184) (-977.960) (-983.427) [-977.827] -- 0:00:17 719500 -- (-978.138) [-978.593] (-978.069) (-976.974) * (-978.562) (-978.030) (-981.262) [-976.599] -- 0:00:17 720000 -- (-977.761) (-980.644) [-978.827] (-976.615) * (-978.824) [-976.211] (-979.714) (-976.872) -- 0:00:17 Average standard deviation of split frequencies: 0.009485 720500 -- (-980.572) (-978.626) [-978.812] (-976.594) * (-978.522) (-976.992) [-979.949] (-977.233) -- 0:00:17 721000 -- (-982.019) (-980.131) [-978.201] (-977.866) * [-977.151] (-977.936) (-978.258) (-980.008) -- 0:00:17 721500 -- (-980.855) (-978.413) [-977.489] (-976.222) * (-981.038) (-979.603) (-976.751) [-978.069] -- 0:00:17 722000 -- [-978.660] (-978.969) (-976.563) (-984.822) * (-978.237) (-979.905) (-977.662) [-977.124] -- 0:00:17 722500 -- (-979.166) (-979.590) [-978.490] (-979.818) * [-978.358] (-980.548) (-976.322) (-978.866) -- 0:00:17 723000 -- [-977.382] (-976.895) (-978.125) (-977.325) * (-978.051) (-979.107) [-978.258] (-978.438) -- 0:00:17 723500 -- (-980.249) (-980.410) (-981.959) [-978.112] * (-977.595) [-978.424] (-976.794) (-978.229) -- 0:00:17 724000 -- [-978.479] (-981.711) (-978.087) (-976.809) * [-976.050] (-977.657) (-981.506) (-978.461) -- 0:00:17 724500 -- (-980.754) (-981.182) (-977.240) [-978.119] * (-979.501) (-978.800) [-980.992] (-976.523) -- 0:00:17 725000 -- (-980.479) [-980.057] (-978.109) (-978.110) * (-981.066) (-983.335) (-978.640) [-977.032] -- 0:00:17 Average standard deviation of split frequencies: 0.009740 725500 -- (-977.255) (-976.305) [-977.400] (-978.463) * [-976.963] (-979.787) (-976.492) (-977.698) -- 0:00:17 726000 -- (-979.583) [-978.411] (-977.030) (-977.153) * [-976.762] (-976.531) (-981.008) (-978.363) -- 0:00:16 726500 -- (-977.999) (-979.918) [-979.022] (-975.907) * [-976.388] (-976.618) (-976.154) (-979.164) -- 0:00:16 727000 -- (-978.056) (-980.925) (-976.858) [-976.631] * (-976.183) (-976.011) (-978.526) [-978.006] -- 0:00:16 727500 -- (-978.414) [-980.383] (-977.010) (-978.320) * [-978.589] (-983.634) (-979.678) (-978.061) -- 0:00:16 728000 -- (-977.768) (-979.702) [-976.988] (-979.231) * (-980.341) (-980.881) (-977.946) [-976.291] -- 0:00:16 728500 -- (-979.175) (-977.413) (-976.988) [-977.463] * (-976.475) (-977.172) (-978.665) [-976.317] -- 0:00:16 729000 -- (-979.469) (-979.118) [-981.903] (-977.345) * (-982.134) (-977.715) (-977.610) [-976.319] -- 0:00:16 729500 -- (-979.570) [-977.754] (-977.073) (-977.218) * (-977.761) (-977.264) (-983.761) [-978.756] -- 0:00:16 730000 -- (-981.689) (-977.713) (-977.300) [-975.979] * [-977.486] (-976.705) (-981.360) (-977.682) -- 0:00:16 Average standard deviation of split frequencies: 0.010000 730500 -- (-978.189) (-978.377) (-980.328) [-976.088] * (-977.394) (-977.787) (-976.032) [-977.219] -- 0:00:16 731000 -- (-977.217) (-978.897) (-978.795) [-978.436] * (-978.395) [-977.918] (-976.496) (-978.720) -- 0:00:16 731500 -- (-979.959) (-977.746) [-977.871] (-979.080) * (-976.287) (-976.732) (-978.614) [-976.952] -- 0:00:16 732000 -- (-981.368) [-977.219] (-977.213) (-977.951) * [-981.161] (-976.679) (-976.597) (-980.113) -- 0:00:16 732500 -- (-979.540) (-977.164) [-978.119] (-977.818) * (-979.305) (-976.610) [-979.044] (-978.129) -- 0:00:16 733000 -- (-979.085) (-980.769) [-977.165] (-977.764) * (-982.862) (-977.408) [-977.276] (-977.605) -- 0:00:16 733500 -- (-977.278) (-981.521) (-976.544) [-977.326] * (-978.116) [-979.296] (-981.837) (-978.839) -- 0:00:16 734000 -- (-977.324) (-978.510) [-976.979] (-977.220) * [-976.899] (-976.596) (-976.295) (-978.235) -- 0:00:16 734500 -- (-981.714) (-976.976) [-978.390] (-977.933) * (-976.544) [-979.118] (-977.329) (-976.946) -- 0:00:16 735000 -- (-976.599) (-979.947) [-977.668] (-979.366) * (-976.377) (-981.019) [-977.446] (-976.311) -- 0:00:16 Average standard deviation of split frequencies: 0.009247 735500 -- (-977.183) (-978.278) [-977.157] (-978.749) * (-978.181) (-981.983) [-976.107] (-977.146) -- 0:00:16 736000 -- (-977.095) [-977.420] (-978.482) (-979.390) * (-979.985) [-977.606] (-977.758) (-978.220) -- 0:00:16 736500 -- (-978.071) (-978.736) [-977.187] (-978.873) * [-984.405] (-979.178) (-979.606) (-976.158) -- 0:00:16 737000 -- (-977.436) (-981.952) [-978.694] (-980.571) * (-981.295) (-979.407) [-976.648] (-977.354) -- 0:00:16 737500 -- (-978.357) (-977.945) [-977.178] (-980.116) * (-977.880) (-978.330) [-976.013] (-978.363) -- 0:00:16 738000 -- [-976.819] (-979.819) (-980.760) (-979.399) * (-981.136) (-984.513) [-975.897] (-976.902) -- 0:00:16 738500 -- (-976.336) [-977.663] (-977.028) (-976.637) * [-977.860] (-977.324) (-978.747) (-976.361) -- 0:00:16 739000 -- (-977.571) [-976.632] (-977.002) (-976.589) * (-978.203) (-977.526) (-977.305) [-977.969] -- 0:00:16 739500 -- (-978.049) (-976.535) (-977.387) [-978.826] * [-978.835] (-981.064) (-978.468) (-976.576) -- 0:00:16 740000 -- (-980.133) (-978.945) [-977.887] (-977.196) * (-979.328) [-978.223] (-982.666) (-977.658) -- 0:00:16 Average standard deviation of split frequencies: 0.009507 740500 -- (-978.764) (-981.697) [-977.735] (-976.010) * (-976.879) [-977.519] (-979.152) (-980.250) -- 0:00:16 741000 -- [-979.767] (-984.352) (-987.195) (-978.539) * (-980.789) (-977.985) (-977.604) [-977.949] -- 0:00:16 741500 -- [-979.167] (-983.560) (-979.352) (-980.118) * [-978.529] (-979.240) (-977.265) (-977.417) -- 0:00:16 742000 -- [-978.496] (-979.937) (-977.958) (-977.810) * (-977.880) (-978.600) (-977.281) [-979.267] -- 0:00:15 742500 -- (-978.869) [-977.636] (-978.403) (-978.258) * [-978.155] (-979.583) (-976.868) (-978.143) -- 0:00:15 743000 -- (-980.210) (-980.702) (-981.300) [-976.838] * [-977.367] (-977.066) (-980.762) (-976.982) -- 0:00:15 743500 -- (-978.613) (-978.502) (-979.520) [-977.716] * (-977.632) [-978.547] (-976.731) (-978.205) -- 0:00:15 744000 -- (-979.645) [-977.059] (-982.464) (-978.745) * (-978.769) (-976.474) (-977.266) [-978.520] -- 0:00:15 744500 -- (-978.381) [-977.510] (-980.073) (-979.284) * [-979.594] (-978.820) (-978.038) (-978.123) -- 0:00:15 745000 -- (-978.469) [-977.903] (-979.322) (-978.887) * (-975.948) (-983.113) [-976.710] (-980.782) -- 0:00:15 Average standard deviation of split frequencies: 0.009637 745500 -- (-978.928) [-977.576] (-984.413) (-979.668) * (-979.706) (-978.769) [-976.697] (-977.599) -- 0:00:15 746000 -- (-978.455) (-977.149) (-976.011) [-976.548] * [-979.339] (-980.138) (-978.260) (-977.634) -- 0:00:15 746500 -- (-977.748) (-977.228) (-976.494) [-977.495] * (-979.119) (-978.425) [-981.230] (-976.471) -- 0:00:15 747000 -- (-979.421) (-977.213) [-977.211] (-978.764) * (-979.531) (-976.981) [-978.856] (-977.053) -- 0:00:15 747500 -- (-978.942) (-976.170) (-976.981) [-976.999] * (-976.524) (-978.362) (-978.883) [-976.015] -- 0:00:15 748000 -- (-979.669) [-977.907] (-978.281) (-977.326) * [-981.573] (-976.332) (-984.293) (-978.031) -- 0:00:15 748500 -- (-977.485) [-979.878] (-981.874) (-976.491) * (-978.455) (-976.585) (-976.308) [-975.857] -- 0:00:15 749000 -- (-976.976) (-979.832) [-976.920] (-978.409) * (-978.825) (-977.016) [-976.188] (-977.927) -- 0:00:15 749500 -- (-978.449) [-978.255] (-978.472) (-976.963) * (-978.831) (-976.962) (-979.291) [-976.322] -- 0:00:15 750000 -- (-979.595) [-976.917] (-980.447) (-976.729) * (-980.607) (-977.351) (-979.949) [-977.829] -- 0:00:15 Average standard deviation of split frequencies: 0.008949 750500 -- (-978.843) [-975.963] (-978.843) (-976.803) * (-980.615) [-977.868] (-978.959) (-979.183) -- 0:00:15 751000 -- (-976.809) (-976.148) (-977.569) [-976.908] * (-978.284) [-976.686] (-981.551) (-979.276) -- 0:00:15 751500 -- [-977.660] (-979.062) (-977.601) (-978.193) * [-979.239] (-975.996) (-979.233) (-979.129) -- 0:00:15 752000 -- (-976.625) (-980.678) (-976.953) [-976.492] * [-978.536] (-977.322) (-980.693) (-977.913) -- 0:00:15 752500 -- (-978.452) (-976.615) (-976.644) [-977.522] * (-978.977) (-977.186) (-978.416) [-977.775] -- 0:00:15 753000 -- (-977.730) (-977.291) (-977.774) [-976.006] * [-981.401] (-976.549) (-977.632) (-979.710) -- 0:00:15 753500 -- (-979.737) [-976.425] (-979.078) (-978.112) * (-977.129) (-976.549) [-976.917] (-976.245) -- 0:00:15 754000 -- (-981.306) [-976.619] (-979.824) (-975.972) * (-977.626) (-976.564) (-976.919) [-976.245] -- 0:00:15 754500 -- (-977.242) (-976.651) (-978.667) [-980.033] * [-977.488] (-976.823) (-976.313) (-982.855) -- 0:00:15 755000 -- [-981.729] (-977.781) (-976.342) (-980.707) * (-978.409) (-977.658) (-976.955) [-977.615] -- 0:00:15 Average standard deviation of split frequencies: 0.008769 755500 -- (-977.742) (-977.832) (-976.263) [-982.070] * (-976.494) [-978.380] (-977.993) (-976.736) -- 0:00:15 756000 -- (-976.043) (-980.775) (-977.675) [-979.265] * [-976.557] (-984.776) (-977.132) (-978.020) -- 0:00:15 756500 -- (-977.188) (-977.418) [-976.797] (-980.332) * (-976.942) [-976.635] (-977.995) (-977.820) -- 0:00:15 757000 -- (-980.361) (-976.107) [-976.719] (-981.106) * [-977.434] (-975.893) (-978.785) (-977.951) -- 0:00:15 757500 -- (-977.572) (-977.488) [-980.646] (-978.837) * [-977.193] (-975.895) (-980.827) (-983.616) -- 0:00:15 758000 -- (-981.408) [-978.533] (-977.748) (-978.540) * (-977.542) [-975.967] (-982.983) (-978.191) -- 0:00:15 758500 -- (-978.718) (-978.767) (-977.316) [-977.295] * (-978.949) [-976.085] (-979.465) (-978.810) -- 0:00:14 759000 -- (-981.342) [-976.415] (-980.007) (-979.511) * (-979.077) (-976.253) [-981.928] (-980.216) -- 0:00:14 759500 -- (-978.411) (-979.059) (-977.976) [-977.914] * (-977.320) [-977.225] (-977.699) (-977.130) -- 0:00:14 760000 -- [-978.571] (-978.417) (-977.304) (-977.870) * (-980.460) (-976.077) [-978.493] (-979.593) -- 0:00:14 Average standard deviation of split frequencies: 0.008635 760500 -- (-976.692) [-976.524] (-979.225) (-976.596) * (-977.945) [-979.292] (-977.228) (-976.636) -- 0:00:14 761000 -- (-976.525) (-975.985) [-976.518] (-979.015) * (-978.612) [-976.978] (-977.077) (-979.185) -- 0:00:14 761500 -- (-977.881) (-977.667) (-975.878) [-977.160] * [-983.562] (-978.738) (-976.960) (-976.978) -- 0:00:14 762000 -- (-976.869) (-981.494) (-977.535) [-977.845] * (-978.655) (-979.055) (-977.972) [-978.767] -- 0:00:14 762500 -- (-978.418) [-979.363] (-979.158) (-981.344) * (-978.511) (-977.174) (-977.628) [-977.560] -- 0:00:14 763000 -- (-978.751) [-976.008] (-980.598) (-977.533) * (-977.358) (-977.837) (-981.046) [-978.691] -- 0:00:14 763500 -- [-978.322] (-977.571) (-977.264) (-977.386) * (-978.393) [-977.092] (-980.248) (-978.983) -- 0:00:14 764000 -- [-977.429] (-979.358) (-980.024) (-976.109) * (-976.655) (-976.999) [-984.058] (-980.522) -- 0:00:14 764500 -- [-976.164] (-978.889) (-979.803) (-976.203) * (-976.430) (-977.766) [-977.068] (-977.460) -- 0:00:14 765000 -- (-977.122) [-976.669] (-979.314) (-977.876) * (-983.585) [-977.138] (-978.331) (-980.347) -- 0:00:14 Average standard deviation of split frequencies: 0.008575 765500 -- [-979.281] (-976.712) (-981.009) (-976.630) * (-977.925) (-980.123) [-978.552] (-978.763) -- 0:00:14 766000 -- (-978.117) (-978.598) (-976.741) [-978.303] * [-976.309] (-982.217) (-977.606) (-977.158) -- 0:00:14 766500 -- (-979.241) (-979.511) (-976.412) [-977.277] * (-978.981) [-976.860] (-977.382) (-979.439) -- 0:00:14 767000 -- (-984.401) (-978.753) (-979.508) [-977.743] * [-977.584] (-979.443) (-981.203) (-978.356) -- 0:00:14 767500 -- (-979.034) [-979.643] (-978.960) (-978.447) * [-977.437] (-979.100) (-984.765) (-977.116) -- 0:00:14 768000 -- (-979.323) (-981.075) (-982.002) [-977.101] * [-978.752] (-978.863) (-979.686) (-976.199) -- 0:00:14 768500 -- (-979.340) (-981.299) (-982.655) [-976.716] * (-977.396) (-977.182) (-979.636) [-979.222] -- 0:00:14 769000 -- (-979.595) (-977.911) [-978.235] (-976.719) * (-977.294) (-979.568) (-979.214) [-976.839] -- 0:00:14 769500 -- [-981.520] (-978.820) (-979.111) (-978.072) * (-977.452) (-979.951) [-978.663] (-977.750) -- 0:00:14 770000 -- [-979.096] (-979.185) (-982.029) (-977.837) * (-982.023) (-981.571) [-976.623] (-976.919) -- 0:00:14 Average standard deviation of split frequencies: 0.008645 770500 -- [-977.809] (-978.359) (-977.230) (-977.141) * [-978.755] (-978.624) (-978.356) (-978.284) -- 0:00:14 771000 -- (-978.045) (-981.894) (-977.190) [-978.067] * (-984.341) [-977.594] (-978.423) (-977.222) -- 0:00:14 771500 -- [-978.950] (-977.652) (-980.104) (-977.501) * (-978.150) [-978.706] (-975.815) (-979.895) -- 0:00:14 772000 -- (-979.537) [-977.877] (-980.116) (-977.731) * (-977.236) [-977.481] (-978.123) (-977.295) -- 0:00:14 772500 -- (-977.926) (-978.648) [-977.512] (-977.359) * [-977.567] (-983.280) (-977.490) (-977.434) -- 0:00:14 773000 -- (-977.902) (-980.673) (-978.849) [-979.252] * [-976.542] (-981.670) (-979.922) (-978.848) -- 0:00:14 773500 -- (-979.493) (-979.604) (-978.182) [-978.440] * (-977.683) (-981.152) [-978.860] (-980.304) -- 0:00:14 774000 -- (-982.470) (-978.124) [-978.943] (-976.545) * (-977.191) [-976.924] (-977.811) (-978.384) -- 0:00:14 774500 -- (-982.672) (-978.868) [-978.296] (-978.321) * (-976.953) (-977.572) [-976.625] (-977.058) -- 0:00:13 775000 -- (-983.713) [-983.489] (-978.508) (-977.510) * (-979.187) (-977.918) [-977.091] (-978.075) -- 0:00:13 Average standard deviation of split frequencies: 0.008991 775500 -- (-981.307) (-979.527) (-976.580) [-980.103] * (-979.034) (-978.091) (-977.637) [-975.895] -- 0:00:13 776000 -- (-978.872) (-978.061) (-976.140) [-976.651] * (-978.095) (-980.126) [-976.904] (-978.926) -- 0:00:13 776500 -- (-978.979) [-977.175] (-977.277) (-976.779) * [-977.507] (-980.087) (-976.678) (-979.360) -- 0:00:13 777000 -- (-978.591) (-982.616) (-977.509) [-982.881] * [-976.489] (-980.387) (-983.041) (-978.598) -- 0:00:13 777500 -- (-979.341) (-978.968) (-977.755) [-979.145] * [-978.476] (-980.340) (-980.993) (-979.039) -- 0:00:13 778000 -- (-978.267) [-981.546] (-979.243) (-977.602) * (-980.526) [-978.973] (-980.376) (-979.588) -- 0:00:13 778500 -- (-977.713) (-980.151) (-978.924) [-978.996] * [-979.646] (-977.315) (-979.314) (-979.424) -- 0:00:13 779000 -- [-977.403] (-977.282) (-977.255) (-978.369) * (-978.392) [-977.567] (-978.472) (-977.277) -- 0:00:13 779500 -- (-981.467) [-979.565] (-977.147) (-980.254) * (-976.984) (-977.732) (-978.257) [-980.019] -- 0:00:13 780000 -- (-982.240) (-976.477) [-978.381] (-980.408) * [-976.526] (-978.538) (-979.336) (-978.523) -- 0:00:13 Average standard deviation of split frequencies: 0.009098 780500 -- [-977.979] (-976.662) (-977.264) (-977.500) * (-978.114) (-985.618) [-977.629] (-979.410) -- 0:00:13 781000 -- (-980.945) (-976.950) (-981.349) [-976.647] * (-977.312) (-981.317) (-977.679) [-980.262] -- 0:00:13 781500 -- (-978.909) [-981.455] (-977.286) (-977.089) * (-977.274) (-979.388) [-977.349] (-977.276) -- 0:00:13 782000 -- [-977.756] (-978.325) (-977.151) (-977.452) * (-979.702) [-979.060] (-978.951) (-979.597) -- 0:00:13 782500 -- (-977.412) (-978.230) [-976.021] (-979.962) * (-979.953) [-977.416] (-980.510) (-978.244) -- 0:00:13 783000 -- [-976.597] (-979.258) (-975.971) (-979.331) * [-977.672] (-976.934) (-979.905) (-976.909) -- 0:00:13 783500 -- (-978.334) (-983.404) (-977.692) [-978.191] * (-976.454) [-977.330] (-978.677) (-979.292) -- 0:00:13 784000 -- (-978.286) (-976.842) (-979.422) [-981.558] * (-977.034) (-977.572) (-979.826) [-978.859] -- 0:00:13 784500 -- (-976.637) (-977.663) [-980.697] (-978.286) * [-977.254] (-977.019) (-976.264) (-977.299) -- 0:00:13 785000 -- (-976.841) (-979.189) (-977.655) [-976.500] * (-977.363) [-977.794] (-978.377) (-977.569) -- 0:00:13 Average standard deviation of split frequencies: 0.008676 785500 -- (-978.221) (-979.157) [-977.128] (-979.010) * [-980.547] (-981.164) (-976.292) (-983.012) -- 0:00:13 786000 -- (-979.756) (-978.363) (-981.116) [-981.127] * (-980.500) (-977.022) (-977.923) [-981.611] -- 0:00:13 786500 -- (-981.713) (-976.710) (-978.882) [-977.246] * (-976.913) (-976.961) [-977.532] (-977.202) -- 0:00:13 787000 -- (-984.616) (-977.713) (-981.434) [-977.304] * [-976.562] (-978.355) (-977.497) (-986.899) -- 0:00:13 787500 -- (-978.968) [-978.878] (-977.622) (-978.691) * (-978.791) [-978.980] (-976.957) (-977.938) -- 0:00:13 788000 -- (-978.169) (-976.852) (-977.649) [-977.733] * (-976.669) (-981.925) [-975.893] (-980.700) -- 0:00:13 788500 -- (-976.999) (-979.594) (-980.323) [-977.679] * [-977.850] (-979.224) (-976.834) (-989.486) -- 0:00:13 789000 -- (-976.821) [-978.388] (-978.344) (-983.934) * (-976.895) [-977.957] (-979.778) (-981.030) -- 0:00:13 789500 -- [-981.263] (-980.761) (-977.588) (-981.452) * [-976.648] (-979.982) (-980.365) (-979.525) -- 0:00:13 790000 -- (-977.355) [-977.348] (-976.605) (-980.500) * (-983.061) [-979.175] (-977.692) (-977.723) -- 0:00:13 Average standard deviation of split frequencies: 0.008546 790500 -- (-979.826) [-978.603] (-978.995) (-977.927) * (-980.856) [-978.068] (-976.425) (-976.635) -- 0:00:12 791000 -- [-979.132] (-977.956) (-980.098) (-980.342) * (-980.233) (-977.944) (-977.768) [-981.719] -- 0:00:12 791500 -- (-981.548) [-978.112] (-982.915) (-976.782) * (-977.776) [-980.759] (-978.707) (-979.681) -- 0:00:12 792000 -- [-976.114] (-979.513) (-977.691) (-976.977) * (-977.522) (-978.206) [-978.338] (-979.007) -- 0:00:12 792500 -- [-976.278] (-980.324) (-976.907) (-979.020) * (-979.872) (-978.034) (-977.205) [-978.721] -- 0:00:12 793000 -- [-977.151] (-978.062) (-980.210) (-979.061) * (-981.645) (-977.536) (-981.646) [-977.868] -- 0:00:12 793500 -- (-976.597) [-977.564] (-980.248) (-976.948) * (-978.944) [-979.238] (-978.575) (-979.733) -- 0:00:12 794000 -- (-976.699) [-977.791] (-977.420) (-977.510) * (-979.329) (-979.193) [-979.838] (-977.344) -- 0:00:12 794500 -- (-978.800) [-977.143] (-979.252) (-980.312) * (-976.604) [-979.617] (-977.959) (-976.119) -- 0:00:12 795000 -- (-977.020) (-976.866) [-977.410] (-978.819) * (-977.749) [-977.942] (-977.064) (-976.357) -- 0:00:12 Average standard deviation of split frequencies: 0.008488 795500 -- [-981.734] (-976.764) (-979.357) (-982.151) * (-978.075) [-979.594] (-977.429) (-977.032) -- 0:00:12 796000 -- (-978.405) [-980.642] (-978.791) (-977.339) * (-977.063) (-984.383) [-979.956] (-977.467) -- 0:00:12 796500 -- (-977.975) (-978.692) [-977.020] (-978.528) * (-976.945) (-979.329) [-978.555] (-977.402) -- 0:00:12 797000 -- [-980.625] (-977.266) (-978.240) (-976.269) * [-978.884] (-980.094) (-981.322) (-979.502) -- 0:00:12 797500 -- (-980.968) (-979.954) (-977.282) [-978.873] * (-980.386) (-978.579) [-976.719] (-976.676) -- 0:00:12 798000 -- (-978.038) (-978.914) (-976.599) [-980.826] * [-979.289] (-980.206) (-977.895) (-979.597) -- 0:00:12 798500 -- [-976.567] (-977.883) (-976.066) (-977.369) * (-978.861) (-982.938) (-978.694) [-978.787] -- 0:00:12 799000 -- (-978.294) (-979.601) (-976.906) [-978.030] * [-979.048] (-984.465) (-977.159) (-979.684) -- 0:00:12 799500 -- (-979.633) (-980.594) (-978.196) [-979.754] * (-979.273) (-980.540) [-976.546] (-978.788) -- 0:00:12 800000 -- (-979.480) (-979.580) [-979.712] (-981.305) * (-982.547) (-976.066) (-979.941) [-976.695] -- 0:00:12 Average standard deviation of split frequencies: 0.008596 800500 -- (-977.348) [-977.038] (-977.290) (-977.925) * (-979.876) (-976.586) (-976.841) [-978.197] -- 0:00:12 801000 -- [-976.405] (-977.123) (-976.757) (-979.325) * (-979.935) (-977.073) [-976.232] (-976.793) -- 0:00:12 801500 -- [-976.038] (-978.231) (-979.696) (-976.138) * (-976.776) (-978.129) [-977.795] (-976.763) -- 0:00:12 802000 -- [-976.606] (-976.017) (-980.205) (-977.755) * [-977.327] (-977.837) (-976.998) (-977.325) -- 0:00:12 802500 -- [-977.330] (-977.876) (-979.202) (-981.236) * (-981.366) [-980.967] (-976.362) (-978.050) -- 0:00:12 803000 -- (-984.212) [-976.090] (-978.552) (-977.841) * (-979.247) (-978.783) (-978.896) [-979.423] -- 0:00:12 803500 -- (-978.568) (-977.594) [-980.611] (-980.724) * (-977.081) (-980.921) [-976.319] (-976.931) -- 0:00:12 804000 -- (-977.337) (-977.854) [-979.865] (-978.243) * (-977.527) [-977.983] (-976.276) (-977.848) -- 0:00:12 804500 -- (-978.431) [-977.779] (-979.229) (-982.707) * (-976.915) (-976.884) (-982.847) [-981.023] -- 0:00:12 805000 -- (-977.681) (-978.160) (-978.405) [-978.357] * (-977.443) (-976.314) [-976.790] (-981.141) -- 0:00:12 Average standard deviation of split frequencies: 0.008890 805500 -- (-976.217) [-977.279] (-982.529) (-978.357) * (-978.351) (-977.603) [-977.970] (-979.938) -- 0:00:12 806000 -- (-976.760) (-977.418) [-977.282] (-975.985) * (-978.375) (-977.832) (-978.234) [-978.156] -- 0:00:12 806500 -- [-976.800] (-980.576) (-979.463) (-976.638) * (-978.222) [-978.673] (-977.761) (-976.190) -- 0:00:11 807000 -- (-977.443) (-981.047) (-977.554) [-981.966] * (-977.010) [-975.864] (-976.641) (-977.071) -- 0:00:11 807500 -- (-977.931) (-979.920) (-977.383) [-976.554] * (-979.326) (-975.869) (-978.494) [-980.926] -- 0:00:11 808000 -- (-977.464) (-979.837) [-981.683] (-978.173) * (-977.282) (-976.210) [-978.985] (-980.296) -- 0:00:11 808500 -- (-978.767) (-979.903) [-980.293] (-982.448) * (-977.225) (-976.343) [-977.521] (-980.168) -- 0:00:11 809000 -- (-976.596) [-977.241] (-978.687) (-976.675) * (-977.917) (-979.972) (-976.671) [-977.577] -- 0:00:11 809500 -- (-977.379) (-978.363) (-978.288) [-978.501] * (-979.149) (-977.657) [-976.210] (-977.777) -- 0:00:11 810000 -- [-977.537] (-978.376) (-979.379) (-977.525) * (-979.857) [-978.211] (-977.980) (-977.074) -- 0:00:11 Average standard deviation of split frequencies: 0.008451 810500 -- [-979.852] (-979.773) (-978.754) (-978.086) * (-979.951) [-983.082] (-977.195) (-977.826) -- 0:00:11 811000 -- [-977.176] (-985.941) (-976.905) (-977.675) * (-981.036) (-977.449) [-976.460] (-977.678) -- 0:00:11 811500 -- (-979.262) [-982.471] (-976.173) (-979.204) * [-978.238] (-976.450) (-976.613) (-980.530) -- 0:00:11 812000 -- (-978.276) (-982.417) [-976.685] (-979.481) * [-978.885] (-976.788) (-977.406) (-980.276) -- 0:00:11 812500 -- [-979.648] (-979.992) (-976.444) (-978.132) * (-978.889) (-978.146) [-976.955] (-977.445) -- 0:00:11 813000 -- (-976.028) [-979.228] (-977.913) (-982.011) * [-976.653] (-977.873) (-981.659) (-977.466) -- 0:00:11 813500 -- (-979.183) [-978.451] (-978.305) (-977.915) * [-976.676] (-980.990) (-981.211) (-980.390) -- 0:00:11 814000 -- (-982.387) [-976.810] (-978.697) (-980.318) * (-978.287) (-977.220) [-980.878] (-978.785) -- 0:00:11 814500 -- [-976.497] (-979.771) (-976.900) (-977.392) * (-978.087) (-980.386) [-978.173] (-985.506) -- 0:00:11 815000 -- (-976.277) (-977.444) [-977.919] (-976.768) * [-978.108] (-977.469) (-978.750) (-984.677) -- 0:00:11 Average standard deviation of split frequencies: 0.008280 815500 -- (-976.932) (-976.792) (-977.988) [-977.005] * [-979.615] (-977.440) (-979.881) (-982.594) -- 0:00:11 816000 -- (-977.076) (-978.385) [-977.907] (-978.459) * (-981.588) [-983.659] (-982.472) (-978.952) -- 0:00:11 816500 -- (-976.056) (-977.381) (-984.798) [-976.023] * (-980.303) (-979.245) [-977.410] (-978.722) -- 0:00:11 817000 -- (-978.701) [-976.537] (-978.227) (-977.360) * (-978.422) [-978.129] (-986.011) (-980.068) -- 0:00:11 817500 -- (-976.739) [-978.636] (-980.469) (-976.613) * [-979.781] (-975.863) (-979.612) (-977.811) -- 0:00:11 818000 -- (-979.685) (-982.255) [-979.667] (-980.819) * (-982.707) (-977.456) [-978.346] (-977.072) -- 0:00:11 818500 -- [-977.556] (-979.625) (-976.166) (-978.280) * (-979.120) [-977.480] (-977.802) (-978.099) -- 0:00:11 819000 -- (-980.556) (-980.968) (-977.611) [-977.459] * (-981.320) (-976.411) [-979.643] (-980.195) -- 0:00:11 819500 -- [-978.698] (-977.276) (-979.425) (-979.745) * [-976.800] (-978.374) (-978.039) (-976.624) -- 0:00:11 820000 -- (-975.900) (-978.145) [-978.121] (-981.165) * [-975.964] (-976.094) (-980.086) (-978.888) -- 0:00:11 Average standard deviation of split frequencies: 0.008463 820500 -- (-976.910) (-977.721) (-979.038) [-980.155] * (-978.127) (-976.550) [-979.859] (-981.805) -- 0:00:11 821000 -- [-978.525] (-977.970) (-984.804) (-978.300) * (-976.892) (-976.609) [-978.319] (-982.035) -- 0:00:11 821500 -- (-978.521) (-979.595) (-977.222) [-978.247] * (-977.768) (-976.385) (-980.482) [-981.910] -- 0:00:11 822000 -- [-978.317] (-976.953) (-980.760) (-977.945) * (-979.264) (-978.135) (-977.997) [-981.312] -- 0:00:11 822500 -- (-977.371) (-978.962) [-980.749] (-981.893) * (-982.445) [-977.159] (-978.722) (-982.712) -- 0:00:11 823000 -- [-978.478] (-979.689) (-977.733) (-982.970) * [-979.604] (-976.727) (-978.014) (-980.527) -- 0:00:10 823500 -- (-978.249) [-978.517] (-977.524) (-979.230) * (-980.429) (-982.913) [-980.084] (-981.933) -- 0:00:10 824000 -- (-980.029) (-977.958) [-981.985] (-978.700) * [-976.304] (-980.548) (-977.111) (-982.414) -- 0:00:10 824500 -- [-978.009] (-979.165) (-977.505) (-981.672) * (-977.052) [-981.732] (-980.537) (-977.843) -- 0:00:10 825000 -- (-979.376) (-979.556) (-976.020) [-981.032] * (-980.191) (-980.483) [-977.189] (-977.928) -- 0:00:10 Average standard deviation of split frequencies: 0.008294 825500 -- [-976.478] (-978.958) (-980.590) (-982.172) * (-979.445) (-977.793) [-977.881] (-979.589) -- 0:00:10 826000 -- (-976.308) [-978.275] (-978.595) (-978.505) * (-979.162) [-978.444] (-977.846) (-979.889) -- 0:00:10 826500 -- [-977.977] (-976.771) (-979.181) (-979.927) * (-980.351) (-978.698) [-976.925] (-979.670) -- 0:00:10 827000 -- (-978.802) (-978.955) (-978.589) [-978.491] * (-978.881) (-978.599) [-981.191] (-978.774) -- 0:00:10 827500 -- [-980.274] (-978.907) (-977.637) (-977.266) * (-981.032) (-977.185) (-980.191) [-983.268] -- 0:00:10 828000 -- (-979.245) (-980.660) (-981.883) [-976.905] * (-978.910) [-977.210] (-982.073) (-979.604) -- 0:00:10 828500 -- (-977.768) (-981.742) (-980.484) [-979.083] * (-978.711) (-980.762) (-986.526) [-977.800] -- 0:00:10 829000 -- (-979.259) [-977.255] (-979.381) (-977.739) * [-976.526] (-976.756) (-977.512) (-978.805) -- 0:00:10 829500 -- (-985.236) [-976.410] (-977.951) (-978.430) * (-986.753) [-977.020] (-976.893) (-979.986) -- 0:00:10 830000 -- (-986.049) (-977.288) (-978.842) [-977.169] * [-980.711] (-977.758) (-977.814) (-979.707) -- 0:00:10 Average standard deviation of split frequencies: 0.008248 830500 -- [-979.368] (-976.724) (-978.412) (-977.354) * [-979.963] (-976.904) (-977.642) (-979.021) -- 0:00:10 831000 -- (-982.372) (-978.491) [-978.216] (-979.843) * (-979.172) [-976.684] (-977.786) (-979.539) -- 0:00:10 831500 -- (-979.052) (-980.648) [-978.849] (-977.647) * (-978.698) (-978.835) (-980.759) [-979.169] -- 0:00:10 832000 -- [-982.341] (-977.814) (-981.701) (-979.468) * (-978.416) (-976.851) [-976.969] (-979.251) -- 0:00:10 832500 -- (-986.752) (-978.225) (-981.524) [-980.802] * [-976.592] (-978.328) (-979.367) (-981.028) -- 0:00:10 833000 -- (-980.082) (-982.134) (-978.751) [-980.248] * [-977.801] (-976.584) (-981.181) (-981.494) -- 0:00:10 833500 -- (-978.453) (-976.326) (-977.326) [-979.253] * (-978.744) (-976.531) [-981.099] (-980.251) -- 0:00:10 834000 -- (-978.773) (-978.656) (-980.305) [-976.963] * (-976.498) [-981.613] (-979.806) (-981.987) -- 0:00:10 834500 -- [-977.404] (-979.177) (-979.842) (-978.379) * (-976.411) [-977.304] (-978.906) (-978.541) -- 0:00:10 835000 -- (-978.988) (-979.481) [-977.311] (-980.980) * (-979.772) [-978.159] (-979.596) (-979.198) -- 0:00:10 Average standard deviation of split frequencies: 0.008045 835500 -- [-976.980] (-976.470) (-976.359) (-977.231) * [-976.715] (-977.186) (-978.875) (-979.359) -- 0:00:10 836000 -- [-976.631] (-978.015) (-977.631) (-979.695) * (-978.959) (-976.221) [-981.418] (-982.790) -- 0:00:10 836500 -- [-981.355] (-976.790) (-977.638) (-977.713) * (-980.926) (-976.844) (-982.112) [-978.617] -- 0:00:10 837000 -- [-978.919] (-978.898) (-982.490) (-982.624) * (-978.981) (-978.246) (-978.523) [-977.342] -- 0:00:10 837500 -- (-978.757) (-980.488) (-981.392) [-977.789] * [-980.610] (-979.233) (-977.306) (-977.431) -- 0:00:10 838000 -- (-978.166) (-976.814) (-981.431) [-976.630] * (-986.021) [-977.826] (-976.496) (-977.284) -- 0:00:10 838500 -- [-977.009] (-976.397) (-977.390) (-978.920) * (-982.184) (-977.048) (-979.247) [-979.379] -- 0:00:10 839000 -- (-978.827) (-975.962) (-977.660) [-979.777] * [-978.112] (-977.251) (-978.086) (-977.238) -- 0:00:09 839500 -- (-979.185) (-975.952) (-977.987) [-981.092] * (-978.763) (-976.396) (-979.777) [-980.870] -- 0:00:09 840000 -- (-977.664) [-976.989] (-978.713) (-978.782) * (-978.742) [-976.301] (-980.337) (-978.569) -- 0:00:09 Average standard deviation of split frequencies: 0.008037 840500 -- (-978.675) [-985.604] (-977.268) (-977.124) * (-978.585) (-977.106) (-981.828) [-976.960] -- 0:00:09 841000 -- (-979.459) (-976.981) (-978.457) [-978.524] * (-979.629) (-976.647) [-977.128] (-976.407) -- 0:00:09 841500 -- [-979.504] (-976.561) (-977.087) (-977.788) * (-978.379) [-978.398] (-980.308) (-976.750) -- 0:00:09 842000 -- [-979.725] (-980.144) (-977.911) (-978.282) * [-976.154] (-978.733) (-977.344) (-979.606) -- 0:00:09 842500 -- (-979.650) (-978.570) [-976.968] (-978.480) * [-976.943] (-984.508) (-977.477) (-978.780) -- 0:00:09 843000 -- (-981.174) (-978.692) (-977.627) [-976.224] * [-979.027] (-977.553) (-977.408) (-976.836) -- 0:00:09 843500 -- (-979.500) (-977.188) [-979.414] (-976.628) * (-983.292) [-977.954] (-976.939) (-977.135) -- 0:00:09 844000 -- (-982.212) (-983.346) [-978.780] (-977.628) * (-981.897) (-978.299) [-975.893] (-976.990) -- 0:00:09 844500 -- [-980.182] (-977.706) (-978.621) (-980.773) * (-979.002) [-981.215] (-977.204) (-976.785) -- 0:00:09 845000 -- [-979.472] (-978.207) (-979.150) (-978.341) * (-978.438) (-978.700) [-976.997] (-980.347) -- 0:00:09 Average standard deviation of split frequencies: 0.008284 845500 -- (-977.094) (-982.579) (-976.728) [-978.450] * (-977.239) (-978.814) [-978.912] (-979.024) -- 0:00:09 846000 -- (-984.688) (-981.659) [-978.501] (-977.871) * (-979.214) (-978.108) [-979.764] (-979.204) -- 0:00:09 846500 -- (-984.594) (-980.012) (-978.623) [-976.489] * (-979.426) [-977.907] (-981.139) (-980.489) -- 0:00:09 847000 -- [-979.656] (-978.539) (-977.039) (-982.712) * (-978.971) [-977.302] (-979.818) (-977.502) -- 0:00:09 847500 -- (-978.966) [-976.613] (-978.760) (-978.658) * [-977.229] (-977.583) (-980.954) (-977.093) -- 0:00:09 848000 -- [-977.855] (-984.550) (-980.915) (-977.486) * (-977.178) (-978.610) [-977.139] (-977.839) -- 0:00:09 848500 -- [-976.785] (-976.388) (-978.392) (-977.174) * (-977.311) (-980.776) (-976.753) [-977.781] -- 0:00:09 849000 -- (-977.520) (-982.356) (-978.263) [-977.934] * (-976.695) (-977.084) (-976.843) [-976.381] -- 0:00:09 849500 -- (-978.007) [-979.248] (-977.495) (-976.375) * (-977.243) (-976.492) [-978.912] (-984.078) -- 0:00:09 850000 -- [-978.224] (-977.569) (-978.546) (-977.177) * (-977.168) (-978.253) [-977.255] (-979.146) -- 0:00:09 Average standard deviation of split frequencies: 0.007241 850500 -- [-977.828] (-979.896) (-977.680) (-976.322) * (-977.137) [-977.394] (-977.903) (-977.951) -- 0:00:09 851000 -- (-978.955) (-979.484) [-978.231] (-980.052) * [-976.630] (-976.210) (-978.358) (-981.170) -- 0:00:09 851500 -- (-977.566) (-976.513) (-977.918) [-976.978] * (-978.682) [-976.562] (-977.208) (-981.357) -- 0:00:09 852000 -- (-977.741) [-976.746] (-978.810) (-977.281) * (-978.686) (-977.699) (-978.114) [-981.073] -- 0:00:09 852500 -- (-976.295) [-981.271] (-978.598) (-976.753) * (-979.232) (-976.252) (-977.105) [-979.039] -- 0:00:09 853000 -- (-978.429) (-984.422) (-977.092) [-976.984] * (-976.959) (-981.388) [-978.558] (-979.736) -- 0:00:09 853500 -- (-976.974) [-979.795] (-976.781) (-977.021) * (-978.172) [-977.678] (-977.101) (-978.368) -- 0:00:09 854000 -- (-976.136) (-978.297) [-977.874] (-980.259) * [-978.305] (-980.359) (-978.995) (-978.288) -- 0:00:09 854500 -- (-982.507) (-983.146) [-977.791] (-981.895) * (-979.829) (-982.013) [-979.776] (-977.528) -- 0:00:09 855000 -- (-981.135) (-976.539) (-976.731) [-977.995] * (-978.816) [-978.494] (-980.185) (-977.285) -- 0:00:08 Average standard deviation of split frequencies: 0.007416 855500 -- (-979.710) (-977.125) [-977.644] (-977.613) * (-979.459) [-976.265] (-977.316) (-976.259) -- 0:00:08 856000 -- (-979.737) (-978.614) [-976.861] (-976.570) * (-976.247) [-976.261] (-977.530) (-979.336) -- 0:00:08 856500 -- (-980.766) (-977.501) [-976.536] (-977.690) * (-976.783) [-977.138] (-977.255) (-979.315) -- 0:00:08 857000 -- (-977.492) [-977.169] (-976.469) (-977.486) * [-976.884] (-976.579) (-980.375) (-978.129) -- 0:00:08 857500 -- (-980.743) (-977.651) (-977.359) [-976.276] * (-977.758) (-978.919) (-979.988) [-979.166] -- 0:00:08 858000 -- (-982.507) (-977.783) (-979.706) [-979.917] * (-977.635) (-976.624) [-978.077] (-981.507) -- 0:00:08 858500 -- (-979.338) (-978.439) (-981.809) [-978.108] * (-980.219) (-976.476) (-977.366) [-979.530] -- 0:00:08 859000 -- (-978.426) (-978.704) (-982.434) [-978.513] * (-979.558) (-976.447) [-977.475] (-977.407) -- 0:00:08 859500 -- (-979.088) [-977.774] (-979.990) (-977.619) * [-977.786] (-976.469) (-979.785) (-979.240) -- 0:00:08 860000 -- (-978.450) (-976.843) (-979.747) [-977.342] * (-979.768) (-980.788) [-978.085] (-978.006) -- 0:00:08 Average standard deviation of split frequencies: 0.007266 860500 -- (-976.844) (-977.425) (-979.228) [-976.792] * (-977.943) (-979.351) [-978.216] (-979.529) -- 0:00:08 861000 -- (-976.292) (-977.710) (-977.945) [-977.765] * (-980.260) (-982.296) [-980.322] (-978.955) -- 0:00:08 861500 -- (-981.622) [-977.575] (-982.694) (-977.514) * [-977.631] (-980.746) (-980.453) (-980.599) -- 0:00:08 862000 -- (-979.957) [-980.139] (-981.512) (-977.996) * (-980.554) (-975.885) [-977.963] (-978.745) -- 0:00:08 862500 -- [-976.463] (-979.482) (-979.383) (-977.499) * [-979.074] (-978.037) (-976.705) (-977.636) -- 0:00:08 863000 -- (-977.801) [-978.101] (-979.154) (-976.918) * (-976.579) [-977.028] (-977.120) (-977.643) -- 0:00:08 863500 -- (-979.258) (-976.535) (-978.169) [-978.543] * (-977.016) (-976.192) (-979.244) [-980.197] -- 0:00:08 864000 -- (-980.588) [-977.599] (-979.611) (-979.963) * (-981.513) (-977.339) [-980.006] (-978.408) -- 0:00:08 864500 -- (-982.682) (-977.250) (-981.567) [-978.836] * (-978.978) (-978.923) (-980.428) [-977.868] -- 0:00:08 865000 -- (-982.582) (-977.686) [-978.960] (-976.074) * (-977.816) (-977.792) [-978.949] (-976.970) -- 0:00:08 Average standard deviation of split frequencies: 0.006895 865500 -- (-976.492) (-975.936) (-976.614) [-976.374] * (-976.422) [-978.913] (-979.137) (-976.108) -- 0:00:08 866000 -- (-976.532) (-975.947) [-978.712] (-977.685) * (-976.013) [-979.737] (-979.940) (-981.904) -- 0:00:08 866500 -- (-977.324) (-977.383) (-977.393) [-976.909] * (-976.684) [-977.401] (-982.347) (-980.465) -- 0:00:08 867000 -- (-977.302) [-976.964] (-976.393) (-978.598) * [-977.084] (-977.517) (-981.238) (-982.882) -- 0:00:08 867500 -- (-976.851) [-981.765] (-977.028) (-976.729) * [-976.775] (-981.056) (-981.136) (-978.302) -- 0:00:08 868000 -- (-976.675) (-979.233) [-976.699] (-977.372) * (-978.669) (-980.525) (-981.232) [-981.857] -- 0:00:08 868500 -- (-976.925) (-979.516) [-976.639] (-977.372) * (-978.717) (-978.278) [-976.545] (-980.234) -- 0:00:08 869000 -- (-977.841) (-977.159) [-977.086] (-976.721) * (-977.112) [-977.542] (-979.136) (-977.887) -- 0:00:08 869500 -- (-979.796) (-977.205) (-977.420) [-976.757] * [-977.850] (-978.718) (-980.115) (-978.716) -- 0:00:08 870000 -- [-979.703] (-977.806) (-976.742) (-978.349) * [-978.520] (-979.944) (-978.850) (-978.249) -- 0:00:08 Average standard deviation of split frequencies: 0.007111 870500 -- [-977.574] (-977.720) (-977.945) (-978.389) * (-976.732) (-976.776) (-977.433) [-977.338] -- 0:00:08 871000 -- [-977.036] (-976.981) (-976.673) (-980.163) * [-977.986] (-979.534) (-979.644) (-978.003) -- 0:00:07 871500 -- (-977.681) (-981.560) (-977.667) [-978.163] * [-977.545] (-979.111) (-977.932) (-979.503) -- 0:00:07 872000 -- [-978.042] (-982.437) (-982.873) (-978.204) * (-978.680) (-976.466) [-977.926] (-983.127) -- 0:00:07 872500 -- (-977.004) (-978.551) [-977.241] (-978.557) * (-977.315) [-977.013] (-982.363) (-983.391) -- 0:00:07 873000 -- [-979.741] (-977.314) (-978.077) (-980.025) * (-978.587) [-977.264] (-981.330) (-986.983) -- 0:00:07 873500 -- (-977.013) [-977.833] (-978.781) (-978.974) * [-977.872] (-978.069) (-977.828) (-978.436) -- 0:00:07 874000 -- (-979.433) [-979.185] (-982.497) (-977.269) * (-977.106) [-976.338] (-980.909) (-977.256) -- 0:00:07 874500 -- (-978.349) [-979.518] (-979.491) (-979.784) * (-979.161) (-977.501) [-977.580] (-976.366) -- 0:00:07 875000 -- (-976.919) [-978.119] (-978.051) (-978.879) * (-975.899) (-980.407) (-977.675) [-976.357] -- 0:00:07 Average standard deviation of split frequencies: 0.006996 875500 -- (-979.493) (-978.519) [-976.935] (-978.662) * [-976.906] (-981.323) (-976.943) (-976.999) -- 0:00:07 876000 -- (-977.516) (-978.108) [-976.874] (-979.141) * (-979.285) (-978.723) [-981.866] (-976.752) -- 0:00:07 876500 -- [-978.918] (-982.291) (-982.454) (-977.797) * [-977.358] (-981.059) (-982.660) (-978.000) -- 0:00:07 877000 -- [-980.441] (-975.979) (-978.326) (-978.868) * [-976.856] (-980.421) (-977.662) (-977.847) -- 0:00:07 877500 -- (-979.849) (-976.083) (-978.159) [-978.627] * (-976.080) [-983.316] (-978.920) (-979.719) -- 0:00:07 878000 -- (-978.722) [-976.226] (-978.068) (-979.425) * (-978.208) (-982.505) [-981.161] (-978.064) -- 0:00:07 878500 -- (-987.114) (-979.863) (-976.954) [-978.895] * (-977.015) (-979.864) [-980.692] (-978.167) -- 0:00:07 879000 -- (-981.198) [-978.797] (-979.647) (-980.070) * [-977.915] (-978.310) (-979.831) (-979.177) -- 0:00:07 879500 -- [-979.857] (-976.997) (-978.021) (-981.221) * (-977.187) (-977.818) [-980.318] (-976.388) -- 0:00:07 880000 -- (-977.215) (-980.587) [-976.741] (-978.558) * (-979.930) (-977.524) [-976.282] (-979.732) -- 0:00:07 Average standard deviation of split frequencies: 0.006923 880500 -- (-984.332) [-978.496] (-977.411) (-978.859) * (-976.686) [-977.751] (-981.884) (-978.065) -- 0:00:07 881000 -- (-982.843) (-977.200) [-978.552] (-977.839) * (-976.989) (-976.362) [-980.875] (-976.363) -- 0:00:07 881500 -- [-977.265] (-978.787) (-977.793) (-979.856) * [-976.369] (-977.218) (-980.766) (-978.129) -- 0:00:07 882000 -- [-977.427] (-983.659) (-977.298) (-976.844) * (-977.476) (-979.046) [-981.598] (-978.033) -- 0:00:07 882500 -- (-977.437) (-979.742) (-981.375) [-977.338] * [-978.795] (-978.233) (-980.010) (-976.478) -- 0:00:07 883000 -- (-980.867) [-978.788] (-975.937) (-978.578) * [-981.182] (-978.417) (-976.832) (-976.783) -- 0:00:07 883500 -- (-979.622) (-978.425) [-977.230] (-977.410) * (-978.473) [-979.913] (-978.370) (-977.199) -- 0:00:07 884000 -- [-985.530] (-977.552) (-978.233) (-976.804) * (-977.958) (-978.466) [-976.344] (-977.553) -- 0:00:07 884500 -- (-979.536) [-979.676] (-979.251) (-976.774) * (-977.902) (-980.093) (-977.562) [-977.033] -- 0:00:07 885000 -- (-977.316) (-980.578) (-978.119) [-976.810] * (-981.177) [-979.692] (-977.030) (-977.645) -- 0:00:07 Average standard deviation of split frequencies: 0.006881 885500 -- (-979.162) [-976.691] (-978.601) (-978.705) * (-977.930) [-977.451] (-977.089) (-980.536) -- 0:00:07 886000 -- [-976.605] (-977.617) (-978.429) (-976.955) * (-977.186) [-978.881] (-977.743) (-981.584) -- 0:00:07 886500 -- (-977.328) (-977.343) (-978.542) [-981.440] * (-977.623) (-979.213) [-976.616] (-983.104) -- 0:00:07 887000 -- (-977.425) (-979.000) (-977.046) [-976.514] * (-977.411) [-979.338] (-977.850) (-977.537) -- 0:00:07 887500 -- [-978.444] (-979.555) (-978.293) (-978.287) * (-977.453) (-979.762) (-977.091) [-979.679] -- 0:00:06 888000 -- (-976.982) [-978.483] (-976.938) (-980.773) * (-979.337) [-981.064] (-976.598) (-979.910) -- 0:00:06 888500 -- [-976.433] (-976.487) (-979.083) (-980.338) * [-980.366] (-979.216) (-976.391) (-977.996) -- 0:00:06 889000 -- (-976.972) [-979.033] (-977.823) (-978.424) * [-976.213] (-978.010) (-977.963) (-979.735) -- 0:00:06 889500 -- (-978.746) (-978.334) [-976.875] (-976.788) * (-978.798) (-978.354) (-980.192) [-979.579] -- 0:00:06 890000 -- (-979.408) [-977.508] (-978.861) (-977.311) * (-981.629) [-977.866] (-982.896) (-981.716) -- 0:00:06 Average standard deviation of split frequencies: 0.006916 890500 -- [-978.405] (-976.952) (-976.686) (-978.282) * (-980.189) (-976.512) [-978.858] (-978.340) -- 0:00:06 891000 -- [-977.133] (-977.730) (-978.210) (-978.331) * (-982.320) (-978.004) (-981.259) [-979.585] -- 0:00:06 891500 -- (-976.872) (-979.095) [-977.021] (-979.665) * (-978.168) (-979.759) [-980.853] (-979.515) -- 0:00:06 892000 -- (-977.193) (-978.486) (-981.794) [-979.939] * (-977.065) (-977.532) [-979.786] (-980.408) -- 0:00:06 892500 -- [-977.253] (-979.135) (-980.010) (-976.783) * (-976.767) [-977.401] (-978.109) (-981.725) -- 0:00:06 893000 -- (-978.974) [-977.825] (-976.740) (-979.390) * (-980.454) (-980.229) [-976.016] (-981.250) -- 0:00:06 893500 -- [-979.324] (-976.121) (-977.221) (-977.756) * (-978.472) (-979.120) [-976.605] (-979.212) -- 0:00:06 894000 -- (-976.735) [-975.900] (-978.480) (-978.113) * (-976.643) [-979.410] (-976.233) (-978.809) -- 0:00:06 894500 -- (-976.602) [-978.754] (-977.484) (-981.566) * (-978.633) [-979.303] (-978.153) (-979.712) -- 0:00:06 895000 -- (-977.057) [-976.771] (-976.342) (-978.852) * (-981.536) (-978.926) [-976.287] (-979.305) -- 0:00:06 Average standard deviation of split frequencies: 0.007225 895500 -- [-977.653] (-977.158) (-978.339) (-979.771) * [-976.591] (-976.141) (-976.038) (-976.439) -- 0:00:06 896000 -- (-980.904) [-977.128] (-976.603) (-979.236) * (-977.723) (-977.238) [-977.736] (-979.544) -- 0:00:06 896500 -- [-976.769] (-977.607) (-978.921) (-976.550) * (-977.605) (-979.665) (-978.002) [-981.513] -- 0:00:06 897000 -- (-980.518) (-979.880) [-978.087] (-980.205) * (-979.894) [-978.386] (-977.962) (-979.791) -- 0:00:06 897500 -- (-976.805) (-977.857) (-979.043) [-978.116] * (-981.731) (-978.775) (-976.903) [-979.841] -- 0:00:06 898000 -- (-979.503) (-978.424) [-985.418] (-977.080) * (-979.524) [-979.074] (-978.504) (-978.645) -- 0:00:06 898500 -- (-978.394) [-978.920] (-986.016) (-977.212) * (-978.545) (-977.525) [-978.345] (-977.075) -- 0:00:06 899000 -- (-979.069) [-981.429] (-987.852) (-982.353) * (-977.315) (-978.457) (-978.873) [-977.530] -- 0:00:06 899500 -- (-978.822) (-979.815) (-978.358) [-978.800] * [-979.178] (-977.223) (-978.059) (-978.886) -- 0:00:06 900000 -- (-977.445) (-977.344) [-982.254] (-982.282) * [-976.240] (-977.304) (-978.086) (-977.011) -- 0:00:06 Average standard deviation of split frequencies: 0.006909 900500 -- (-977.461) (-980.388) [-978.778] (-981.279) * (-979.182) (-976.705) [-977.964] (-979.760) -- 0:00:06 901000 -- (-979.790) (-977.066) (-977.469) [-978.438] * (-978.997) [-976.360] (-977.284) (-980.420) -- 0:00:06 901500 -- [-980.109] (-977.243) (-976.497) (-979.607) * (-978.595) (-979.390) [-977.119] (-978.622) -- 0:00:06 902000 -- (-976.978) (-976.858) [-976.668] (-977.911) * [-977.285] (-979.019) (-977.235) (-977.180) -- 0:00:06 902500 -- (-976.863) [-977.177] (-978.071) (-977.706) * (-976.300) (-979.399) (-981.162) [-979.063] -- 0:00:06 903000 -- (-977.027) [-976.579] (-977.591) (-976.491) * [-977.328] (-978.959) (-976.360) (-976.398) -- 0:00:06 903500 -- (-978.459) (-977.739) (-977.332) [-976.724] * (-983.070) (-979.690) [-978.314] (-979.216) -- 0:00:05 904000 -- [-977.642] (-978.890) (-979.516) (-976.864) * [-978.982] (-978.622) (-980.500) (-977.750) -- 0:00:05 904500 -- [-977.520] (-981.188) (-978.042) (-977.277) * (-976.756) (-984.723) (-978.579) [-979.222] -- 0:00:05 905000 -- (-977.493) [-977.891] (-980.579) (-979.326) * (-980.018) [-978.590] (-977.726) (-983.279) -- 0:00:05 Average standard deviation of split frequencies: 0.006972 905500 -- [-978.196] (-978.484) (-979.320) (-978.322) * (-980.752) (-977.121) [-977.468] (-980.891) -- 0:00:05 906000 -- (-979.122) (-976.317) (-980.375) [-978.930] * [-978.715] (-976.566) (-977.776) (-979.752) -- 0:00:05 906500 -- (-978.036) (-979.534) (-980.273) [-978.297] * [-977.093] (-984.015) (-981.813) (-976.675) -- 0:00:05 907000 -- (-980.354) (-978.023) (-983.700) [-977.940] * (-977.140) (-979.287) (-980.379) [-977.443] -- 0:00:05 907500 -- (-976.914) [-979.424] (-980.267) (-976.671) * (-977.564) [-979.397] (-977.423) (-977.287) -- 0:00:05 908000 -- (-976.422) [-979.485] (-981.106) (-978.981) * [-979.979] (-980.353) (-976.330) (-978.571) -- 0:00:05 908500 -- [-976.610] (-980.577) (-978.618) (-985.833) * (-977.435) (-978.167) (-976.147) [-980.698] -- 0:00:05 909000 -- (-981.566) (-979.581) (-977.281) [-978.661] * (-977.944) (-977.624) (-976.874) [-982.017] -- 0:00:05 909500 -- (-977.057) (-979.360) (-976.701) [-977.500] * [-978.534] (-978.489) (-978.984) (-978.720) -- 0:00:05 910000 -- (-979.088) (-978.950) (-977.557) [-977.571] * (-977.860) (-982.559) [-979.950] (-977.806) -- 0:00:05 Average standard deviation of split frequencies: 0.006902 910500 -- (-977.854) (-976.680) (-978.895) [-977.614] * [-976.154] (-977.336) (-978.673) (-979.308) -- 0:00:05 911000 -- [-977.505] (-979.927) (-979.018) (-978.314) * [-977.874] (-976.766) (-977.057) (-977.193) -- 0:00:05 911500 -- [-978.611] (-977.825) (-980.100) (-978.030) * (-976.673) (-979.552) (-980.263) [-977.510] -- 0:00:05 912000 -- (-977.974) (-978.331) [-979.973] (-977.841) * (-977.179) (-977.259) (-976.959) [-977.844] -- 0:00:05 912500 -- [-979.196] (-978.216) (-978.665) (-977.057) * [-977.484] (-977.492) (-978.306) (-977.057) -- 0:00:05 913000 -- (-978.737) (-977.475) [-978.813] (-977.552) * (-979.120) (-978.222) [-977.315] (-978.542) -- 0:00:05 913500 -- (-980.324) [-977.098] (-979.753) (-978.115) * (-979.837) [-978.706] (-977.371) (-976.863) -- 0:00:05 914000 -- (-981.451) (-976.349) [-981.669] (-980.647) * (-978.765) [-978.615] (-976.671) (-978.025) -- 0:00:05 914500 -- (-979.233) (-979.922) [-978.946] (-979.839) * (-980.186) (-980.510) [-976.494] (-977.426) -- 0:00:05 915000 -- [-976.509] (-976.869) (-976.022) (-976.910) * (-976.857) (-978.306) [-976.641] (-980.433) -- 0:00:05 Average standard deviation of split frequencies: 0.006965 915500 -- (-980.160) [-979.976] (-977.039) (-976.596) * (-978.539) (-977.764) (-977.751) [-976.902] -- 0:00:05 916000 -- (-977.634) (-978.577) (-978.001) [-975.911] * (-979.147) (-979.440) [-976.847] (-978.951) -- 0:00:05 916500 -- (-977.168) (-976.108) [-978.029] (-981.217) * (-977.034) [-982.457] (-978.332) (-979.632) -- 0:00:05 917000 -- (-978.496) (-978.043) [-978.216] (-982.081) * (-976.526) [-978.348] (-980.410) (-976.489) -- 0:00:05 917500 -- (-977.747) [-977.500] (-979.018) (-978.274) * (-976.741) [-980.058] (-977.472) (-977.248) -- 0:00:05 918000 -- [-978.906] (-976.813) (-979.167) (-977.687) * [-977.343] (-980.704) (-976.195) (-976.990) -- 0:00:05 918500 -- (-977.995) (-976.640) (-980.962) [-977.699] * [-978.654] (-980.973) (-976.346) (-977.505) -- 0:00:05 919000 -- (-977.252) [-979.436] (-978.307) (-978.414) * (-975.804) (-982.008) (-976.277) [-976.552] -- 0:00:05 919500 -- [-977.303] (-976.557) (-977.872) (-982.362) * [-977.515] (-984.955) (-976.541) (-977.255) -- 0:00:04 920000 -- (-976.871) (-981.672) [-977.123] (-979.480) * (-978.313) (-979.148) [-977.264] (-977.796) -- 0:00:04 Average standard deviation of split frequencies: 0.006588 920500 -- (-977.242) (-978.445) (-976.198) [-977.597] * (-980.717) [-981.965] (-978.300) (-978.003) -- 0:00:04 921000 -- (-980.699) [-978.656] (-977.511) (-978.412) * (-977.116) (-977.705) (-981.320) [-976.820] -- 0:00:04 921500 -- [-976.930] (-976.901) (-977.048) (-977.535) * (-982.838) (-978.774) (-979.037) [-976.399] -- 0:00:04 922000 -- (-976.468) (-978.584) [-978.924] (-976.651) * [-978.912] (-976.617) (-977.745) (-977.879) -- 0:00:04 922500 -- [-979.546] (-979.116) (-977.706) (-978.403) * (-978.143) [-976.676] (-977.143) (-981.091) -- 0:00:04 923000 -- [-981.446] (-976.609) (-978.898) (-979.347) * (-976.532) [-978.396] (-977.357) (-986.030) -- 0:00:04 923500 -- (-977.277) (-976.869) (-976.445) [-978.294] * [-977.526] (-981.442) (-978.224) (-980.336) -- 0:00:04 924000 -- (-978.217) (-977.146) [-977.616] (-979.081) * [-978.123] (-979.108) (-977.252) (-980.839) -- 0:00:04 924500 -- (-976.077) (-977.246) [-977.955] (-981.420) * (-979.186) [-978.954] (-981.607) (-978.437) -- 0:00:04 925000 -- [-976.023] (-980.488) (-978.732) (-976.734) * (-978.784) (-977.970) [-980.698] (-979.809) -- 0:00:04 Average standard deviation of split frequencies: 0.006414 925500 -- (-979.024) [-978.327] (-980.068) (-977.188) * [-977.468] (-979.206) (-978.949) (-977.240) -- 0:00:04 926000 -- (-981.950) (-979.218) (-977.964) [-979.411] * (-981.694) (-977.121) [-978.300] (-983.368) -- 0:00:04 926500 -- (-978.112) [-977.609] (-981.235) (-980.996) * (-978.058) [-978.989] (-979.262) (-976.854) -- 0:00:04 927000 -- [-979.501] (-977.542) (-978.876) (-979.409) * (-978.942) (-977.298) [-979.482] (-976.644) -- 0:00:04 927500 -- [-978.265] (-976.822) (-977.998) (-978.652) * (-978.803) (-976.088) [-977.642] (-977.914) -- 0:00:04 928000 -- [-977.515] (-976.805) (-978.653) (-978.678) * (-977.454) [-976.652] (-977.868) (-984.573) -- 0:00:04 928500 -- (-977.204) [-979.954] (-978.384) (-977.890) * (-977.395) [-978.640] (-981.527) (-982.650) -- 0:00:04 929000 -- [-978.075] (-980.373) (-978.764) (-977.748) * (-977.497) (-977.706) (-980.549) [-977.460] -- 0:00:04 929500 -- (-977.501) (-977.511) (-977.375) [-977.562] * [-977.416] (-977.461) (-978.029) (-978.813) -- 0:00:04 930000 -- (-978.417) (-979.445) [-977.669] (-977.179) * (-979.384) [-976.309] (-976.281) (-977.484) -- 0:00:04 Average standard deviation of split frequencies: 0.006450 930500 -- (-978.338) (-977.227) (-977.633) [-978.512] * (-979.025) (-978.648) [-976.128] (-977.624) -- 0:00:04 931000 -- (-976.132) (-976.222) [-977.173] (-978.483) * (-979.365) [-978.629] (-976.236) (-977.064) -- 0:00:04 931500 -- [-976.416] (-976.391) (-976.788) (-978.020) * [-978.624] (-979.066) (-978.008) (-977.276) -- 0:00:04 932000 -- [-977.290] (-978.736) (-976.862) (-977.102) * (-980.195) [-978.784] (-979.981) (-977.186) -- 0:00:04 932500 -- (-977.143) (-981.560) (-976.944) [-979.322] * (-978.724) (-977.277) [-977.456] (-978.564) -- 0:00:04 933000 -- [-977.559] (-983.377) (-977.141) (-977.412) * (-976.781) (-976.946) [-978.892] (-978.836) -- 0:00:04 933500 -- [-978.066] (-976.307) (-976.204) (-977.876) * (-980.435) (-978.517) (-976.371) [-978.577] -- 0:00:04 934000 -- (-978.116) (-976.216) (-978.486) [-978.096] * (-980.519) (-976.687) (-975.951) [-978.173] -- 0:00:04 934500 -- (-978.997) [-979.047] (-979.481) (-978.386) * [-980.721] (-978.625) (-978.141) (-977.320) -- 0:00:04 935000 -- [-978.058] (-979.779) (-979.284) (-977.938) * (-978.461) [-977.590] (-979.576) (-976.734) -- 0:00:04 Average standard deviation of split frequencies: 0.006346 935500 -- (-979.681) (-978.017) [-978.886] (-983.490) * (-982.531) [-978.077] (-977.974) (-977.057) -- 0:00:03 936000 -- [-978.716] (-976.740) (-976.477) (-978.024) * (-977.726) (-980.112) [-977.825] (-978.964) -- 0:00:03 936500 -- [-976.472] (-980.754) (-977.969) (-977.655) * (-977.023) (-978.614) (-977.872) [-977.077] -- 0:00:03 937000 -- (-979.899) (-981.897) (-978.200) [-978.504] * [-977.242] (-983.067) (-976.782) (-976.833) -- 0:00:03 937500 -- (-976.171) (-977.577) [-976.798] (-976.883) * (-977.324) [-977.092] (-978.182) (-977.272) -- 0:00:03 938000 -- (-976.963) (-977.221) [-976.942] (-976.825) * [-982.465] (-976.482) (-976.569) (-977.583) -- 0:00:03 938500 -- (-978.569) (-977.878) [-978.424] (-982.623) * (-977.313) [-976.583] (-981.477) (-976.693) -- 0:00:03 939000 -- [-978.096] (-979.523) (-978.139) (-980.238) * (-977.944) (-980.257) (-976.763) [-978.964] -- 0:00:03 939500 -- (-977.978) (-979.051) (-978.087) [-977.873] * (-977.577) (-977.258) (-976.679) [-977.953] -- 0:00:03 940000 -- (-978.418) (-976.868) [-978.512] (-977.194) * (-977.619) (-976.801) (-976.995) [-977.221] -- 0:00:03 Average standard deviation of split frequencies: 0.006448 940500 -- [-976.666] (-976.538) (-976.744) (-976.933) * [-978.150] (-981.795) (-980.053) (-977.331) -- 0:00:03 941000 -- (-978.992) (-976.141) [-976.962] (-977.152) * (-978.778) (-978.302) [-976.429] (-977.588) -- 0:00:03 941500 -- (-978.443) (-976.417) (-978.668) [-977.630] * (-977.156) (-978.374) (-976.607) [-979.378] -- 0:00:03 942000 -- (-980.407) (-976.806) (-978.145) [-977.463] * (-983.178) (-978.166) (-976.791) [-976.950] -- 0:00:03 942500 -- (-978.084) (-979.644) (-983.143) [-978.129] * (-983.870) (-977.481) (-976.530) [-981.776] -- 0:00:03 943000 -- [-976.049] (-977.156) (-977.749) (-979.126) * (-979.796) (-977.916) [-976.382] (-976.368) -- 0:00:03 943500 -- [-977.419] (-977.852) (-977.749) (-978.232) * (-981.972) (-982.206) [-976.765] (-977.895) -- 0:00:03 944000 -- [-980.095] (-979.134) (-980.201) (-978.067) * (-977.503) [-978.699] (-980.050) (-978.486) -- 0:00:03 944500 -- (-980.748) [-981.546] (-979.765) (-977.035) * (-976.697) (-978.764) (-978.255) [-978.702] -- 0:00:03 945000 -- (-980.240) (-977.126) (-976.641) [-978.073] * [-977.459] (-977.132) (-978.017) (-977.459) -- 0:00:03 Average standard deviation of split frequencies: 0.006777 945500 -- (-977.016) [-982.210] (-978.853) (-976.498) * (-976.940) (-980.444) (-978.361) [-976.559] -- 0:00:03 946000 -- (-979.823) [-979.729] (-978.908) (-976.520) * (-977.623) (-979.626) (-981.582) [-978.658] -- 0:00:03 946500 -- (-978.725) [-978.595] (-980.349) (-978.405) * (-977.666) (-976.644) [-977.313] (-976.119) -- 0:00:03 947000 -- (-977.290) (-976.796) (-977.761) [-976.947] * [-976.620] (-976.774) (-981.944) (-977.853) -- 0:00:03 947500 -- [-977.684] (-983.669) (-977.460) (-979.117) * (-978.744) [-977.910] (-978.207) (-977.259) -- 0:00:03 948000 -- (-982.183) (-987.825) [-978.303] (-978.994) * (-977.421) (-977.802) [-978.068] (-977.429) -- 0:00:03 948500 -- (-977.266) (-977.146) (-980.397) [-978.229] * (-980.474) (-979.887) [-977.327] (-982.376) -- 0:00:03 949000 -- (-976.688) [-979.110] (-983.448) (-978.886) * (-986.135) [-977.715] (-976.768) (-978.620) -- 0:00:03 949500 -- (-976.902) (-979.159) (-982.123) [-979.599] * (-980.148) (-980.131) (-977.315) [-977.989] -- 0:00:03 950000 -- (-976.648) (-980.312) (-981.264) [-977.168] * (-977.912) (-978.766) (-977.056) [-976.419] -- 0:00:03 Average standard deviation of split frequencies: 0.006545 950500 -- (-980.906) (-977.405) (-978.599) [-976.239] * (-976.942) (-980.348) [-976.825] (-976.203) -- 0:00:03 951000 -- (-980.477) (-977.920) [-980.098] (-979.383) * (-979.201) [-977.653] (-978.447) (-978.780) -- 0:00:03 951500 -- [-976.764] (-979.001) (-977.832) (-980.009) * (-976.552) (-983.479) [-978.045] (-979.361) -- 0:00:03 952000 -- (-980.357) (-978.457) [-978.037] (-978.045) * (-978.975) [-979.297] (-976.938) (-980.990) -- 0:00:02 952500 -- (-979.804) (-977.282) [-978.177] (-977.731) * (-976.728) [-976.508] (-977.239) (-978.580) -- 0:00:02 953000 -- (-977.442) (-979.153) (-977.733) [-977.129] * (-977.903) (-977.808) (-977.181) [-977.481] -- 0:00:02 953500 -- [-977.470] (-979.266) (-977.150) (-976.427) * [-979.226] (-980.577) (-976.441) (-979.571) -- 0:00:02 954000 -- [-976.860] (-979.425) (-976.579) (-977.520) * [-979.122] (-980.769) (-977.822) (-977.650) -- 0:00:02 954500 -- (-977.692) (-981.480) [-976.379] (-977.089) * (-979.462) (-977.979) [-981.262] (-977.867) -- 0:00:02 955000 -- (-979.694) (-977.105) (-976.179) [-976.633] * (-978.067) (-977.293) [-979.536] (-982.921) -- 0:00:02 Average standard deviation of split frequencies: 0.006180 955500 -- (-978.127) (-980.953) [-979.631] (-978.542) * (-980.131) (-979.355) [-977.758] (-977.255) -- 0:00:02 956000 -- (-978.629) (-982.241) (-978.203) [-979.598] * (-978.706) [-978.803] (-977.900) (-979.742) -- 0:00:02 956500 -- (-978.110) (-977.523) [-979.958] (-977.579) * (-977.720) [-978.651] (-976.988) (-976.243) -- 0:00:02 957000 -- (-976.614) (-978.996) (-976.871) [-978.324] * (-977.138) [-977.614] (-977.393) (-978.334) -- 0:00:02 957500 -- (-978.182) (-978.416) [-976.667] (-979.713) * (-978.312) (-977.696) (-979.228) [-978.098] -- 0:00:02 958000 -- (-977.531) (-978.958) [-976.005] (-980.739) * (-977.026) (-978.392) (-978.039) [-977.550] -- 0:00:02 958500 -- [-976.824] (-979.255) (-978.010) (-980.842) * (-978.424) [-979.528] (-977.651) (-976.526) -- 0:00:02 959000 -- (-977.007) [-976.958] (-977.392) (-978.626) * (-977.296) [-980.936] (-978.723) (-978.494) -- 0:00:02 959500 -- (-979.988) [-976.527] (-977.694) (-981.886) * [-978.683] (-981.686) (-979.825) (-979.500) -- 0:00:02 960000 -- [-978.014] (-976.153) (-978.980) (-980.006) * [-976.963] (-977.541) (-979.890) (-977.277) -- 0:00:02 Average standard deviation of split frequencies: 0.005725 960500 -- (-977.258) (-977.374) (-979.374) [-978.114] * (-979.535) (-977.302) [-979.291] (-976.509) -- 0:00:02 961000 -- (-978.922) [-978.079] (-976.786) (-978.399) * (-979.044) (-977.389) [-980.608] (-980.348) -- 0:00:02 961500 -- (-980.773) (-979.639) (-977.193) [-979.782] * [-977.982] (-976.911) (-978.660) (-977.475) -- 0:00:02 962000 -- [-976.438] (-977.362) (-977.404) (-977.018) * [-976.239] (-980.340) (-979.274) (-976.818) -- 0:00:02 962500 -- [-976.971] (-976.478) (-980.131) (-978.024) * (-978.487) (-978.250) (-978.808) [-979.679] -- 0:00:02 963000 -- (-979.125) (-977.159) [-977.354] (-984.718) * (-979.479) [-978.280] (-978.321) (-982.145) -- 0:00:02 963500 -- [-977.920] (-980.758) (-977.637) (-979.127) * [-976.797] (-977.879) (-977.223) (-980.676) -- 0:00:02 964000 -- (-978.286) (-979.927) [-976.711] (-978.530) * (-979.311) [-977.493] (-977.922) (-981.643) -- 0:00:02 964500 -- [-980.038] (-981.901) (-979.609) (-977.633) * (-977.341) (-978.039) [-977.348] (-979.123) -- 0:00:02 965000 -- (-979.762) [-981.072] (-976.904) (-981.098) * (-979.210) [-978.200] (-976.601) (-977.408) -- 0:00:02 Average standard deviation of split frequencies: 0.006311 965500 -- (-976.557) (-978.814) (-978.505) [-977.521] * (-979.081) (-976.386) (-978.851) [-977.306] -- 0:00:02 966000 -- [-977.292] (-980.045) (-981.707) (-977.669) * [-977.276] (-977.378) (-981.400) (-982.420) -- 0:00:02 966500 -- (-976.671) [-977.811] (-977.646) (-977.655) * (-978.372) (-981.620) (-978.206) [-979.708] -- 0:00:02 967000 -- (-978.253) (-976.530) (-977.278) [-978.067] * [-978.783] (-977.437) (-979.295) (-980.491) -- 0:00:02 967500 -- (-977.319) (-976.544) [-977.093] (-976.264) * (-978.174) [-977.396] (-978.508) (-980.408) -- 0:00:02 968000 -- (-976.994) [-978.934] (-979.807) (-981.511) * (-977.206) [-979.112] (-977.259) (-976.239) -- 0:00:01 968500 -- (-979.217) [-978.476] (-979.988) (-980.989) * [-978.663] (-976.304) (-980.939) (-978.355) -- 0:00:01 969000 -- (-980.025) [-978.464] (-977.657) (-978.346) * (-979.586) (-977.505) (-976.612) [-978.146] -- 0:00:01 969500 -- (-978.623) (-977.185) (-977.310) [-977.044] * (-981.892) [-978.371] (-978.985) (-977.445) -- 0:00:01 970000 -- (-978.231) (-978.397) [-977.428] (-976.989) * (-981.106) [-977.409] (-981.013) (-977.663) -- 0:00:01 Average standard deviation of split frequencies: 0.006411 970500 -- (-977.890) [-976.638] (-979.857) (-979.048) * (-982.999) [-977.851] (-976.422) (-976.807) -- 0:00:01 971000 -- [-980.356] (-976.932) (-984.084) (-977.949) * (-976.072) [-977.070] (-976.347) (-979.007) -- 0:00:01 971500 -- (-976.839) (-977.541) [-978.571] (-978.217) * [-975.833] (-977.483) (-977.131) (-979.517) -- 0:00:01 972000 -- (-977.532) [-978.002] (-977.497) (-979.991) * (-978.807) (-976.736) [-976.867] (-978.546) -- 0:00:01 972500 -- (-977.644) (-978.331) [-980.577] (-980.004) * (-981.852) (-976.846) [-976.589] (-979.067) -- 0:00:01 973000 -- (-981.545) (-978.229) [-975.843] (-977.008) * (-978.145) (-981.688) (-978.790) [-977.273] -- 0:00:01 973500 -- (-980.170) (-979.680) [-976.693] (-977.639) * [-979.637] (-977.140) (-980.802) (-977.682) -- 0:00:01 974000 -- (-980.917) [-979.475] (-976.767) (-978.619) * (-979.285) (-980.515) [-977.681] (-980.455) -- 0:00:01 974500 -- (-976.165) [-978.301] (-976.396) (-978.454) * (-980.135) (-981.209) [-976.380] (-976.977) -- 0:00:01 975000 -- [-978.313] (-977.166) (-976.832) (-979.050) * (-979.192) (-981.461) (-978.114) [-980.865] -- 0:00:01 Average standard deviation of split frequencies: 0.006826 975500 -- (-978.281) (-977.124) (-981.072) [-980.903] * (-978.163) (-977.957) (-978.509) [-978.985] -- 0:00:01 976000 -- (-976.917) (-979.712) [-977.763] (-979.143) * (-978.749) (-977.732) (-977.123) [-980.526] -- 0:00:01 976500 -- [-978.409] (-978.054) (-978.405) (-982.884) * [-976.810] (-977.372) (-980.457) (-978.970) -- 0:00:01 977000 -- (-976.127) (-980.371) [-978.719] (-979.214) * (-977.940) (-977.967) (-977.606) [-977.927] -- 0:00:01 977500 -- (-977.670) [-978.413] (-981.888) (-977.565) * (-977.961) (-979.489) [-978.160] (-976.999) -- 0:00:01 978000 -- [-977.867] (-982.379) (-977.519) (-978.439) * (-976.311) [-978.818] (-977.899) (-978.963) -- 0:00:01 978500 -- (-978.896) (-981.734) [-977.044] (-977.699) * (-979.418) (-978.141) [-978.114] (-977.046) -- 0:00:01 979000 -- [-976.360] (-977.599) (-976.789) (-977.798) * (-976.972) (-978.607) [-979.392] (-977.512) -- 0:00:01 979500 -- (-979.387) (-977.088) (-979.354) [-978.135] * (-977.704) (-976.888) [-982.576] (-977.047) -- 0:00:01 980000 -- (-979.192) (-979.396) [-977.389] (-976.854) * (-977.621) (-976.265) (-986.771) [-980.631] -- 0:00:01 Average standard deviation of split frequencies: 0.006986 980500 -- (-979.126) [-981.298] (-977.671) (-978.748) * (-977.827) (-976.185) [-977.371] (-979.664) -- 0:00:01 981000 -- (-977.525) [-980.977] (-978.805) (-980.728) * [-979.555] (-978.591) (-976.495) (-979.137) -- 0:00:01 981500 -- (-976.990) (-980.995) [-980.083] (-978.569) * (-985.307) [-978.140] (-976.679) (-977.728) -- 0:00:01 982000 -- (-977.692) (-976.778) [-979.071] (-979.720) * [-976.641] (-981.546) (-976.876) (-979.272) -- 0:00:01 982500 -- [-978.654] (-978.700) (-982.196) (-976.816) * (-976.785) (-980.971) (-979.433) [-978.488] -- 0:00:01 983000 -- [-982.590] (-980.416) (-981.169) (-980.389) * (-976.991) (-976.688) [-979.971] (-981.096) -- 0:00:01 983500 -- (-977.921) (-977.436) [-977.097] (-978.174) * (-977.918) [-978.588] (-978.296) (-978.397) -- 0:00:01 984000 -- (-979.301) (-977.440) [-978.675] (-977.527) * (-977.317) [-978.777] (-981.431) (-978.687) -- 0:00:00 984500 -- [-976.589] (-976.852) (-979.303) (-978.792) * (-977.455) [-977.127] (-982.041) (-978.147) -- 0:00:00 985000 -- (-977.310) [-976.272] (-979.680) (-977.026) * [-977.225] (-978.546) (-985.564) (-981.750) -- 0:00:00 Average standard deviation of split frequencies: 0.006821 985500 -- (-976.682) (-977.776) (-982.099) [-980.221] * (-978.644) [-976.897] (-983.242) (-982.809) -- 0:00:00 986000 -- [-977.037] (-978.917) (-977.326) (-980.145) * (-979.472) [-978.402] (-981.509) (-981.853) -- 0:00:00 986500 -- (-976.231) (-976.445) (-978.554) [-977.413] * (-979.044) (-979.174) [-977.346] (-982.678) -- 0:00:00 987000 -- (-976.524) [-978.928] (-978.305) (-978.712) * (-977.343) (-976.545) [-977.002] (-979.580) -- 0:00:00 987500 -- (-977.283) (-976.262) [-977.081] (-979.843) * (-977.128) (-978.594) [-978.808] (-978.622) -- 0:00:00 988000 -- [-977.461] (-978.384) (-978.362) (-979.350) * (-977.041) [-980.299] (-977.605) (-979.426) -- 0:00:00 988500 -- [-977.293] (-981.238) (-978.789) (-978.846) * (-978.351) (-979.493) [-977.209] (-978.832) -- 0:00:00 989000 -- (-977.160) (-978.587) [-976.216] (-978.407) * (-977.966) (-979.214) (-982.130) [-978.525] -- 0:00:00 989500 -- [-980.930] (-980.769) (-980.408) (-977.213) * (-981.008) [-981.770] (-978.240) (-978.283) -- 0:00:00 990000 -- (-977.846) [-980.965] (-980.389) (-978.834) * [-977.561] (-978.972) (-981.539) (-977.859) -- 0:00:00 Average standard deviation of split frequencies: 0.006662 990500 -- (-976.738) [-977.531] (-979.403) (-976.368) * (-977.744) (-980.998) (-976.178) [-981.588] -- 0:00:00 991000 -- (-978.775) [-978.077] (-977.000) (-978.398) * (-977.744) [-976.971] (-976.481) (-975.788) -- 0:00:00 991500 -- [-977.589] (-980.877) (-977.217) (-978.801) * [-978.387] (-977.509) (-976.636) (-977.331) -- 0:00:00 992000 -- (-977.310) (-980.630) (-978.131) [-977.967] * [-977.704] (-978.447) (-976.710) (-979.642) -- 0:00:00 992500 -- (-976.952) (-977.518) (-980.253) [-977.152] * (-982.116) (-983.500) [-976.525] (-979.965) -- 0:00:00 993000 -- (-978.434) (-978.510) [-979.499] (-977.167) * (-982.209) [-978.164] (-977.604) (-978.845) -- 0:00:00 993500 -- [-976.595] (-979.411) (-978.764) (-978.330) * (-980.694) [-978.067] (-979.378) (-978.530) -- 0:00:00 994000 -- [-976.426] (-977.118) (-978.497) (-977.598) * (-977.058) [-977.417] (-977.452) (-980.166) -- 0:00:00 994500 -- [-977.655] (-977.302) (-977.983) (-981.990) * (-978.776) (-976.930) (-980.833) [-978.830] -- 0:00:00 995000 -- (-977.111) [-976.943] (-977.428) (-978.683) * (-977.320) (-978.050) (-977.941) [-977.968] -- 0:00:00 Average standard deviation of split frequencies: 0.006752 995500 -- (-977.896) (-976.745) (-978.509) [-978.669] * (-979.254) (-976.409) (-977.488) [-979.083] -- 0:00:00 996000 -- (-979.801) (-977.858) [-980.170] (-978.318) * (-983.147) (-977.511) [-977.734] (-976.540) -- 0:00:00 996500 -- [-980.190] (-977.758) (-980.438) (-977.747) * (-983.173) (-981.256) [-978.017] (-976.638) -- 0:00:00 997000 -- (-979.763) [-981.200] (-978.024) (-977.196) * (-977.875) [-977.807] (-977.610) (-977.335) -- 0:00:00 997500 -- [-978.677] (-976.824) (-977.588) (-977.633) * (-981.574) [-978.116] (-977.078) (-980.657) -- 0:00:00 998000 -- (-978.696) (-977.777) (-978.431) [-975.936] * (-978.734) (-978.323) [-978.877] (-978.697) -- 0:00:00 998500 -- (-980.796) [-981.515] (-979.069) (-977.910) * (-978.145) (-977.993) [-976.416] (-983.566) -- 0:00:00 999000 -- (-980.603) [-980.750] (-978.002) (-979.992) * (-976.610) (-978.513) (-977.746) [-978.349] -- 0:00:00 999500 -- [-979.246] (-977.062) (-979.309) (-978.324) * [-977.678] (-982.133) (-978.479) (-976.319) -- 0:00:00 1000000 -- (-977.795) (-977.200) [-976.669] (-976.599) * (-981.337) [-977.774] (-979.700) (-978.669) -- 0:00:00 Average standard deviation of split frequencies: 0.006941 Analysis completed in 1 mins 2 seconds Analysis used 61.33 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -975.74 Likelihood of best state for "cold" chain of run 2 was -975.74 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.9 % ( 63 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 27.9 % ( 26 %) Dirichlet(Pi{all}) 29.0 % ( 19 %) Slider(Pi{all}) 78.8 % ( 53 %) Multiplier(Alpha{1,2}) 78.4 % ( 57 %) Multiplier(Alpha{3}) 20.8 % ( 27 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 74 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 28 %) Multiplier(V{all}) 97.5 % ( 99 %) Nodeslider(V{all}) 30.3 % ( 22 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.7 % ( 64 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 27.5 % ( 27 %) Dirichlet(Pi{all}) 29.9 % ( 21 %) Slider(Pi{all}) 78.5 % ( 50 %) Multiplier(Alpha{1,2}) 77.3 % ( 47 %) Multiplier(Alpha{3}) 21.4 % ( 29 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 67 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 15 %) Multiplier(V{all}) 97.5 % ( 97 %) Nodeslider(V{all}) 30.5 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166886 0.82 0.67 3 | 165972 167013 0.84 4 | 166319 167000 166810 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167037 0.82 0.67 3 | 166601 166793 0.84 4 | 166258 166476 166835 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -977.36 | 1 | | 1 1 | | 2 1 11 1 | | 1* 1 2 2* 2 1 2 | | 1 2 22 2 2 2 2 1 1 2 221 2 2 | |** 21 * 2 21 1 * 1*22 1 212 2 2 * 1 | | 2 2 *1 * 22 112 2 1 11* 1 2| | 1 1 1 2 11 1 1 1 1 1 2 1| | 2 2 22 2 122 2 *1 * | | 1 1 1 2 2 | | 1 1 2 2 | | | | | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -979.50 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -977.49 -980.23 2 -977.46 -980.18 -------------------------------------- TOTAL -977.48 -980.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897657 0.087234 0.348370 1.458194 0.873493 1501.00 1501.00 1.000 r(A<->C){all} 0.168382 0.020288 0.000001 0.461061 0.130394 208.75 216.96 1.000 r(A<->G){all} 0.163346 0.019383 0.000008 0.453785 0.126661 235.71 274.99 1.007 r(A<->T){all} 0.161887 0.019331 0.000024 0.445972 0.124379 197.24 329.80 1.000 r(C<->G){all} 0.166404 0.020463 0.000093 0.448463 0.127245 199.23 209.59 1.002 r(C<->T){all} 0.167018 0.021545 0.000448 0.467162 0.125030 260.65 288.01 1.000 r(G<->T){all} 0.172962 0.022269 0.000289 0.461311 0.133254 153.90 163.25 1.001 pi(A){all} 0.196108 0.000220 0.168210 0.225227 0.196233 1179.93 1288.30 1.001 pi(C){all} 0.270185 0.000273 0.239421 0.304534 0.270198 1282.98 1329.33 1.001 pi(G){all} 0.322361 0.000292 0.292725 0.359573 0.322204 1340.99 1365.50 1.000 pi(T){all} 0.211345 0.000222 0.184655 0.243363 0.211129 1283.66 1284.73 1.000 alpha{1,2} 0.436816 0.262576 0.000293 1.438817 0.253421 1083.51 1205.99 1.000 alpha{3} 0.458607 0.236024 0.000163 1.455973 0.286676 1236.52 1274.23 1.000 pinvar{all} 0.997842 0.000007 0.993204 0.999999 0.998648 890.86 1038.83 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .****. 8 -- .**.** 9 -- .*.*.. 10 -- ..**.. 11 -- .*..*. 12 -- .***.* 13 -- ....** 14 -- ..*.*. 15 -- .*.*** 16 -- ..**** 17 -- ...**. 18 -- .*...* 19 -- ...*.* 20 -- .**... 21 -- ..*..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 447 0.148901 0.008951 0.142572 0.155230 2 8 443 0.147568 0.007066 0.142572 0.152565 2 9 442 0.147235 0.001884 0.145903 0.148568 2 10 438 0.145903 0.005653 0.141905 0.149900 2 11 438 0.145903 0.005653 0.141905 0.149900 2 12 434 0.144570 0.000942 0.143904 0.145237 2 13 433 0.144237 0.008951 0.137908 0.150566 2 14 432 0.143904 0.015075 0.133245 0.154564 2 15 431 0.143571 0.016488 0.131912 0.155230 2 16 431 0.143571 0.005182 0.139907 0.147235 2 17 420 0.139907 0.005653 0.135909 0.143904 2 18 420 0.139907 0.001884 0.138574 0.141239 2 19 413 0.137575 0.010835 0.129913 0.145237 2 20 407 0.135576 0.007066 0.130580 0.140573 2 21 404 0.134577 0.002827 0.132578 0.136576 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099570 0.009614 0.000213 0.296946 0.069349 1.000 2 length{all}[2] 0.101699 0.010468 0.000073 0.305455 0.069810 1.002 2 length{all}[3] 0.101435 0.010571 0.000005 0.308501 0.068985 1.000 2 length{all}[4] 0.101146 0.010421 0.000004 0.307349 0.070666 1.000 2 length{all}[5] 0.099008 0.009692 0.000020 0.288254 0.069276 1.000 2 length{all}[6] 0.098216 0.010161 0.000004 0.302674 0.066435 1.000 2 length{all}[7] 0.104578 0.012647 0.000300 0.308174 0.068221 1.000 2 length{all}[8] 0.101563 0.010811 0.000589 0.312961 0.069431 0.999 2 length{all}[9] 0.107362 0.011616 0.000160 0.327436 0.073246 0.999 2 length{all}[10] 0.094197 0.008846 0.000284 0.269668 0.067031 0.999 2 length{all}[11] 0.092962 0.008159 0.000196 0.266761 0.063464 1.016 2 length{all}[12] 0.087714 0.008532 0.000181 0.267682 0.057444 0.998 2 length{all}[13] 0.101813 0.010849 0.000072 0.323098 0.067944 1.000 2 length{all}[14] 0.096232 0.008839 0.000442 0.268371 0.067933 1.000 2 length{all}[15] 0.111312 0.012892 0.000265 0.329280 0.074602 0.998 2 length{all}[16] 0.099771 0.009407 0.000179 0.304455 0.067715 1.002 2 length{all}[17] 0.101907 0.011443 0.000024 0.335351 0.070103 0.998 2 length{all}[18] 0.099699 0.009394 0.000219 0.302457 0.068460 0.998 2 length{all}[19] 0.091253 0.010860 0.000002 0.293707 0.058264 0.999 2 length{all}[20] 0.095600 0.009529 0.000455 0.280563 0.066618 0.998 2 length{all}[21] 0.098177 0.008330 0.000583 0.278467 0.072685 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006941 Maximum standard deviation of split frequencies = 0.016488 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.016 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |----------------------------------------------------------------------- C2 (2) | |---------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------------ C4 (4) | |----------------------------------------------------------------------- C5 (5) | \-------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 714 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 53 patterns at 238 / 238 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 53 patterns at 238 / 238 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 51728 bytes for conP 4664 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.077082 0.018986 0.076973 0.049259 0.077923 0.080814 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1035.165590 Iterating by ming2 Initial: fx= 1035.165590 x= 0.07708 0.01899 0.07697 0.04926 0.07792 0.08081 0.30000 1.30000 1 h-m-p 0.0000 0.0001 570.7204 ++ 1008.793999 m 0.0001 13 | 1/8 2 h-m-p 0.0014 0.0369 30.6358 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 521.9187 ++ 973.396745 m 0.0001 44 | 2/8 4 h-m-p 0.0023 0.0537 26.3723 ------------.. | 2/8 5 h-m-p 0.0000 0.0001 468.8508 ++ 947.121756 m 0.0001 76 | 3/8 6 h-m-p 0.0018 0.0619 26.9447 ------------.. | 3/8 7 h-m-p 0.0000 0.0000 408.0123 ++ 947.043254 m 0.0000 108 | 4/8 8 h-m-p 0.0002 0.0797 24.2578 ----------.. | 4/8 9 h-m-p 0.0000 0.0000 333.1020 ++ 946.641845 m 0.0000 138 | 5/8 10 h-m-p 0.0002 0.1185 16.1712 ----------.. | 5/8 11 h-m-p 0.0000 0.0000 235.5133 ++ 945.951232 m 0.0000 168 | 6/8 12 h-m-p 0.0975 8.0000 0.0000 ---------Y 945.951232 0 0.0000 188 | 6/8 13 h-m-p 0.0160 8.0000 0.0000 --------N 945.951232 0 0.0000 209 Out.. lnL = -945.951232 210 lfun, 210 eigenQcodon, 1260 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.070628 0.028027 0.109077 0.078691 0.048783 0.045212 0.300027 0.624920 0.219167 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.169535 np = 9 lnL0 = -1030.438775 Iterating by ming2 Initial: fx= 1030.438775 x= 0.07063 0.02803 0.10908 0.07869 0.04878 0.04521 0.30003 0.62492 0.21917 1 h-m-p 0.0000 0.0001 518.0412 ++ 994.397459 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0003 318.5155 ++ 974.847909 m 0.0003 26 | 2/9 3 h-m-p 0.0000 0.0000 7850.5985 ++ 971.725744 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 6062.3791 ++ 956.860243 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 143443.5221 ++ 953.143114 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 549570.4917 ++ 952.872999 m 0.0000 74 | 6/9 7 h-m-p 0.0001 0.0173 21.8327 ---------.. | 6/9 8 h-m-p 0.0000 0.0001 226.5714 ++ 945.951175 m 0.0001 105 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 ++ 945.951175 m 8.0000 117 | 7/9 10 h-m-p 0.0160 8.0000 0.0131 +++++ 945.951173 m 8.0000 134 | 7/9 11 h-m-p 0.2312 1.1560 0.1725 ++ 945.951172 m 1.1560 148 | 8/9 12 h-m-p 0.0845 0.4792 0.9621 ++ 945.950965 m 0.4792 162 | 9/9 13 h-m-p 0.0160 8.0000 0.0000 N 945.950965 0 0.0160 175 | 9/9 14 h-m-p 0.0160 8.0000 0.0000 N 945.950965 0 0.0160 187 Out.. lnL = -945.950965 188 lfun, 564 eigenQcodon, 2256 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.065285 0.019940 0.087566 0.094687 0.054173 0.065329 0.000100 1.646564 0.261467 0.396745 1.466498 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 12.069650 np = 11 lnL0 = -1032.437196 Iterating by ming2 Initial: fx= 1032.437196 x= 0.06529 0.01994 0.08757 0.09469 0.05417 0.06533 0.00011 1.64656 0.26147 0.39674 1.46650 1 h-m-p 0.0000 0.0000 525.3101 ++ 1031.810708 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0002 390.6589 +++ 1005.324142 m 0.0002 31 | 2/11 3 h-m-p 0.0001 0.0005 177.1356 ++ 970.772151 m 0.0005 45 | 3/11 4 h-m-p 0.0008 0.0041 42.3881 ++ 952.860442 m 0.0041 59 | 4/11 5 h-m-p 0.0000 0.0000 2787.7443 ++ 952.838694 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 9918.4734 ++ 946.437015 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0000 9.6470 -------.. | 6/11 8 h-m-p 0.0000 0.0000 327.0007 ++ 946.416312 m 0.0000 120 | 7/11 9 h-m-p 0.0007 0.3444 2.8539 -----------.. | 7/11 10 h-m-p 0.0000 0.0000 231.1283 ++ 945.951140 m 0.0000 157 | 8/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951140 m 8.0000 174 | 8/11 12 h-m-p 0.0194 8.0000 0.0016 +++++ 945.951140 m 8.0000 194 | 8/11 13 h-m-p 0.0160 8.0000 2.4970 ----------Y 945.951140 0 0.0000 221 | 8/11 14 h-m-p 0.0160 8.0000 0.0000 Y 945.951140 0 0.0040 235 | 8/11 15 h-m-p 0.0160 8.0000 0.0000 N 945.951140 0 0.0040 252 Out.. lnL = -945.951140 253 lfun, 1012 eigenQcodon, 4554 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -945.971770 S = -945.948647 -0.008875 Calculating f(w|X), posterior probabilities of site classes. did 10 / 53 patterns 0:02 did 20 / 53 patterns 0:02 did 30 / 53 patterns 0:02 did 40 / 53 patterns 0:02 did 50 / 53 patterns 0:02 did 53 / 53 patterns 0:02 Time used: 0:02 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.030517 0.090089 0.047167 0.025796 0.012016 0.026572 0.000100 0.200288 1.921742 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 29.665911 np = 9 lnL0 = -996.896537 Iterating by ming2 Initial: fx= 996.896537 x= 0.03052 0.09009 0.04717 0.02580 0.01202 0.02657 0.00011 0.20029 1.92174 1 h-m-p 0.0000 0.0000 523.8657 ++ 996.590004 m 0.0000 14 | 1/9 2 h-m-p 0.0001 0.0336 15.1639 ---------.. | 1/9 3 h-m-p 0.0000 0.0001 524.0425 ++ 981.607140 m 0.0001 45 | 2/9 4 h-m-p 0.0025 0.1915 10.2476 ------------.. | 2/9 5 h-m-p 0.0000 0.0001 485.5381 ++ 966.555936 m 0.0001 79 | 3/9 6 h-m-p 0.0005 0.0025 17.6474 -----------.. | 3/9 7 h-m-p 0.0000 0.0000 441.8040 ++ 965.868197 m 0.0000 112 | 4/9 8 h-m-p 0.0001 0.0047 24.6441 ++++ 965.316998 m 0.0047 126 | 5/9 9 h-m-p 0.0000 0.0002 376.3124 ++ 958.669160 m 0.0002 138 | 6/9 10 h-m-p 0.0000 0.0000 292.7893 ++ 956.179984 m 0.0000 150 | 7/9 11 h-m-p 0.0160 8.0000 1.0148 -------------.. | 7/9 12 h-m-p 0.0000 0.0002 214.0138 +++ 945.950965 m 0.0002 186 | 8/9 13 h-m-p 1.6000 8.0000 0.0000 Y 945.950965 0 1.6000 198 | 8/9 14 h-m-p 0.0160 8.0000 0.0000 Y 945.950965 0 0.0040 211 Out.. lnL = -945.950965 212 lfun, 2332 eigenQcodon, 12720 P(t) Time used: 0:05 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.088829 0.024285 0.034987 0.070626 0.076124 0.013535 0.000100 0.900000 0.577472 1.626575 1.299930 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 17.241316 np = 11 lnL0 = -1012.717793 Iterating by ming2 Initial: fx= 1012.717793 x= 0.08883 0.02428 0.03499 0.07063 0.07612 0.01353 0.00011 0.90000 0.57747 1.62658 1.29993 1 h-m-p 0.0000 0.0000 498.8281 ++ 1012.363083 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0007 166.4717 ++++ 994.901506 m 0.0007 32 | 2/11 3 h-m-p 0.0000 0.0001 272.3625 ++ 983.172409 m 0.0001 46 | 3/11 4 h-m-p 0.0003 0.0013 123.4395 ++ 973.298372 m 0.0013 60 | 4/11 5 h-m-p 0.0000 0.0001 1932.3639 ++ 951.302973 m 0.0001 74 | 5/11 6 h-m-p 0.0000 0.0002 582.1830 ++ 948.740218 m 0.0002 88 | 6/11 7 h-m-p 0.0000 0.0000 4834.2948 ++ 948.163587 m 0.0000 102 | 7/11 8 h-m-p 0.0022 0.0312 23.1505 ------------.. | 7/11 9 h-m-p 0.0000 0.0000 229.1457 ++ 945.951169 m 0.0000 140 | 8/11 10 h-m-p 0.2733 8.0000 0.0000 +++ 945.951169 m 8.0000 155 | 8/11 11 h-m-p 0.0160 8.0000 0.0225 +++++ 945.951163 m 8.0000 175 | 8/11 12 h-m-p 0.2324 4.6164 0.7757 -----------Y 945.951163 0 0.0000 203 | 8/11 13 h-m-p 0.0160 8.0000 0.0001 ----N 945.951163 0 0.0000 224 | 8/11 14 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951163 m 8.0000 244 | 8/11 15 h-m-p 0.0112 5.6219 0.6593 ---------Y 945.951163 0 0.0000 270 | 8/11 16 h-m-p 0.0160 8.0000 0.0001 +++++ 945.951163 m 8.0000 290 | 8/11 17 h-m-p 0.0092 4.6135 0.7822 -------------.. | 8/11 18 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951163 m 8.0000 338 | 8/11 19 h-m-p 0.0096 2.9759 0.2473 -----------C 945.951163 0 0.0000 366 | 8/11 20 h-m-p 0.0160 8.0000 0.0025 +++++ 945.951157 m 8.0000 386 | 8/11 21 h-m-p 0.0724 2.9673 0.2779 -------------Y 945.951157 0 0.0000 416 | 8/11 22 h-m-p 0.0160 8.0000 0.0004 +++++ 945.951156 m 8.0000 436 | 8/11 23 h-m-p 0.0099 3.3583 0.2919 ----------Y 945.951156 0 0.0000 463 | 8/11 24 h-m-p 0.0160 8.0000 0.0001 +++++ 945.951156 m 8.0000 483 | 8/11 25 h-m-p 0.0042 2.1247 0.3788 ---------C 945.951156 0 0.0000 509 | 8/11 26 h-m-p 0.0160 8.0000 0.0005 +++++ 945.951156 m 8.0000 529 | 8/11 27 h-m-p 0.0102 2.0597 0.3849 ------------C 945.951156 0 0.0000 558 | 8/11 28 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11 29 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951155 m 8.0000 606 | 8/11 30 h-m-p 0.0113 3.2481 0.2337 -------------.. | 8/11 31 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951154 m 8.0000 654 | 8/11 32 h-m-p 0.0115 3.2779 0.2323 ----------Y 945.951154 0 0.0000 681 | 8/11 33 h-m-p 0.0160 8.0000 0.0035 +++++ 945.951144 m 8.0000 701 | 8/11 34 h-m-p 0.1152 3.3698 0.2413 ---------------.. | 8/11 35 h-m-p 0.0160 8.0000 0.0004 +++++ 945.951143 m 8.0000 751 | 8/11 36 h-m-p 0.0141 3.6483 0.2163 ------------Y 945.951143 0 0.0000 780 | 8/11 37 h-m-p 0.0160 8.0000 0.0003 +++++ 945.951143 m 8.0000 800 | 8/11 38 h-m-p 0.0089 2.7174 0.2772 -----------Y 945.951143 0 0.0000 828 | 8/11 39 h-m-p 0.0160 8.0000 0.0001 +++++ 945.951143 m 8.0000 848 | 8/11 40 h-m-p 0.0058 2.8859 0.3143 --------Y 945.951143 0 0.0000 873 | 8/11 41 h-m-p 0.0160 8.0000 0.0001 -Y 945.951143 0 0.0010 891 | 8/11 42 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951143 m 8.0000 911 | 8/11 43 h-m-p 0.0160 8.0000 0.0530 ------N 945.951143 0 0.0000 934 | 8/11 44 h-m-p 0.0160 8.0000 0.0000 +++++ 945.951143 m 8.0000 954 | 8/11 45 h-m-p 0.0130 6.4868 0.1351 -------C 945.951143 0 0.0000 978 | 8/11 46 h-m-p 0.0160 8.0000 0.0003 --------Y 945.951143 0 0.0000 1003 | 8/11 47 h-m-p 0.0160 8.0000 0.0000 -C 945.951143 0 0.0010 1021 Out.. lnL = -945.951143 1022 lfun, 12264 eigenQcodon, 67452 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -945.978186 S = -945.948591 -0.013048 Calculating f(w|X), posterior probabilities of site classes. did 10 / 53 patterns 0:22 did 20 / 53 patterns 0:22 did 30 / 53 patterns 0:22 did 40 / 53 patterns 0:23 did 50 / 53 patterns 0:23 did 53 / 53 patterns 0:23 Time used: 0:23 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238 NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV NC_002677_1_NP_302140_1_1012_rnc VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV ************************************************** NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL NC_002677_1_NP_302140_1_1012_rnc LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL ************************************************** NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL NC_002677_1_NP_302140_1_1012_rnc LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL ************************************************** NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM NC_002677_1_NP_302140_1_1012_rnc DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM ************************************************** NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV NC_002677_1_NP_302140_1_1012_rnc DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV **************************************
>NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NC_002677_1_NP_302140_1_1012_rnc GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG >NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG GGAAAACGTCCGTG
>NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NC_002677_1_NP_302140_1_1012_rnc VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV >NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
#NEXUS [ID: 0877481311] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 NC_002677_1_NP_302140_1_1012_rnc NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 ; end; begin trees; translate 1 NC_011896_1_WP_010908461_1_1762_MLBR_RS08350, 2 NC_002677_1_NP_302140_1_1012_rnc, 3 NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955, 4 NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670, 5 NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115, 6 NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06934873,2:0.06981047,3:0.06898548,4:0.07066602,5:0.06927571,6:0.06643473); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06934873,2:0.06981047,3:0.06898548,4:0.07066602,5:0.06927571,6:0.06643473); end;
Estimated marginal likelihoods for runs sampled in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -977.49 -980.23 2 -977.46 -980.18 -------------------------------------- TOTAL -977.48 -980.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897657 0.087234 0.348370 1.458194 0.873493 1501.00 1501.00 1.000 r(A<->C){all} 0.168382 0.020288 0.000001 0.461061 0.130394 208.75 216.96 1.000 r(A<->G){all} 0.163346 0.019383 0.000008 0.453785 0.126661 235.71 274.99 1.007 r(A<->T){all} 0.161887 0.019331 0.000024 0.445972 0.124379 197.24 329.80 1.000 r(C<->G){all} 0.166404 0.020463 0.000093 0.448463 0.127245 199.23 209.59 1.002 r(C<->T){all} 0.167018 0.021545 0.000448 0.467162 0.125030 260.65 288.01 1.000 r(G<->T){all} 0.172962 0.022269 0.000289 0.461311 0.133254 153.90 163.25 1.001 pi(A){all} 0.196108 0.000220 0.168210 0.225227 0.196233 1179.93 1288.30 1.001 pi(C){all} 0.270185 0.000273 0.239421 0.304534 0.270198 1282.98 1329.33 1.001 pi(G){all} 0.322361 0.000292 0.292725 0.359573 0.322204 1340.99 1365.50 1.000 pi(T){all} 0.211345 0.000222 0.184655 0.243363 0.211129 1283.66 1284.73 1.000 alpha{1,2} 0.436816 0.262576 0.000293 1.438817 0.253421 1083.51 1205.99 1.000 alpha{3} 0.458607 0.236024 0.000163 1.455973 0.286676 1236.52 1274.23 1.000 pinvar{all} 0.997842 0.000007 0.993204 0.999999 0.998648 890.86 1038.83 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rnc/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 238 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0 TTC 3 3 3 3 3 3 | TCC 4 4 4 4 4 4 | TAC 6 6 6 6 6 6 | TGC 0 0 0 0 0 0 Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 9 9 9 9 9 9 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4 CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 6 6 6 6 6 6 | CGC 4 4 4 4 4 4 CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2 CTG 17 17 17 17 17 17 | CCG 1 1 1 1 1 1 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2 ATC 2 2 2 2 2 2 | ACC 11 11 11 11 11 11 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3 ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0 Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 2 | Ala GCT 8 8 8 8 8 8 | Asp GAT 9 9 9 9 9 9 | Gly GGT 9 9 9 9 9 9 GTC 7 7 7 7 7 7 | GCC 5 5 5 5 5 5 | GAC 7 7 7 7 7 7 | GGC 10 10 10 10 10 10 GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3 GTG 10 10 10 10 10 10 | GCG 9 9 9 9 9 9 | GAG 10 10 10 10 10 10 | GGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350 position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 #2: NC_002677_1_NP_302140_1_1012_rnc position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 #3: NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955 position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 #4: NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670 position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 #5: NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115 position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 #6: NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340 position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0 TTC 18 | TCC 24 | TAC 36 | TGC 0 Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 54 | TCG 30 | TAG 0 | Trp W TGG 12 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 24 CTC 18 | CCC 6 | CAC 36 | CGC 24 CTA 12 | CCA 12 | Gln Q CAA 6 | CGA 12 CTG 102 | CCG 6 | CAG 30 | CGG 6 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 12 ATC 12 | ACC 66 | AAC 24 | AGC 18 ATA 6 | ACA 18 | Lys K AAA 36 | Arg R AGA 0 Met M ATG 18 | ACG 18 | AAG 18 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 48 | Asp D GAT 54 | Gly G GGT 54 GTC 42 | GCC 30 | GAC 42 | GGC 60 GTA 0 | GCA 24 | Glu E GAA 24 | GGA 18 GTG 60 | GCG 54 | GAG 60 | GGG 30 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.15126 C:0.23529 A:0.18487 G:0.42857 position 2: T:0.28571 C:0.25630 A:0.26891 G:0.18908 position 3: T:0.19748 C:0.31933 A:0.13445 G:0.34874 Average T:0.21148 C:0.27031 A:0.19608 G:0.32213 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -945.951232 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300027 1.299930 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.30003 omega (dN/dS) = 1.29993 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0 7..2 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0 7..3 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0 7..4 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0 7..5 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0 7..6 0.000 544.4 169.6 1.2999 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -945.950965 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -945.951140 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.728046 0.149672 0.000001 1.332962 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.72805 0.14967 0.12228 w: 0.00000 1.00000 1.33296 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0 7..2 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0 7..3 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0 7..4 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0 7..5 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0 7..6 0.000 553.3 160.7 0.3127 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:02 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -945.950965 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.905527 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.90553 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 553.3 160.7 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -945.951143 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.782188 0.005000 1.736161 1.486608 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908461_1_1762_MLBR_RS08350: 0.000004, NC_002677_1_NP_302140_1_1012_rnc: 0.000004, NZ_LVXE01000091_1_WP_010908461_1_2900_A3216_RS13955: 0.000004, NZ_LYPH01000094_1_WP_010908461_1_2836_A8144_RS13670: 0.000004, NZ_CP029543_1_WP_010908461_1_1791_DIJ64_RS09115: 0.000004, NZ_AP014567_1_WP_010908461_1_1836_JK2ML_RS09340: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.78219 p = 0.00500 q = 1.73616 (p1 = 0.21781) w = 1.48661 MLEs of dN/dS (w) for site classes (K=11) p: 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.07822 0.21781 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.48661 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0 7..2 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0 7..3 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0 7..4 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0 7..5 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0 7..6 0.000 553.3 160.7 0.3238 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908461_1_1762_MLBR_RS08350) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Time used: 0:23
Model 1: NearlyNeutral -945.950965 Model 2: PositiveSelection -945.95114 Model 0: one-ratio -945.951232 Model 7: beta -945.950965 Model 8: beta&w>1 -945.951143 Model 0 vs 1 5.340000000160217E-4 Model 2 vs 1 3.5000000002582965E-4 Model 8 vs 7 3.560000000106811E-4