--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:28:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rnc/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -977.49          -980.23
2       -977.46          -980.18
--------------------------------------
TOTAL     -977.48          -980.20
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897657    0.087234    0.348370    1.458194    0.873493   1501.00   1501.00    1.000
r(A<->C){all}   0.168382    0.020288    0.000001    0.461061    0.130394    208.75    216.96    1.000
r(A<->G){all}   0.163346    0.019383    0.000008    0.453785    0.126661    235.71    274.99    1.007
r(A<->T){all}   0.161887    0.019331    0.000024    0.445972    0.124379    197.24    329.80    1.000
r(C<->G){all}   0.166404    0.020463    0.000093    0.448463    0.127245    199.23    209.59    1.002
r(C<->T){all}   0.167018    0.021545    0.000448    0.467162    0.125030    260.65    288.01    1.000
r(G<->T){all}   0.172962    0.022269    0.000289    0.461311    0.133254    153.90    163.25    1.001
pi(A){all}      0.196108    0.000220    0.168210    0.225227    0.196233   1179.93   1288.30    1.001
pi(C){all}      0.270185    0.000273    0.239421    0.304534    0.270198   1282.98   1329.33    1.001
pi(G){all}      0.322361    0.000292    0.292725    0.359573    0.322204   1340.99   1365.50    1.000
pi(T){all}      0.211345    0.000222    0.184655    0.243363    0.211129   1283.66   1284.73    1.000
alpha{1,2}      0.436816    0.262576    0.000293    1.438817    0.253421   1083.51   1205.99    1.000
alpha{3}        0.458607    0.236024    0.000163    1.455973    0.286676   1236.52   1274.23    1.000
pinvar{all}     0.997842    0.000007    0.993204    0.999999    0.998648    890.86   1038.83    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-945.950965
Model 2: PositiveSelection	-945.95114
Model 0: one-ratio	-945.951232
Model 7: beta	-945.950965
Model 8: beta&w>1	-945.951143


Model 0 vs 1	5.340000000160217E-4

Model 2 vs 1	3.5000000002582965E-4

Model 8 vs 7	3.560000000106811E-4
>C1
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C2
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C3
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C4
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C5
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C6
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=238 

C1              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C2              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C3              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C4              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C5              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C6              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
                **************************************************

C1              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C2              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C3              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C4              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C5              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C6              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
                **************************************************

C1              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C2              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C3              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C4              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C5              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C6              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
                **************************************************

C1              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C2              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C3              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C4              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C5              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C6              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
                **************************************************

C1              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C2              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C3              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C4              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C5              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C6              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
                **************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  238 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  238 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7140]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7140]--->[7140]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.480 Mb, Max= 30.778 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C2              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C3              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C4              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C5              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
C6              VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
                **************************************************

C1              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C2              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C3              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C4              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C5              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
C6              LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
                **************************************************

C1              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C2              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C3              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C4              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C5              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
C6              LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
                **************************************************

C1              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C2              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C3              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C4              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C5              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
C6              DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
                **************************************************

C1              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C2              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C3              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C4              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C5              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
C6              DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
                **************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C2              GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C3              GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C4              GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C5              GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
C6              GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
                **************************************************

C1              TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C2              TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C3              TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C4              TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C5              TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
C6              TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
                **************************************************

C1              ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C2              ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C3              ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C4              ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C5              ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
C6              ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
                **************************************************

C1              CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C2              CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C3              CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C4              CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C5              CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
C6              CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
                **************************************************

C1              GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C2              GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C3              GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C4              GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C5              GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
C6              GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
                **************************************************

C1              TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C2              TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C3              TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C4              TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C5              TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
C6              TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
                **************************************************

C1              CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C2              CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C3              CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C4              CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C5              CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
C6              CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
                **************************************************

C1              ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C2              ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C3              ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C4              ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C5              ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
C6              ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
                **************************************************

C1              GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C2              GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C3              GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C4              GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C5              GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
C6              GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
                **************************************************

C1              GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C2              GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C3              GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C4              GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C5              GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
C6              GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
                **************************************************

C1              GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C2              GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C3              GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C4              GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C5              GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
C6              GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
                **************************************************

C1              CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C2              CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C3              CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C4              CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C5              CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
C6              CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
                **************************************************

C1              GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C2              GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C3              GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C4              GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C5              GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
C6              GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
                **************************************************

C1              GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C2              GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C3              GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C4              GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C5              GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
C6              GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
                **************************************************

C1              GGAAAACGTCCGTG
C2              GGAAAACGTCCGTG
C3              GGAAAACGTCCGTG
C4              GGAAAACGTCCGTG
C5              GGAAAACGTCCGTG
C6              GGAAAACGTCCGTG
                **************



>C1
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C2
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C3
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C4
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C5
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C6
GTGACCCAGCCTCGACAAGCTTTGCTCGATGCGTTCGGCGTCGATCTGCC
TGATGAGCTACTTTCGCTGGCGTTGACACACCGCAGTTATGCCTACGAGC
ACGGCGGGTTACCAACCAACGAGCGCCTGGAGTTTCTTGGTGACGCTGTC
CTGAGCTTGACCATTACCGATGAGTTGTTCCATCGCCACCCCGACCGTTC
GGAAGGGGATCTGGCTAAATTGCGTGCCAGTGTGGTCAACACCCAGGCAC
TGGCTTACGTTGCGCGAAACTTATCCGATGGTGGTCTCGGTGTCTACCTG
CTGCTGGGCCGTGGCGAGACAAACACCGGAGGAGCGGATAAGTCCAGCAT
ACTGGCCGACGGCATGGAATCGCTGCTGGGTGCGATCTACCTGCATCACG
GTATTGAGGTGGCCCGTCAGGTGATCTTGCGGTTGTTTGGTACGCTGCTG
GACGCTGCGCCTACGCTGGGAGCTGGGTTGGATTGGAAGACCAGCTTGCA
GGAGCTAACAGCGGCACGCGGCATGGGCGTGCCATCGTACGTGGTGACCT
CCACCGGTCCGGACCACGACAAAGAATTCACCGCGGTTGTCGTCGTGATG
GACACCGAATACGGGTCAGGTATTGGCCACTCGAAGAAAGAGGCTGAGCA
GAAAGCCGCATCAGCGGCTTGGAAAGCACTCGATGTGCTGGGCGGCGTCG
GGAAAACGTCCGTG
>C1
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C2
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C3
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C4
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C5
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV
>C6
VTQPRQALLDAFGVDLPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAV
LSLTITDELFHRHPDRSEGDLAKLRASVVNTQALAYVARNLSDGGLGVYL
LLGRGETNTGGADKSSILADGMESLLGAIYLHHGIEVARQVILRLFGTLL
DAAPTLGAGLDWKTSLQELTAARGMGVPSYVVTSTGPDHDKEFTAVVVVM
DTEYGSGIGHSKKEAEQKAASAAWKALDVLGGVGKTSV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 714 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789616
      Setting output file names to "/data/11res/rnc/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1542864648
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0877481311
      Seed = 2124774355
      Swapseed = 1579789616
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1597.966227 -- -24.965149
         Chain 2 -- -1597.966227 -- -24.965149
         Chain 3 -- -1597.966227 -- -24.965149
         Chain 4 -- -1597.966227 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1597.965984 -- -24.965149
         Chain 2 -- -1597.966227 -- -24.965149
         Chain 3 -- -1597.966227 -- -24.965149
         Chain 4 -- -1597.966135 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1597.966] (-1597.966) (-1597.966) (-1597.966) * [-1597.966] (-1597.966) (-1597.966) (-1597.966) 
        500 -- [-983.479] (-990.836) (-992.443) (-996.162) * [-984.510] (-990.855) (-989.435) (-997.868) -- 0:00:00
       1000 -- [-990.041] (-998.017) (-992.318) (-989.953) * (-992.763) (-1002.319) [-983.810] (-993.125) -- 0:00:00
       1500 -- (-987.457) [-988.160] (-991.411) (-988.918) * (-985.487) (-991.314) (-986.522) [-986.711] -- 0:00:00
       2000 -- (-989.989) (-995.993) (-989.842) [-982.073] * (-987.829) (-994.215) [-981.997] (-989.329) -- 0:00:00
       2500 -- (-982.845) (-985.236) [-985.579] (-986.841) * [-986.938] (-980.847) (-983.605) (-993.266) -- 0:00:00
       3000 -- (-982.966) (-987.917) [-987.707] (-986.749) * (-990.000) (-986.558) [-988.949] (-986.878) -- 0:00:00
       3500 -- [-986.794] (-986.019) (-983.972) (-986.286) * (-985.211) (-984.047) (-992.172) [-983.580] -- 0:00:00
       4000 -- (-989.249) (-992.427) [-987.003] (-985.213) * (-981.244) (-995.273) (-984.376) [-985.732] -- 0:00:00
       4500 -- (-995.513) (-991.472) (-988.957) [-981.570] * (-989.542) (-985.261) [-989.610] (-989.492) -- 0:00:00
       5000 -- (-985.234) (-980.918) [-984.681] (-992.729) * (-986.286) [-994.634] (-996.135) (-989.061) -- 0:00:00

      Average standard deviation of split frequencies: 0.092852

       5500 -- (-986.577) (-993.840) [-987.718] (-990.170) * (-982.649) (-988.382) (-980.734) [-985.283] -- 0:00:00
       6000 -- (-989.908) (-989.046) [-986.679] (-986.429) * (-985.952) (-984.342) (-989.539) [-983.594] -- 0:00:00
       6500 -- [-983.727] (-986.574) (-987.735) (-987.212) * (-982.904) (-984.025) [-985.110] (-988.268) -- 0:00:00
       7000 -- (-989.564) (-989.592) (-986.480) [-982.707] * (-985.159) (-983.225) [-986.555] (-984.272) -- 0:00:00
       7500 -- (-987.009) (-988.937) (-985.382) [-992.108] * (-982.828) [-984.934] (-983.704) (-993.261) -- 0:00:00
       8000 -- (-982.520) (-986.090) (-984.980) [-982.972] * (-984.209) (-990.470) (-988.417) [-984.302] -- 0:00:00
       8500 -- (-990.348) (-983.312) [-989.489] (-985.810) * (-987.337) [-991.118] (-987.640) (-981.983) -- 0:00:00
       9000 -- (-992.822) [-983.957] (-986.336) (-989.944) * [-982.961] (-986.531) (-989.867) (-983.429) -- 0:00:00
       9500 -- (-993.219) (-980.958) (-982.141) [-985.571] * [-986.291] (-995.934) (-993.600) (-989.625) -- 0:00:00
      10000 -- (-985.872) (-987.053) (-986.635) [-993.138] * (-990.227) (-985.977) [-986.834] (-988.382) -- 0:00:00

      Average standard deviation of split frequencies: 0.081410

      10500 -- (-986.784) (-996.504) [-988.853] (-995.302) * (-982.553) (-984.022) (-989.291) [-990.910] -- 0:00:00
      11000 -- [-989.622] (-987.646) (-987.674) (-990.246) * (-989.104) (-987.758) (-987.435) [-985.531] -- 0:00:00
      11500 -- [-982.674] (-983.570) (-989.332) (-983.785) * (-983.890) [-985.879] (-986.027) (-987.753) -- 0:00:00
      12000 -- [-985.582] (-992.413) (-986.988) (-993.027) * (-982.633) (-993.384) [-987.232] (-985.411) -- 0:01:22
      12500 -- (-983.971) (-986.202) (-984.314) [-985.580] * [-981.353] (-988.068) (-987.752) (-985.413) -- 0:01:19
      13000 -- [-983.980] (-986.693) (-996.044) (-980.619) * [-983.541] (-985.818) (-988.032) (-993.338) -- 0:01:15
      13500 -- (-985.777) (-989.431) [-984.379] (-986.200) * [-988.996] (-985.266) (-993.396) (-984.265) -- 0:01:13
      14000 -- (-997.665) (-988.319) (-1004.091) [-988.297] * [-987.198] (-991.851) (-986.445) (-989.116) -- 0:01:10
      14500 -- [-992.239] (-991.221) (-990.489) (-992.067) * [-986.275] (-989.102) (-984.881) (-990.525) -- 0:01:07
      15000 -- (-992.990) (-989.262) [-983.181] (-989.173) * [-983.653] (-988.164) (-987.246) (-984.920) -- 0:01:05

      Average standard deviation of split frequencies: 0.062854

      15500 -- [-991.014] (-999.951) (-988.840) (-982.701) * (-986.153) [-984.154] (-984.726) (-985.165) -- 0:01:03
      16000 -- (-994.367) (-990.912) [-990.370] (-992.409) * [-986.020] (-986.993) (-984.072) (-990.787) -- 0:01:01
      16500 -- (-994.306) (-980.869) [-993.121] (-992.612) * (-986.985) [-983.611] (-993.657) (-990.022) -- 0:00:59
      17000 -- [-988.672] (-982.789) (-990.142) (-988.445) * (-987.832) (-984.612) [-988.575] (-994.616) -- 0:00:57
      17500 -- (-985.766) [-989.641] (-986.759) (-998.864) * (-986.936) (-985.619) (-984.785) [-982.480] -- 0:00:56
      18000 -- (-989.163) (-990.439) [-987.332] (-991.643) * (-983.948) [-986.149] (-985.077) (-990.394) -- 0:00:54
      18500 -- [-985.544] (-988.435) (-988.505) (-989.954) * [-986.932] (-983.247) (-988.725) (-988.198) -- 0:00:53
      19000 -- [-986.762] (-988.126) (-992.973) (-1000.272) * (-994.212) (-985.819) (-991.002) [-983.194] -- 0:00:51
      19500 -- [-981.407] (-987.748) (-986.534) (-990.841) * (-984.675) (-981.473) [-986.715] (-991.672) -- 0:00:50
      20000 -- [-987.122] (-996.790) (-991.836) (-1003.677) * (-986.743) [-976.379] (-989.293) (-995.018) -- 0:00:49

      Average standard deviation of split frequencies: 0.065388

      20500 -- [-981.109] (-992.258) (-993.123) (-981.185) * (-986.931) [-978.566] (-989.488) (-987.138) -- 0:00:47
      21000 -- (-989.773) (-988.471) (-991.770) [-978.701] * (-986.765) [-978.914] (-989.018) (-989.193) -- 0:00:46
      21500 -- (-986.591) [-979.295] (-986.914) (-980.165) * (-997.053) (-976.841) [-985.630] (-990.142) -- 0:00:45
      22000 -- (-985.264) [-976.505] (-994.640) (-977.649) * (-991.322) (-977.813) (-996.641) [-988.518] -- 0:00:44
      22500 -- (-977.784) (-976.976) (-987.197) [-979.811] * (-984.085) (-980.049) [-988.535] (-984.253) -- 0:00:43
      23000 -- (-979.074) [-976.357] (-986.679) (-977.217) * (-993.392) [-977.338] (-983.274) (-976.283) -- 0:00:42
      23500 -- (-976.959) [-976.730] (-981.230) (-977.743) * [-982.990] (-977.802) (-991.306) (-979.242) -- 0:00:41
      24000 -- (-979.403) [-977.094] (-981.291) (-977.680) * (-990.037) (-981.356) (-994.078) [-979.182] -- 0:00:40
      24500 -- (-978.246) (-976.692) [-983.837] (-976.046) * (-999.570) (-976.414) (-996.376) [-980.822] -- 0:00:39
      25000 -- [-978.921] (-979.101) (-983.618) (-978.239) * (-988.492) [-976.683] (-986.168) (-979.257) -- 0:00:39

      Average standard deviation of split frequencies: 0.062981

      25500 -- (-978.178) (-979.263) (-996.744) [-976.811] * (-990.149) [-977.253] (-990.842) (-981.448) -- 0:00:38
      26000 -- [-979.440] (-979.792) (-986.385) (-978.132) * (-994.373) [-980.014] (-985.513) (-980.895) -- 0:00:37
      26500 -- (-979.996) [-976.991] (-985.038) (-978.255) * (-1003.150) [-983.200] (-988.862) (-978.179) -- 0:00:36
      27000 -- (-979.556) [-978.293] (-985.311) (-977.368) * (-987.863) (-981.462) (-991.629) [-977.606] -- 0:00:36
      27500 -- (-980.786) (-977.550) [-984.324] (-976.179) * [-992.925] (-977.032) (-985.148) (-977.766) -- 0:01:10
      28000 -- (-977.218) (-977.286) (-989.898) [-976.190] * (-987.861) (-978.072) (-987.841) [-977.131] -- 0:01:09
      28500 -- [-976.270] (-977.738) (-988.925) (-978.107) * (-989.150) (-976.877) [-985.244] (-977.153) -- 0:01:08
      29000 -- (-977.027) (-982.427) (-989.407) [-980.368] * (-991.915) (-977.696) (-981.857) [-976.454] -- 0:01:06
      29500 -- (-976.975) (-985.656) (-990.770) [-978.341] * (-984.088) (-978.122) (-987.455) [-980.187] -- 0:01:05
      30000 -- (-977.825) (-976.734) [-988.994] (-977.470) * (-989.471) (-978.255) [-987.509] (-976.430) -- 0:01:04

      Average standard deviation of split frequencies: 0.053397

      30500 -- (-977.762) (-976.581) (-990.220) [-979.393] * (-991.929) (-978.635) [-984.936] (-976.771) -- 0:01:03
      31000 -- [-977.811] (-979.377) (-997.593) (-982.868) * (-988.264) (-976.846) [-987.456] (-978.268) -- 0:01:02
      31500 -- (-978.352) [-980.204] (-989.523) (-976.621) * (-989.944) [-977.159] (-986.915) (-979.613) -- 0:01:01
      32000 -- [-978.427] (-979.389) (-989.025) (-976.067) * (-987.718) (-978.295) [-985.141] (-979.319) -- 0:01:00
      32500 -- [-977.322] (-977.423) (-991.535) (-978.480) * (-986.890) (-976.893) [-986.383] (-979.023) -- 0:00:59
      33000 -- [-976.663] (-978.282) (-991.017) (-976.972) * (-986.543) (-979.091) (-992.374) [-978.259] -- 0:00:58
      33500 -- [-977.237] (-978.069) (-989.193) (-976.501) * (-994.691) [-978.816] (-990.234) (-978.293) -- 0:00:57
      34000 -- (-981.643) (-983.115) [-985.199] (-977.059) * (-990.646) (-977.715) [-991.938] (-978.352) -- 0:00:56
      34500 -- [-976.810] (-980.829) (-995.607) (-976.223) * (-987.427) [-977.767] (-994.088) (-977.740) -- 0:00:55
      35000 -- [-976.768] (-976.721) (-994.437) (-977.542) * [-982.857] (-980.977) (-983.868) (-980.444) -- 0:00:55

      Average standard deviation of split frequencies: 0.048243

      35500 -- (-978.100) (-977.288) (-984.219) [-977.628] * (-989.084) (-983.099) [-981.109] (-979.282) -- 0:00:54
      36000 -- (-976.647) (-978.582) [-985.651] (-979.867) * (-988.987) (-977.554) (-981.267) [-976.916] -- 0:00:53
      36500 -- (-976.997) [-978.355] (-981.575) (-980.128) * [-985.176] (-977.569) (-996.117) (-978.902) -- 0:00:52
      37000 -- (-977.114) (-983.565) (-1001.095) [-978.650] * (-984.723) [-977.242] (-985.547) (-980.163) -- 0:00:52
      37500 -- (-976.250) (-979.771) [-990.276] (-976.920) * (-990.429) (-979.661) (-987.795) [-978.234] -- 0:00:51
      38000 -- (-982.562) (-976.715) (-992.129) [-977.353] * (-983.254) [-980.120] (-985.374) (-978.103) -- 0:00:50
      38500 -- (-978.883) [-977.426] (-986.663) (-979.357) * [-991.786] (-978.060) (-983.146) (-978.918) -- 0:00:49
      39000 -- [-978.682] (-978.326) (-986.532) (-979.509) * (-991.756) (-980.290) [-993.577] (-979.895) -- 0:00:49
      39500 -- (-979.969) (-980.156) [-993.149] (-977.219) * (-991.332) (-980.544) [-984.891] (-976.531) -- 0:00:48
      40000 -- (-979.079) [-978.941] (-988.079) (-977.765) * (-990.875) [-980.580] (-985.446) (-980.660) -- 0:00:48

      Average standard deviation of split frequencies: 0.034094

      40500 -- (-976.873) [-977.707] (-987.781) (-979.793) * (-985.139) (-980.029) [-986.864] (-981.084) -- 0:00:47
      41000 -- (-979.027) (-977.301) (-985.262) [-979.841] * (-983.181) [-980.712] (-989.518) (-979.308) -- 0:00:46
      41500 -- (-978.948) (-977.315) (-988.360) [-977.247] * (-989.247) (-978.496) (-985.573) [-978.212] -- 0:00:46
      42000 -- (-980.892) [-980.352] (-988.333) (-976.819) * (-983.613) [-976.582] (-991.444) (-978.103) -- 0:00:45
      42500 -- (-978.141) (-979.895) (-989.124) [-976.216] * [-982.264] (-977.416) (-987.714) (-978.190) -- 0:00:45
      43000 -- (-978.790) (-985.256) (-983.911) [-977.567] * [-994.191] (-979.145) (-983.409) (-980.804) -- 0:00:44
      43500 -- (-976.448) (-980.907) [-984.684] (-977.338) * [-987.877] (-980.096) (-989.159) (-977.508) -- 0:00:43
      44000 -- (-976.466) (-977.396) [-983.232] (-976.442) * (-994.173) [-976.689] (-983.934) (-977.509) -- 0:01:05
      44500 -- (-980.410) (-978.721) [-986.031] (-976.368) * (-989.813) (-976.977) [-987.279] (-980.539) -- 0:01:04
      45000 -- (-978.954) [-978.512] (-984.421) (-977.261) * (-988.720) [-975.843] (-985.236) (-977.275) -- 0:01:03

      Average standard deviation of split frequencies: 0.028304

      45500 -- (-980.328) [-977.702] (-982.616) (-978.370) * [-984.199] (-976.904) (-991.351) (-977.920) -- 0:01:02
      46000 -- (-980.257) (-976.863) [-978.272] (-979.544) * (-991.894) (-980.022) [-977.956] (-976.732) -- 0:01:02
      46500 -- (-979.489) (-979.845) (-977.181) [-980.094] * (-982.342) [-978.434] (-978.070) (-976.580) -- 0:01:01
      47000 -- (-981.621) (-983.616) (-978.201) [-981.099] * (-985.297) [-978.702] (-980.503) (-976.963) -- 0:01:00
      47500 -- (-981.523) [-978.640] (-977.905) (-979.665) * [-987.018] (-979.654) (-979.946) (-980.476) -- 0:01:00
      48000 -- (-982.024) (-980.247) (-977.147) [-981.299] * (-988.263) (-977.541) (-984.349) [-977.968] -- 0:00:59
      48500 -- (-983.069) [-981.746] (-975.992) (-981.041) * [-983.639] (-979.034) (-980.473) (-979.288) -- 0:00:58
      49000 -- (-977.621) (-978.456) [-976.932] (-977.977) * (-992.463) (-980.616) (-980.067) [-980.132] -- 0:00:58
      49500 -- (-978.943) (-977.093) [-977.686] (-980.155) * (-982.194) [-978.094] (-978.214) (-977.819) -- 0:00:57
      50000 -- [-976.709] (-976.955) (-980.807) (-976.495) * (-980.109) [-981.002] (-977.375) (-977.758) -- 0:00:57

      Average standard deviation of split frequencies: 0.029684

      50500 -- (-976.176) [-977.417] (-978.047) (-976.534) * (-979.806) (-978.000) [-976.776] (-977.768) -- 0:00:56
      51000 -- (-978.552) [-977.464] (-978.666) (-979.139) * (-978.458) (-977.736) [-977.857] (-977.738) -- 0:00:55
      51500 -- (-977.945) (-976.809) (-979.586) [-978.048] * (-976.460) (-979.482) [-977.699] (-978.973) -- 0:00:55
      52000 -- (-976.939) (-980.101) [-978.778] (-978.211) * [-978.349] (-977.621) (-979.604) (-980.442) -- 0:00:54
      52500 -- (-976.008) (-984.230) (-977.151) [-977.311] * (-976.627) [-978.586] (-977.311) (-976.892) -- 0:00:54
      53000 -- [-977.213] (-982.000) (-976.438) (-977.915) * (-978.200) [-977.382] (-976.999) (-975.947) -- 0:00:53
      53500 -- (-977.377) (-978.553) [-978.072] (-982.001) * [-975.901] (-977.329) (-976.760) (-976.561) -- 0:00:53
      54000 -- (-977.580) (-978.751) [-977.905] (-985.031) * (-976.456) (-977.386) (-977.271) [-977.306] -- 0:00:52
      54500 -- (-978.426) [-977.152] (-978.092) (-977.399) * (-980.468) [-979.216] (-977.548) (-976.406) -- 0:00:52
      55000 -- [-977.423] (-978.224) (-979.058) (-978.107) * (-977.830) (-979.557) (-977.816) [-979.179] -- 0:00:51

      Average standard deviation of split frequencies: 0.027469

      55500 -- [-976.895] (-978.810) (-978.314) (-978.372) * [-978.220] (-977.444) (-978.802) (-979.113) -- 0:00:51
      56000 -- (-977.727) (-979.167) (-977.861) [-977.616] * (-982.144) (-977.544) (-977.089) [-979.204] -- 0:00:50
      56500 -- [-978.373] (-977.366) (-979.844) (-978.698) * (-980.342) (-977.419) (-978.400) [-977.372] -- 0:00:50
      57000 -- (-979.556) [-978.308] (-978.199) (-976.184) * (-979.629) [-977.505] (-976.766) (-980.403) -- 0:00:49
      57500 -- (-976.936) (-979.160) [-976.851] (-978.233) * (-981.250) (-978.666) [-978.872] (-980.110) -- 0:00:49
      58000 -- (-978.248) (-979.677) [-977.628] (-978.914) * [-978.376] (-980.052) (-980.242) (-979.152) -- 0:00:48
      58500 -- (-976.266) (-979.824) [-976.512] (-979.207) * (-977.941) (-978.400) [-983.474] (-976.736) -- 0:00:48
      59000 -- [-976.596] (-978.748) (-976.829) (-977.579) * (-980.593) [-976.448] (-981.362) (-977.094) -- 0:00:47
      59500 -- (-977.512) [-978.989] (-976.668) (-976.153) * (-979.061) (-977.437) [-978.547] (-982.951) -- 0:00:47
      60000 -- (-978.022) (-978.153) (-978.298) [-976.270] * (-978.713) (-976.974) [-977.105] (-977.867) -- 0:01:02

      Average standard deviation of split frequencies: 0.031491

      60500 -- (-978.429) (-981.969) [-980.723] (-976.270) * (-980.581) [-976.695] (-976.837) (-976.720) -- 0:01:02
      61000 -- [-976.979] (-979.344) (-977.606) (-977.110) * (-979.492) [-978.654] (-978.910) (-979.777) -- 0:01:01
      61500 -- (-977.850) (-976.955) (-979.233) [-977.083] * (-980.492) (-979.242) (-979.716) [-976.271] -- 0:01:01
      62000 -- (-979.180) (-976.125) [-980.035] (-979.027) * (-977.312) (-981.394) (-976.783) [-978.893] -- 0:01:00
      62500 -- (-979.956) [-976.411] (-977.698) (-981.666) * [-977.460] (-977.558) (-976.783) (-981.067) -- 0:01:00
      63000 -- (-977.224) (-976.488) [-977.054] (-978.978) * (-977.704) [-982.542] (-977.303) (-977.395) -- 0:00:59
      63500 -- (-977.701) (-979.430) (-980.625) [-978.806] * (-977.249) [-976.979] (-977.365) (-977.720) -- 0:00:58
      64000 -- (-977.523) (-977.603) (-980.596) [-978.525] * [-976.611] (-977.009) (-978.182) (-976.567) -- 0:00:58
      64500 -- (-977.593) [-977.472] (-980.194) (-976.921) * (-977.298) (-977.453) [-978.393] (-977.207) -- 0:00:58
      65000 -- (-978.450) (-977.517) [-978.526] (-977.407) * (-977.564) (-976.893) (-978.101) [-977.144] -- 0:00:57

      Average standard deviation of split frequencies: 0.032855

      65500 -- [-976.934] (-977.979) (-978.380) (-980.094) * (-978.856) (-978.120) [-979.296] (-976.492) -- 0:00:57
      66000 -- (-978.251) (-978.260) [-978.235] (-978.737) * (-977.285) (-976.780) [-978.065] (-978.955) -- 0:00:56
      66500 -- [-979.061] (-977.475) (-978.033) (-977.149) * (-979.626) [-976.734] (-978.361) (-976.987) -- 0:00:56
      67000 -- [-977.308] (-977.187) (-976.327) (-977.625) * (-981.425) (-976.300) (-977.255) [-976.945] -- 0:00:55
      67500 -- (-978.503) (-976.610) (-976.988) [-977.929] * (-978.352) (-976.256) [-978.117] (-989.031) -- 0:00:55
      68000 -- (-977.762) (-977.066) (-976.307) [-982.201] * [-981.101] (-977.435) (-977.241) (-985.804) -- 0:00:54
      68500 -- (-979.489) (-978.085) [-977.366] (-981.940) * (-977.740) (-980.051) (-976.551) [-979.590] -- 0:00:54
      69000 -- (-979.221) [-977.912] (-978.248) (-984.410) * [-977.830] (-980.162) (-976.838) (-979.885) -- 0:00:53
      69500 -- (-978.129) (-979.018) (-977.171) [-980.422] * (-977.459) [-978.508] (-982.507) (-980.511) -- 0:00:53
      70000 -- [-976.906] (-977.150) (-977.523) (-980.538) * (-980.343) (-977.053) [-979.902] (-976.373) -- 0:00:53

      Average standard deviation of split frequencies: 0.032020

      70500 -- (-976.412) (-979.492) (-978.665) [-978.390] * (-979.876) (-976.318) (-982.558) [-978.657] -- 0:00:52
      71000 -- (-977.407) [-977.684] (-978.875) (-978.983) * [-977.562] (-979.370) (-980.241) (-978.710) -- 0:00:52
      71500 -- (-976.726) (-979.043) (-977.363) [-976.557] * (-980.539) (-978.590) (-977.631) [-976.974] -- 0:00:51
      72000 -- (-976.152) (-978.814) (-976.086) [-976.859] * (-976.262) (-977.038) [-976.099] (-978.857) -- 0:00:51
      72500 -- [-979.053] (-979.407) (-976.736) (-978.096) * (-978.741) (-976.941) [-976.081] (-976.262) -- 0:00:51
      73000 -- (-980.951) (-976.098) [-979.353] (-978.535) * (-977.037) (-978.436) (-976.088) [-980.160] -- 0:00:50
      73500 -- (-976.612) (-976.854) (-979.215) [-979.612] * (-976.888) [-976.838] (-979.964) (-980.057) -- 0:00:50
      74000 -- [-977.225] (-977.910) (-979.874) (-976.139) * (-977.799) [-976.406] (-979.038) (-978.297) -- 0:00:50
      74500 -- (-976.616) [-977.010] (-978.120) (-977.803) * [-978.213] (-977.236) (-978.807) (-980.259) -- 0:00:49
      75000 -- (-981.629) (-977.767) (-977.853) [-976.912] * [-977.608] (-977.084) (-979.169) (-977.040) -- 0:00:49

      Average standard deviation of split frequencies: 0.030703

      75500 -- (-978.500) [-977.398] (-981.433) (-977.196) * [-979.254] (-977.086) (-980.003) (-976.979) -- 0:00:48
      76000 -- (-977.887) [-977.386] (-979.922) (-976.256) * (-978.675) (-977.718) (-983.178) [-981.050] -- 0:01:00
      76500 -- (-980.064) [-976.621] (-978.456) (-976.932) * (-981.083) (-977.536) (-976.161) [-979.505] -- 0:01:00
      77000 -- (-979.802) [-978.891] (-978.630) (-980.143) * [-980.924] (-981.499) (-978.973) (-976.293) -- 0:00:59
      77500 -- (-980.209) (-978.219) (-979.239) [-979.249] * (-982.569) [-977.258] (-980.521) (-976.293) -- 0:00:59
      78000 -- (-981.686) [-977.234] (-980.309) (-977.835) * (-979.809) (-978.609) (-979.378) [-980.656] -- 0:00:59
      78500 -- (-981.535) [-977.088] (-978.054) (-977.829) * (-980.033) [-977.734] (-978.324) (-979.310) -- 0:00:58
      79000 -- [-977.059] (-976.900) (-977.404) (-979.145) * (-978.999) [-976.396] (-977.733) (-977.188) -- 0:00:58
      79500 -- (-977.368) (-976.694) (-978.071) [-976.678] * (-978.887) (-977.163) [-978.939] (-979.046) -- 0:00:57
      80000 -- [-976.757] (-976.959) (-977.913) (-976.490) * [-976.765] (-978.647) (-978.125) (-981.764) -- 0:00:57

      Average standard deviation of split frequencies: 0.027596

      80500 -- [-976.596] (-976.470) (-976.304) (-976.754) * (-981.442) [-976.903] (-978.204) (-977.209) -- 0:00:57
      81000 -- [-976.130] (-977.401) (-978.522) (-979.055) * (-977.818) (-977.343) [-978.452] (-980.823) -- 0:00:56
      81500 -- (-976.381) (-978.453) (-977.089) [-980.275] * (-976.344) (-979.363) [-978.084] (-978.669) -- 0:00:56
      82000 -- (-976.849) (-977.057) (-979.465) [-976.489] * [-977.549] (-982.365) (-978.487) (-977.740) -- 0:00:55
      82500 -- (-976.538) (-979.350) (-978.546) [-979.017] * [-977.252] (-977.730) (-979.725) (-977.835) -- 0:00:55
      83000 -- (-980.156) [-978.470] (-978.321) (-975.901) * (-977.077) (-977.906) [-981.860] (-977.808) -- 0:00:55
      83500 -- (-977.360) [-977.164] (-978.780) (-975.829) * (-978.081) (-977.721) (-978.090) [-977.337] -- 0:00:54
      84000 -- (-979.835) [-978.001] (-978.013) (-977.990) * (-977.981) (-980.767) [-978.710] (-979.394) -- 0:00:54
      84500 -- [-977.606] (-978.148) (-977.936) (-977.945) * (-979.279) [-978.209] (-982.589) (-982.191) -- 0:00:54
      85000 -- (-978.170) (-979.271) [-982.407] (-981.895) * [-976.573] (-978.628) (-979.357) (-979.020) -- 0:00:53

      Average standard deviation of split frequencies: 0.028930

      85500 -- (-977.668) (-978.205) (-986.455) [-978.882] * (-976.432) [-976.899] (-977.139) (-979.624) -- 0:00:53
      86000 -- (-980.116) (-977.857) (-983.313) [-981.095] * [-977.476] (-976.568) (-982.414) (-977.952) -- 0:00:53
      86500 -- (-980.289) [-977.598] (-977.781) (-982.510) * (-976.975) (-977.075) [-979.504] (-976.723) -- 0:00:52
      87000 -- [-981.248] (-977.706) (-977.779) (-979.044) * (-979.183) [-977.764] (-977.818) (-977.785) -- 0:00:52
      87500 -- (-976.923) (-976.654) (-979.309) [-980.862] * (-978.789) (-980.201) (-978.019) [-976.618] -- 0:00:52
      88000 -- (-976.211) [-976.386] (-981.293) (-979.338) * (-977.389) (-978.927) [-977.738] (-977.333) -- 0:00:51
      88500 -- (-976.893) (-978.359) [-977.554] (-978.621) * (-980.852) [-977.764] (-977.281) (-977.350) -- 0:00:51
      89000 -- (-978.722) (-981.130) (-977.652) [-977.368] * (-981.883) (-982.275) [-976.756] (-977.336) -- 0:00:51
      89500 -- [-978.995] (-979.723) (-979.756) (-979.876) * (-977.572) [-979.355] (-980.710) (-981.998) -- 0:00:50
      90000 -- (-977.145) [-978.171] (-978.770) (-980.755) * (-985.133) [-980.195] (-976.445) (-976.909) -- 0:00:50

      Average standard deviation of split frequencies: 0.027730

      90500 -- (-982.929) [-977.679] (-980.257) (-981.481) * (-982.267) (-983.452) [-976.941] (-978.739) -- 0:00:50
      91000 -- (-978.918) (-980.879) [-978.920] (-981.256) * [-976.682] (-982.251) (-976.615) (-977.205) -- 0:00:49
      91500 -- (-982.517) (-977.010) (-976.558) [-976.891] * [-981.156] (-985.304) (-980.264) (-978.014) -- 0:00:49
      92000 -- (-978.158) (-976.976) [-976.941] (-978.629) * (-976.718) (-980.120) (-978.050) [-979.342] -- 0:00:49
      92500 -- (-977.457) (-977.897) [-976.938] (-977.036) * (-983.166) (-982.076) (-977.091) [-982.286] -- 0:00:58
      93000 -- (-984.267) [-977.082] (-976.937) (-976.134) * [-977.498] (-976.298) (-977.763) (-977.933) -- 0:00:58
      93500 -- (-982.581) (-976.689) [-977.678] (-976.379) * (-980.282) (-976.525) [-976.791] (-976.923) -- 0:00:58
      94000 -- (-979.370) (-976.689) [-976.915] (-977.502) * (-978.303) [-976.429] (-980.232) (-977.782) -- 0:00:57
      94500 -- (-979.021) [-977.326] (-978.203) (-977.171) * (-977.085) (-977.499) (-977.576) [-977.553] -- 0:00:57
      95000 -- (-979.540) [-977.064] (-981.456) (-978.128) * [-977.793] (-978.763) (-979.779) (-976.791) -- 0:00:57

      Average standard deviation of split frequencies: 0.025644

      95500 -- (-981.579) [-977.974] (-979.040) (-980.030) * (-977.206) (-976.389) (-978.632) [-977.069] -- 0:00:56
      96000 -- (-980.122) (-982.790) [-978.535] (-976.536) * (-976.209) (-977.188) (-978.342) [-977.063] -- 0:00:56
      96500 -- (-980.384) [-977.798] (-976.916) (-975.902) * [-978.471] (-981.141) (-977.073) (-978.382) -- 0:00:56
      97000 -- [-977.107] (-981.404) (-977.130) (-976.185) * (-978.966) [-978.004] (-976.779) (-978.224) -- 0:00:55
      97500 -- [-976.839] (-981.808) (-976.571) (-977.708) * (-978.603) (-977.738) [-982.140] (-979.393) -- 0:00:55
      98000 -- (-976.877) (-981.327) (-979.354) [-978.986] * [-976.708] (-980.997) (-982.222) (-977.365) -- 0:00:55
      98500 -- (-979.006) (-983.315) (-978.252) [-979.223] * (-978.058) (-979.075) (-981.450) [-979.264] -- 0:00:54
      99000 -- (-978.261) (-981.523) (-976.555) [-977.341] * (-978.066) [-976.956] (-978.217) (-983.331) -- 0:00:54
      99500 -- [-977.222] (-976.615) (-976.630) (-978.249) * (-978.798) [-977.516] (-983.882) (-983.049) -- 0:00:54
      100000 -- (-976.349) (-978.899) (-976.847) [-978.355] * [-976.989] (-977.612) (-978.108) (-982.027) -- 0:00:54

      Average standard deviation of split frequencies: 0.024975

      100500 -- [-976.769] (-978.635) (-977.123) (-979.030) * (-983.685) [-976.523] (-979.989) (-980.872) -- 0:00:53
      101000 -- (-975.829) (-979.903) (-976.590) [-978.949] * (-977.603) (-976.999) (-979.836) [-980.112] -- 0:00:53
      101500 -- (-977.868) [-977.865] (-976.576) (-981.812) * (-980.161) (-978.787) [-976.820] (-979.976) -- 0:00:53
      102000 -- (-977.616) (-979.602) [-978.211] (-978.246) * (-979.999) [-977.938] (-978.526) (-976.371) -- 0:00:52
      102500 -- [-978.744] (-979.315) (-976.416) (-979.851) * (-979.635) (-977.128) [-977.406] (-976.988) -- 0:00:52
      103000 -- [-979.595] (-979.300) (-977.037) (-981.147) * (-978.102) [-979.250] (-979.334) (-977.688) -- 0:00:52
      103500 -- (-978.397) [-977.232] (-977.052) (-978.774) * (-979.872) [-976.421] (-981.718) (-979.126) -- 0:00:51
      104000 -- (-976.207) [-977.225] (-978.917) (-979.416) * (-977.618) [-976.549] (-979.126) (-980.873) -- 0:00:51
      104500 -- (-979.480) (-976.553) [-977.784] (-978.012) * [-979.823] (-978.256) (-980.092) (-981.212) -- 0:00:51
      105000 -- (-978.747) [-977.251] (-978.667) (-976.276) * (-976.798) [-977.671] (-977.268) (-981.064) -- 0:00:51

      Average standard deviation of split frequencies: 0.024109

      105500 -- (-980.235) (-979.653) [-976.483] (-979.142) * (-980.445) [-977.196] (-978.530) (-980.632) -- 0:00:50
      106000 -- (-979.427) (-979.951) (-983.504) [-978.048] * (-976.861) [-979.381] (-978.890) (-977.252) -- 0:00:50
      106500 -- (-976.858) (-977.678) (-976.115) [-976.138] * (-976.971) [-977.714] (-977.184) (-977.750) -- 0:00:50
      107000 -- [-979.905] (-978.204) (-984.257) (-980.439) * (-977.799) (-980.671) (-977.091) [-978.461] -- 0:00:50
      107500 -- (-984.379) (-979.343) [-978.835] (-978.523) * [-977.297] (-977.905) (-977.945) (-979.891) -- 0:00:49
      108000 -- [-981.478] (-977.003) (-978.798) (-979.794) * (-976.479) [-979.952] (-977.959) (-976.745) -- 0:00:49
      108500 -- (-986.879) [-979.324] (-977.588) (-982.489) * [-977.238] (-981.867) (-978.583) (-976.838) -- 0:00:57
      109000 -- [-979.044] (-978.150) (-979.777) (-979.336) * (-977.855) (-979.818) [-979.228] (-977.717) -- 0:00:57
      109500 -- (-978.106) [-976.887] (-978.169) (-977.783) * [-977.730] (-980.719) (-978.131) (-987.535) -- 0:00:56
      110000 -- [-976.304] (-980.154) (-979.455) (-977.121) * (-976.873) [-977.174] (-977.301) (-983.687) -- 0:00:56

      Average standard deviation of split frequencies: 0.024661

      110500 -- (-982.447) [-978.754] (-982.838) (-976.259) * [-977.906] (-976.735) (-976.571) (-976.948) -- 0:00:56
      111000 -- [-977.885] (-981.044) (-978.334) (-977.581) * [-978.093] (-977.972) (-976.879) (-978.099) -- 0:00:56
      111500 -- (-977.132) [-978.113] (-979.103) (-979.272) * (-979.039) [-976.816] (-978.413) (-979.344) -- 0:00:55
      112000 -- (-977.240) (-978.048) (-977.345) [-978.052] * [-979.447] (-976.541) (-979.748) (-982.434) -- 0:00:55
      112500 -- [-976.991] (-977.424) (-979.034) (-979.590) * (-977.356) (-979.213) [-982.808] (-979.101) -- 0:00:55
      113000 -- (-981.171) [-977.760] (-983.227) (-978.348) * (-979.502) (-978.890) (-977.470) [-980.267] -- 0:00:54
      113500 -- [-978.292] (-979.559) (-977.768) (-978.231) * (-977.481) (-981.385) [-976.759] (-978.145) -- 0:00:54
      114000 -- (-982.917) (-978.764) [-981.569] (-980.477) * (-978.136) [-979.236] (-976.903) (-978.932) -- 0:00:54
      114500 -- (-979.025) [-978.442] (-978.518) (-979.662) * (-976.809) [-979.003] (-979.166) (-980.354) -- 0:00:54
      115000 -- (-978.234) (-979.855) [-977.758] (-982.184) * (-978.026) (-976.749) (-976.161) [-977.388] -- 0:00:53

      Average standard deviation of split frequencies: 0.024383

      115500 -- [-977.181] (-980.294) (-978.053) (-981.322) * (-977.856) [-977.186] (-976.794) (-978.122) -- 0:00:53
      116000 -- (-979.168) (-976.640) [-977.489] (-977.512) * (-979.853) (-978.908) (-977.229) [-979.623] -- 0:00:53
      116500 -- (-978.509) (-978.182) [-977.496] (-977.024) * [-976.895] (-977.413) (-977.016) (-981.152) -- 0:00:53
      117000 -- (-978.346) [-980.598] (-977.905) (-977.371) * (-976.951) (-977.114) [-977.402] (-978.663) -- 0:00:52
      117500 -- [-976.667] (-977.515) (-980.351) (-976.741) * [-976.945] (-976.100) (-978.435) (-977.339) -- 0:00:52
      118000 -- [-977.318] (-977.241) (-978.861) (-978.803) * (-977.037) [-975.901] (-979.026) (-979.145) -- 0:00:52
      118500 -- [-981.099] (-977.661) (-980.509) (-978.039) * (-978.896) (-976.907) (-977.727) [-979.365] -- 0:00:52
      119000 -- [-978.481] (-978.839) (-983.057) (-979.321) * (-976.741) (-977.168) [-978.513] (-977.379) -- 0:00:51
      119500 -- [-978.008] (-979.489) (-982.594) (-978.312) * [-977.131] (-978.696) (-977.464) (-980.428) -- 0:00:51
      120000 -- [-977.430] (-980.122) (-978.479) (-978.877) * (-978.638) [-977.711] (-981.248) (-982.051) -- 0:00:51

      Average standard deviation of split frequencies: 0.024742

      120500 -- (-977.156) (-978.165) [-979.824] (-980.885) * (-978.853) (-977.125) (-978.784) [-977.700] -- 0:00:51
      121000 -- [-977.789] (-981.170) (-978.333) (-980.234) * [-978.487] (-976.578) (-977.034) (-978.510) -- 0:00:50
      121500 -- (-980.099) (-978.750) (-977.952) [-978.988] * (-976.570) (-977.038) [-978.997] (-980.085) -- 0:00:50
      122000 -- (-977.886) (-977.271) (-978.653) [-978.527] * (-977.678) (-976.425) (-979.165) [-981.139] -- 0:00:50
      122500 -- (-977.059) [-977.932] (-981.254) (-979.258) * (-987.851) (-976.357) (-978.754) [-981.171] -- 0:00:50
      123000 -- (-977.413) (-978.967) (-976.724) [-979.625] * (-982.970) (-976.357) [-978.983] (-981.375) -- 0:00:49
      123500 -- [-977.176] (-978.682) (-977.981) (-976.969) * [-977.849] (-978.822) (-979.908) (-982.185) -- 0:00:49
      124000 -- (-980.028) (-980.967) (-980.093) [-980.586] * (-978.647) [-980.506] (-979.009) (-983.059) -- 0:00:49
      124500 -- (-981.353) (-977.900) (-978.918) [-980.550] * (-978.933) [-976.349] (-979.118) (-983.110) -- 0:00:56
      125000 -- [-978.261] (-977.276) (-980.177) (-979.434) * (-982.057) (-977.663) [-977.321] (-980.316) -- 0:00:56

      Average standard deviation of split frequencies: 0.025401

      125500 -- (-977.640) (-982.726) [-977.069] (-979.977) * (-979.393) (-977.061) [-977.583] (-979.326) -- 0:00:55
      126000 -- (-976.096) (-980.163) (-978.204) [-978.434] * (-976.970) (-978.350) (-977.661) [-981.476] -- 0:00:55
      126500 -- (-976.427) (-978.015) [-977.496] (-980.891) * [-978.924] (-978.537) (-977.469) (-979.163) -- 0:00:55
      127000 -- (-977.495) (-978.139) [-977.769] (-980.374) * [-977.697] (-977.142) (-976.116) (-979.115) -- 0:00:54
      127500 -- (-979.353) [-976.465] (-981.268) (-977.939) * (-978.322) (-979.728) (-975.943) [-976.672] -- 0:00:54
      128000 -- (-978.230) (-977.251) (-981.283) [-977.252] * (-979.246) (-978.413) [-977.755] (-976.811) -- 0:00:54
      128500 -- [-978.621] (-978.280) (-977.695) (-977.311) * (-978.242) [-980.034] (-979.327) (-978.983) -- 0:00:54
      129000 -- [-978.902] (-977.913) (-977.293) (-978.569) * (-978.417) (-979.630) (-980.826) [-976.834] -- 0:00:54
      129500 -- (-976.944) (-978.461) [-978.428] (-978.136) * (-979.412) (-978.036) (-979.312) [-979.168] -- 0:00:53
      130000 -- [-979.996] (-978.204) (-978.062) (-978.828) * (-980.056) (-981.672) (-981.020) [-978.095] -- 0:00:53

      Average standard deviation of split frequencies: 0.026456

      130500 -- (-980.368) (-978.496) (-979.109) [-981.722] * (-979.231) (-977.598) (-977.073) [-977.832] -- 0:00:53
      131000 -- (-975.864) (-977.782) (-977.138) [-981.000] * (-980.341) [-976.746] (-979.296) (-978.967) -- 0:00:53
      131500 -- (-979.947) (-978.414) [-976.157] (-983.697) * [-976.975] (-977.161) (-976.635) (-980.736) -- 0:00:52
      132000 -- (-979.814) (-978.318) (-977.589) [-977.239] * [-977.250] (-976.573) (-976.810) (-977.536) -- 0:00:52
      132500 -- (-976.651) (-980.260) (-976.815) [-978.329] * (-978.112) [-976.148] (-976.813) (-977.519) -- 0:00:52
      133000 -- [-976.633] (-977.715) (-976.525) (-979.366) * (-979.150) (-977.559) [-976.811] (-978.185) -- 0:00:52
      133500 -- (-979.464) [-977.093] (-979.492) (-978.061) * (-982.008) (-977.384) [-976.570] (-977.878) -- 0:00:51
      134000 -- (-978.653) (-976.271) (-978.486) [-976.917] * (-977.638) (-976.738) (-977.999) [-978.645] -- 0:00:51
      134500 -- (-977.367) (-976.192) [-978.473] (-979.159) * (-980.473) (-978.999) [-979.329] (-982.727) -- 0:00:51
      135000 -- (-977.333) [-980.113] (-978.103) (-984.166) * (-979.785) [-976.932] (-977.099) (-982.143) -- 0:00:51

      Average standard deviation of split frequencies: 0.025997

      135500 -- (-977.152) [-978.495] (-979.069) (-986.209) * (-977.111) (-979.099) (-978.064) [-981.669] -- 0:00:51
      136000 -- (-979.048) (-978.200) (-978.699) [-978.160] * (-979.872) [-975.907] (-978.132) (-976.366) -- 0:00:50
      136500 -- (-976.125) (-978.043) (-977.824) [-976.861] * [-978.552] (-977.823) (-977.198) (-977.723) -- 0:00:50
      137000 -- (-981.288) (-977.391) [-977.938] (-980.567) * (-977.720) (-983.448) (-977.238) [-977.866] -- 0:00:50
      137500 -- [-981.182] (-976.786) (-977.796) (-979.418) * [-977.869] (-978.471) (-976.435) (-977.050) -- 0:00:50
      138000 -- (-977.537) (-980.497) [-979.227] (-977.230) * (-977.537) (-981.047) [-978.590] (-978.523) -- 0:00:49
      138500 -- [-977.041] (-979.345) (-977.414) (-977.430) * (-977.835) (-979.883) [-979.304] (-977.802) -- 0:00:49
      139000 -- (-977.376) (-978.443) [-977.317] (-977.735) * [-979.727] (-981.050) (-977.790) (-977.558) -- 0:00:49
      139500 -- (-979.849) (-979.452) (-981.149) [-979.229] * (-977.557) (-980.975) (-981.066) [-977.602] -- 0:00:49
      140000 -- (-981.101) [-980.745] (-978.758) (-978.188) * (-978.626) [-978.009] (-981.188) (-981.893) -- 0:00:49

      Average standard deviation of split frequencies: 0.025036

      140500 -- [-984.864] (-979.853) (-978.435) (-978.360) * (-978.794) (-977.057) [-978.582] (-983.102) -- 0:00:55
      141000 -- [-979.303] (-986.124) (-976.795) (-980.388) * [-980.512] (-976.606) (-985.322) (-979.815) -- 0:00:54
      141500 -- (-978.271) (-980.087) [-979.077] (-977.116) * (-978.934) (-978.469) (-977.650) [-978.009] -- 0:00:54
      142000 -- (-978.794) [-977.667] (-979.565) (-977.356) * (-977.893) (-979.048) [-978.433] (-978.350) -- 0:00:54
      142500 -- (-976.887) (-977.243) (-979.122) [-976.571] * (-979.227) [-977.536] (-979.373) (-977.871) -- 0:00:54
      143000 -- (-976.921) (-978.333) (-979.902) [-977.860] * [-981.224] (-981.330) (-981.674) (-978.988) -- 0:00:53
      143500 -- (-978.306) (-979.131) [-978.055] (-977.498) * [-977.810] (-982.027) (-978.143) (-979.617) -- 0:00:53
      144000 -- [-976.071] (-977.721) (-979.384) (-976.053) * [-976.965] (-980.824) (-979.039) (-977.910) -- 0:00:53
      144500 -- [-977.754] (-980.826) (-980.340) (-980.999) * (-978.302) (-979.550) (-979.988) [-979.540] -- 0:00:53
      145000 -- (-977.341) (-977.823) [-980.152] (-980.020) * (-978.885) (-977.945) (-981.193) [-977.945] -- 0:00:53

      Average standard deviation of split frequencies: 0.024754

      145500 -- (-976.878) (-979.430) [-981.374] (-976.916) * [-977.571] (-978.921) (-978.417) (-979.149) -- 0:00:52
      146000 -- (-977.750) [-979.169] (-977.471) (-978.015) * (-977.196) [-978.641] (-979.405) (-978.310) -- 0:00:52
      146500 -- (-976.982) (-978.838) (-977.130) [-976.914] * (-979.858) (-978.631) (-977.021) [-978.651] -- 0:00:52
      147000 -- (-978.091) (-978.003) [-976.353] (-976.852) * (-981.755) [-979.579] (-977.373) (-980.957) -- 0:00:52
      147500 -- [-981.295] (-977.821) (-977.200) (-976.138) * [-976.190] (-976.854) (-975.995) (-980.243) -- 0:00:52
      148000 -- (-978.892) (-979.157) [-977.329] (-978.106) * [-976.542] (-979.389) (-975.982) (-981.773) -- 0:00:51
      148500 -- (-977.891) (-980.826) (-979.674) [-977.691] * (-978.674) [-978.880] (-976.786) (-978.320) -- 0:00:51
      149000 -- [-980.047] (-979.935) (-980.529) (-979.344) * (-978.368) (-977.600) (-979.402) [-979.744] -- 0:00:51
      149500 -- (-979.797) [-976.964] (-980.791) (-978.782) * (-977.385) [-977.661] (-981.573) (-981.323) -- 0:00:51
      150000 -- (-978.012) (-976.679) (-982.800) [-977.686] * [-976.104] (-978.676) (-983.606) (-983.067) -- 0:00:51

      Average standard deviation of split frequencies: 0.024536

      150500 -- [-980.513] (-976.259) (-983.075) (-978.595) * (-978.557) (-976.999) (-980.123) [-978.163] -- 0:00:50
      151000 -- (-975.924) [-976.942] (-979.139) (-977.859) * (-978.449) [-976.750] (-977.149) (-979.278) -- 0:00:50
      151500 -- (-976.180) [-979.659] (-979.180) (-978.141) * (-979.795) (-979.206) [-978.166] (-978.469) -- 0:00:50
      152000 -- (-976.977) [-980.539] (-984.206) (-977.862) * (-985.528) [-976.614] (-978.326) (-976.553) -- 0:00:50
      152500 -- (-977.655) [-978.235] (-978.381) (-978.891) * (-979.195) (-980.133) (-980.753) [-976.358] -- 0:00:50
      153000 -- (-979.302) [-975.793] (-977.400) (-978.843) * (-979.161) [-976.414] (-978.411) (-976.846) -- 0:00:49
      153500 -- (-978.252) (-977.419) [-977.442] (-977.244) * (-980.324) (-978.166) [-977.613] (-978.773) -- 0:00:49
      154000 -- (-976.630) (-977.726) [-976.511] (-976.648) * (-977.958) (-976.006) [-976.370] (-982.841) -- 0:00:49
      154500 -- (-976.130) [-977.232] (-977.240) (-980.575) * (-978.010) [-978.536] (-977.106) (-978.081) -- 0:00:49
      155000 -- (-977.832) (-976.902) [-983.020] (-977.451) * (-980.769) [-976.710] (-980.011) (-977.553) -- 0:00:49

      Average standard deviation of split frequencies: 0.022743

      155500 -- (-976.277) (-981.813) (-978.707) [-978.215] * (-977.914) (-979.281) [-979.029] (-978.547) -- 0:00:48
      156000 -- (-979.207) (-977.027) [-978.731] (-981.059) * (-977.021) (-976.391) (-979.768) [-979.426] -- 0:00:48
      156500 -- [-980.951] (-978.549) (-978.494) (-977.797) * (-976.534) [-982.542] (-982.913) (-977.330) -- 0:00:53
      157000 -- [-980.877] (-979.765) (-980.384) (-977.067) * (-976.037) (-976.605) [-976.662] (-979.275) -- 0:00:53
      157500 -- (-978.693) (-977.102) (-980.347) [-976.068] * (-976.918) [-978.037] (-981.806) (-978.424) -- 0:00:53
      158000 -- [-977.821] (-978.248) (-980.263) (-979.060) * (-976.887) [-978.625] (-977.644) (-981.219) -- 0:00:53
      158500 -- (-980.123) (-978.358) (-979.175) [-977.798] * [-977.671] (-976.761) (-976.966) (-982.877) -- 0:00:53
      159000 -- (-978.473) [-977.849] (-981.887) (-977.312) * (-978.008) (-976.955) [-978.520] (-982.397) -- 0:00:52
      159500 -- (-979.382) (-983.507) [-976.624] (-978.661) * (-977.984) (-979.484) (-978.277) [-982.679] -- 0:00:52
      160000 -- [-980.430] (-977.456) (-978.434) (-976.083) * (-976.688) (-982.232) [-977.286] (-981.619) -- 0:00:52

      Average standard deviation of split frequencies: 0.022739

      160500 -- [-977.871] (-980.205) (-979.311) (-976.145) * (-979.567) (-978.034) (-979.982) [-978.051] -- 0:00:52
      161000 -- [-979.161] (-979.794) (-979.067) (-976.326) * (-979.571) (-977.258) (-977.523) [-978.323] -- 0:00:52
      161500 -- (-977.580) [-976.496] (-976.838) (-976.249) * (-977.835) [-976.809] (-977.523) (-981.023) -- 0:00:51
      162000 -- [-977.951] (-980.685) (-976.242) (-978.876) * [-978.121] (-978.371) (-978.376) (-981.863) -- 0:00:51
      162500 -- (-980.693) (-981.476) [-977.501] (-979.694) * (-976.572) (-981.008) [-976.982] (-980.600) -- 0:00:51
      163000 -- (-984.528) [-978.022] (-976.606) (-977.009) * [-978.083] (-978.925) (-977.721) (-979.867) -- 0:00:51
      163500 -- [-977.375] (-977.336) (-977.346) (-980.265) * [-978.754] (-978.089) (-977.481) (-976.781) -- 0:00:51
      164000 -- (-977.568) [-978.871] (-977.160) (-981.648) * (-978.013) (-977.035) [-976.508] (-980.451) -- 0:00:50
      164500 -- (-988.233) (-978.349) (-977.947) [-981.001] * (-976.933) (-977.383) [-976.189] (-978.078) -- 0:00:50
      165000 -- (-976.802) [-982.331] (-978.072) (-977.633) * (-979.878) (-980.586) [-976.507] (-976.552) -- 0:00:50

      Average standard deviation of split frequencies: 0.022313

      165500 -- (-982.230) [-980.183] (-977.805) (-977.977) * [-981.067] (-979.127) (-978.174) (-979.346) -- 0:00:50
      166000 -- [-980.071] (-980.191) (-977.846) (-977.496) * (-983.137) (-977.302) [-977.710] (-979.145) -- 0:00:50
      166500 -- (-979.167) (-981.176) [-979.398] (-976.819) * (-980.337) [-977.226] (-979.090) (-976.963) -- 0:00:50
      167000 -- [-979.167] (-978.599) (-978.248) (-976.305) * (-980.977) (-979.369) (-978.564) [-978.928] -- 0:00:49
      167500 -- (-981.623) (-978.306) [-976.383] (-977.456) * [-981.400] (-981.313) (-978.392) (-983.061) -- 0:00:49
      168000 -- (-980.634) (-980.682) (-977.784) [-978.874] * (-976.723) [-977.430] (-977.720) (-982.229) -- 0:00:49
      168500 -- (-982.303) (-978.205) [-976.264] (-976.828) * [-978.682] (-979.082) (-978.262) (-977.162) -- 0:00:49
      169000 -- (-981.412) [-977.961] (-976.829) (-976.676) * (-980.863) (-979.711) (-980.787) [-977.702] -- 0:00:49
      169500 -- (-977.419) [-976.960] (-976.967) (-977.244) * (-978.472) (-977.889) (-979.924) [-977.078] -- 0:00:48
      170000 -- (-977.001) (-977.878) (-978.367) [-979.010] * [-978.930] (-976.681) (-981.889) (-977.108) -- 0:00:48

      Average standard deviation of split frequencies: 0.022755

      170500 -- (-980.466) [-976.112] (-979.271) (-976.704) * (-978.520) (-978.749) (-978.817) [-977.229] -- 0:00:48
      171000 -- (-979.972) (-978.801) [-980.553] (-978.134) * (-977.705) (-978.803) (-978.897) [-979.146] -- 0:00:48
      171500 -- (-978.149) (-977.387) [-977.682] (-978.446) * (-979.725) (-981.379) (-979.869) [-979.219] -- 0:00:48
      172000 -- [-978.944] (-979.758) (-981.004) (-976.313) * (-979.847) (-976.936) (-978.444) [-976.047] -- 0:00:52
      172500 -- (-976.627) [-978.638] (-979.093) (-976.867) * (-983.570) (-976.898) (-977.946) [-977.138] -- 0:00:52
      173000 -- (-976.720) (-980.367) (-977.981) [-976.563] * (-978.967) (-985.910) [-976.805] (-976.516) -- 0:00:52
      173500 -- (-977.043) (-978.062) (-976.612) [-980.150] * (-976.741) (-981.316) (-976.534) [-978.641] -- 0:00:52
      174000 -- (-977.960) (-978.179) (-977.645) [-978.573] * (-978.984) (-981.787) [-977.476] (-977.960) -- 0:00:52
      174500 -- [-976.824] (-977.873) (-977.023) (-977.710) * (-977.973) (-977.416) (-977.924) [-977.613] -- 0:00:52
      175000 -- (-977.474) (-977.096) (-976.644) [-977.760] * (-979.971) (-978.335) (-978.075) [-978.394] -- 0:00:51

      Average standard deviation of split frequencies: 0.024701

      175500 -- (-978.909) [-978.606] (-977.479) (-977.546) * [-981.532] (-979.730) (-977.312) (-978.921) -- 0:00:51
      176000 -- [-977.910] (-979.470) (-978.608) (-978.311) * (-983.222) (-980.909) (-977.542) [-976.476] -- 0:00:51
      176500 -- [-977.834] (-976.989) (-977.527) (-976.744) * (-979.313) (-978.193) [-977.638] (-978.907) -- 0:00:51
      177000 -- [-978.909] (-978.502) (-978.067) (-976.444) * (-976.561) (-977.819) [-976.741] (-977.010) -- 0:00:51
      177500 -- (-977.575) (-979.311) (-977.145) [-977.472] * (-977.685) (-978.148) [-979.931] (-977.526) -- 0:00:50
      178000 -- (-976.632) [-977.920] (-977.962) (-976.802) * (-986.488) (-977.053) (-978.198) [-977.939] -- 0:00:50
      178500 -- (-976.875) (-977.411) (-977.546) [-975.966] * (-979.928) (-975.919) (-980.317) [-977.059] -- 0:00:50
      179000 -- (-977.727) (-976.918) [-978.296] (-977.143) * [-977.393] (-976.733) (-979.643) (-977.890) -- 0:00:50
      179500 -- (-978.643) (-977.639) (-977.863) [-977.352] * (-977.641) [-977.395] (-976.860) (-978.628) -- 0:00:50
      180000 -- (-977.710) (-977.672) [-976.046] (-975.990) * (-979.143) (-977.563) [-976.749] (-979.541) -- 0:00:50

      Average standard deviation of split frequencies: 0.024643

      180500 -- (-979.616) (-982.760) [-978.731] (-980.856) * (-978.319) (-978.691) [-976.530] (-976.960) -- 0:00:49
      181000 -- (-976.867) (-978.538) (-977.372) [-982.029] * (-981.781) [-977.953] (-977.714) (-976.646) -- 0:00:49
      181500 -- [-978.726] (-978.779) (-979.604) (-978.373) * (-975.998) (-979.692) (-977.978) [-976.937] -- 0:00:49
      182000 -- [-979.921] (-976.876) (-980.200) (-977.190) * (-976.396) [-977.816] (-976.045) (-980.463) -- 0:00:49
      182500 -- (-981.708) (-978.811) (-981.477) [-977.952] * (-978.781) [-977.255] (-976.432) (-978.402) -- 0:00:49
      183000 -- (-982.766) [-978.080] (-979.236) (-976.697) * (-978.794) (-976.961) (-977.462) [-976.888] -- 0:00:49
      183500 -- (-980.407) (-976.925) (-980.113) [-977.835] * (-977.719) (-976.167) [-976.005] (-977.618) -- 0:00:48
      184000 -- (-981.954) (-978.913) (-980.960) [-978.054] * (-977.153) [-978.110] (-977.182) (-979.767) -- 0:00:48
      184500 -- [-979.615] (-977.894) (-978.703) (-980.433) * (-976.526) (-981.796) (-979.460) [-978.447] -- 0:00:48
      185000 -- (-977.325) (-981.802) (-976.562) [-979.127] * (-976.148) (-981.302) (-980.789) [-977.917] -- 0:00:48

      Average standard deviation of split frequencies: 0.025626

      185500 -- (-979.349) (-980.334) [-976.731] (-980.347) * [-978.175] (-980.508) (-979.736) (-978.831) -- 0:00:48
      186000 -- (-977.324) (-977.564) [-980.416] (-978.446) * (-980.472) (-977.388) (-978.875) [-977.863] -- 0:00:48
      186500 -- (-978.660) (-978.678) (-977.970) [-979.335] * (-980.282) [-978.441] (-978.303) (-978.200) -- 0:00:47
      187000 -- [-982.237] (-982.451) (-978.995) (-980.850) * (-979.324) (-977.239) (-977.890) [-977.392] -- 0:00:47
      187500 -- (-979.162) (-979.522) (-979.141) [-978.017] * (-978.936) (-979.254) [-976.802] (-978.632) -- 0:00:47
      188000 -- (-977.340) [-979.215] (-980.558) (-979.126) * (-978.484) (-979.648) [-976.596] (-977.426) -- 0:00:51
      188500 -- (-977.098) (-977.758) [-978.058] (-980.115) * (-977.246) (-978.371) [-975.952] (-977.291) -- 0:00:51
      189000 -- [-976.104] (-978.546) (-977.562) (-976.855) * (-977.181) (-977.113) [-976.254] (-978.965) -- 0:00:51
      189500 -- (-979.279) [-978.383] (-977.606) (-976.806) * [-976.141] (-976.554) (-977.377) (-982.750) -- 0:00:51
      190000 -- (-978.893) [-983.065] (-979.004) (-977.028) * [-976.178] (-977.571) (-976.946) (-978.493) -- 0:00:51

      Average standard deviation of split frequencies: 0.024037

      190500 -- [-976.737] (-981.763) (-979.031) (-978.938) * (-981.534) [-978.024] (-977.483) (-977.406) -- 0:00:50
      191000 -- (-978.164) (-977.180) [-976.769] (-979.457) * (-977.315) (-979.174) [-979.373] (-977.700) -- 0:00:50
      191500 -- (-978.711) (-976.696) [-977.953] (-977.543) * [-976.755] (-978.051) (-976.857) (-978.464) -- 0:00:50
      192000 -- (-980.786) [-976.936] (-977.953) (-978.695) * (-978.489) (-980.051) (-977.694) [-981.935] -- 0:00:50
      192500 -- (-977.411) (-977.178) (-977.933) [-977.209] * (-978.164) [-979.128] (-977.505) (-977.522) -- 0:00:50
      193000 -- (-986.509) (-976.936) [-981.525] (-979.989) * (-979.484) (-978.296) (-977.150) [-977.305] -- 0:00:50
      193500 -- (-985.541) [-977.452] (-977.648) (-976.844) * [-976.790] (-980.289) (-983.372) (-978.269) -- 0:00:50
      194000 -- (-981.584) [-977.411] (-977.356) (-977.627) * [-980.290] (-981.142) (-981.334) (-976.941) -- 0:00:49
      194500 -- (-976.762) (-978.294) (-978.114) [-978.316] * (-977.833) [-980.586] (-982.196) (-976.325) -- 0:00:49
      195000 -- [-978.319] (-977.983) (-978.880) (-976.822) * (-978.415) (-981.080) [-978.341] (-977.342) -- 0:00:49

      Average standard deviation of split frequencies: 0.020254

      195500 -- (-976.743) (-977.410) [-978.653] (-976.922) * (-978.140) (-979.390) [-977.764] (-980.549) -- 0:00:49
      196000 -- (-977.189) (-976.264) (-976.798) [-977.668] * (-980.876) [-977.341] (-980.136) (-978.846) -- 0:00:49
      196500 -- [-977.055] (-976.140) (-979.150) (-981.627) * [-976.155] (-981.549) (-979.280) (-979.738) -- 0:00:49
      197000 -- (-978.959) (-979.609) (-980.639) [-980.466] * [-977.624] (-980.364) (-976.071) (-980.555) -- 0:00:48
      197500 -- [-979.218] (-978.645) (-978.918) (-979.964) * (-976.948) [-976.959] (-977.465) (-979.839) -- 0:00:48
      198000 -- (-977.761) (-976.917) [-977.524] (-977.785) * (-977.474) [-976.246] (-978.367) (-978.000) -- 0:00:48
      198500 -- [-977.488] (-979.722) (-977.658) (-977.425) * [-976.916] (-978.259) (-984.006) (-977.677) -- 0:00:48
      199000 -- [-976.227] (-976.764) (-977.641) (-977.881) * (-976.373) [-978.289] (-981.848) (-979.160) -- 0:00:48
      199500 -- (-975.857) (-982.155) [-977.561] (-977.420) * [-978.746] (-978.896) (-979.176) (-977.228) -- 0:00:48
      200000 -- (-978.814) (-977.036) (-976.868) [-979.027] * [-977.012] (-977.481) (-977.804) (-976.283) -- 0:00:48

      Average standard deviation of split frequencies: 0.022056

      200500 -- [-981.057] (-978.309) (-976.410) (-981.748) * [-977.156] (-977.646) (-978.263) (-983.355) -- 0:00:47
      201000 -- (-983.827) (-978.799) [-979.669] (-978.999) * (-977.972) [-977.171] (-978.079) (-978.676) -- 0:00:47
      201500 -- (-985.175) (-977.888) [-980.887] (-979.702) * (-978.984) [-977.266] (-979.797) (-980.399) -- 0:00:47
      202000 -- (-977.486) [-976.822] (-978.185) (-979.803) * [-978.080] (-978.376) (-977.719) (-985.155) -- 0:00:47
      202500 -- [-976.663] (-977.907) (-977.806) (-976.650) * (-976.876) [-979.341] (-977.249) (-977.520) -- 0:00:47
      203000 -- (-979.124) (-978.714) [-979.386] (-975.874) * [-976.829] (-978.623) (-977.388) (-977.467) -- 0:00:47
      203500 -- (-982.131) (-976.957) (-978.942) [-977.257] * [-979.261] (-977.386) (-977.753) (-977.531) -- 0:00:46
      204000 -- (-984.308) [-978.981] (-979.342) (-978.014) * (-979.599) (-978.303) [-980.933] (-976.675) -- 0:00:50
      204500 -- (-977.117) (-981.351) (-980.816) [-980.591] * (-977.660) (-979.171) (-976.926) [-976.154] -- 0:00:50
      205000 -- (-977.792) (-977.478) [-977.379] (-976.977) * (-976.922) (-978.901) [-976.048] (-976.155) -- 0:00:50

      Average standard deviation of split frequencies: 0.022248

      205500 -- [-976.756] (-977.330) (-977.636) (-978.597) * (-976.649) (-979.984) (-978.166) [-977.683] -- 0:00:50
      206000 -- (-979.867) [-979.507] (-980.843) (-977.031) * (-976.909) (-979.837) [-977.388] (-981.655) -- 0:00:50
      206500 -- (-979.688) (-978.037) (-977.262) [-980.936] * (-977.523) (-980.620) [-977.257] (-983.297) -- 0:00:49
      207000 -- (-976.876) (-978.743) (-978.252) [-976.793] * (-978.269) (-978.048) [-977.141] (-980.560) -- 0:00:49
      207500 -- [-976.981] (-980.149) (-978.563) (-980.330) * (-979.145) [-977.258] (-976.860) (-976.720) -- 0:00:49
      208000 -- (-977.005) [-978.929] (-980.856) (-980.065) * (-976.980) (-979.780) (-981.003) [-979.899] -- 0:00:49
      208500 -- [-978.012] (-980.109) (-979.781) (-980.328) * (-977.105) (-976.055) [-977.141] (-981.394) -- 0:00:49
      209000 -- (-980.428) (-977.918) (-977.603) [-979.684] * (-979.674) [-976.545] (-977.907) (-978.045) -- 0:00:49
      209500 -- (-987.933) (-979.880) [-977.621] (-977.680) * (-979.731) [-977.260] (-979.130) (-977.004) -- 0:00:49
      210000 -- (-984.657) [-976.542] (-981.908) (-977.837) * [-977.393] (-978.051) (-981.135) (-978.084) -- 0:00:48

      Average standard deviation of split frequencies: 0.019315

      210500 -- (-983.396) [-978.137] (-979.614) (-978.257) * (-978.750) (-977.144) (-977.156) [-976.854] -- 0:00:48
      211000 -- (-980.465) [-977.702] (-979.863) (-978.840) * (-978.748) [-976.461] (-977.421) (-977.299) -- 0:00:48
      211500 -- [-977.636] (-976.518) (-980.957) (-978.631) * (-978.219) [-978.165] (-978.443) (-979.079) -- 0:00:48
      212000 -- [-979.962] (-976.992) (-980.101) (-976.076) * (-978.537) (-981.166) (-978.750) [-976.437] -- 0:00:48
      212500 -- (-979.477) (-977.331) (-981.156) [-975.930] * (-977.272) (-984.711) [-977.664] (-976.976) -- 0:00:48
      213000 -- (-980.400) (-976.255) (-981.731) [-975.844] * (-979.311) (-977.862) [-978.142] (-980.690) -- 0:00:48
      213500 -- (-979.751) [-976.796] (-975.964) (-980.885) * [-978.415] (-976.542) (-977.096) (-981.003) -- 0:00:47
      214000 -- (-977.338) (-979.534) [-977.057] (-980.832) * (-979.835) (-976.478) [-979.677] (-983.824) -- 0:00:47
      214500 -- (-977.858) [-978.201] (-978.465) (-977.456) * (-984.977) (-977.332) (-981.160) [-978.597] -- 0:00:47
      215000 -- [-977.908] (-977.091) (-979.021) (-978.262) * (-980.015) (-977.265) (-979.630) [-976.099] -- 0:00:47

      Average standard deviation of split frequencies: 0.019297

      215500 -- (-984.559) [-977.619] (-982.979) (-976.591) * (-979.171) (-978.027) (-981.621) [-976.996] -- 0:00:47
      216000 -- (-978.843) (-982.605) (-976.702) [-976.830] * (-980.695) (-978.244) (-980.927) [-977.929] -- 0:00:47
      216500 -- [-983.720] (-980.535) (-981.403) (-978.395) * [-976.488] (-977.089) (-977.659) (-977.856) -- 0:00:47
      217000 -- (-976.806) (-977.304) [-976.379] (-977.216) * [-977.055] (-980.666) (-977.338) (-981.917) -- 0:00:46
      217500 -- (-977.407) (-977.910) (-978.494) [-976.932] * (-981.103) (-979.454) [-976.718] (-980.653) -- 0:00:46
      218000 -- (-978.883) [-976.487] (-981.437) (-977.025) * [-977.892] (-977.679) (-977.520) (-978.646) -- 0:00:46
      218500 -- [-978.744] (-977.969) (-979.133) (-976.263) * (-977.673) (-977.324) [-977.224] (-979.842) -- 0:00:46
      219000 -- (-976.571) (-977.826) (-977.631) [-976.087] * [-977.168] (-976.807) (-976.901) (-980.102) -- 0:00:46
      219500 -- (-976.168) (-977.166) (-976.810) [-976.290] * [-977.023] (-976.303) (-976.953) (-979.696) -- 0:00:46
      220000 -- (-976.764) (-977.131) [-980.473] (-976.356) * (-979.035) (-979.437) (-977.467) [-979.107] -- 0:00:49

      Average standard deviation of split frequencies: 0.019226

      220500 -- (-976.866) (-977.598) [-977.647] (-978.167) * [-979.959] (-978.418) (-977.376) (-977.823) -- 0:00:49
      221000 -- (-978.055) (-979.432) (-983.171) [-979.636] * [-976.495] (-976.780) (-979.744) (-978.358) -- 0:00:49
      221500 -- (-976.666) (-983.490) (-980.027) [-980.649] * (-978.376) [-976.645] (-976.908) (-978.745) -- 0:00:49
      222000 -- (-976.449) (-979.561) (-981.239) [-980.747] * (-976.695) (-977.241) [-977.536] (-976.870) -- 0:00:49
      222500 -- [-977.446] (-980.724) (-982.772) (-976.504) * (-977.412) (-977.242) (-978.109) [-977.545] -- 0:00:48
      223000 -- (-977.064) (-976.751) [-983.007] (-978.514) * (-980.883) (-979.321) [-981.736] (-978.414) -- 0:00:48
      223500 -- (-976.687) (-977.667) (-980.783) [-976.066] * (-977.418) [-978.001] (-980.557) (-979.147) -- 0:00:48
      224000 -- (-976.360) (-977.544) (-977.386) [-976.462] * [-976.848] (-977.246) (-981.590) (-977.874) -- 0:00:48
      224500 -- (-976.729) (-977.544) (-977.254) [-976.462] * [-976.435] (-977.256) (-981.124) (-977.522) -- 0:00:48
      225000 -- (-977.656) (-979.913) (-976.717) [-976.622] * (-979.759) (-979.096) (-981.074) [-977.531] -- 0:00:48

      Average standard deviation of split frequencies: 0.018251

      225500 -- (-977.504) (-977.406) [-976.653] (-978.394) * (-979.456) [-976.811] (-979.568) (-978.502) -- 0:00:48
      226000 -- [-978.301] (-977.583) (-977.047) (-977.445) * (-977.997) (-976.906) (-978.222) [-977.794] -- 0:00:47
      226500 -- (-977.192) [-977.519] (-978.334) (-978.756) * (-977.058) (-976.864) [-977.321] (-979.139) -- 0:00:47
      227000 -- (-978.638) (-983.214) (-977.094) [-982.618] * (-976.901) (-976.716) [-978.302] (-976.800) -- 0:00:47
      227500 -- [-977.013] (-977.906) (-977.609) (-977.905) * (-981.099) (-976.094) (-978.978) [-978.768] -- 0:00:47
      228000 -- [-977.817] (-976.972) (-981.790) (-977.836) * (-978.284) [-976.470] (-977.494) (-980.238) -- 0:00:47
      228500 -- [-977.005] (-976.926) (-976.794) (-977.756) * [-980.612] (-976.368) (-976.706) (-982.138) -- 0:00:47
      229000 -- (-980.197) [-976.903] (-977.766) (-977.908) * [-977.932] (-978.081) (-976.108) (-980.918) -- 0:00:47
      229500 -- [-978.178] (-981.788) (-977.946) (-981.320) * [-980.176] (-977.620) (-975.987) (-980.341) -- 0:00:47
      230000 -- (-977.370) (-980.430) [-977.350] (-981.095) * (-975.886) [-978.653] (-976.712) (-982.157) -- 0:00:46

      Average standard deviation of split frequencies: 0.018802

      230500 -- (-979.084) (-976.751) [-977.814] (-978.497) * (-976.951) (-977.681) (-980.420) [-977.448] -- 0:00:46
      231000 -- (-979.408) (-976.402) (-977.141) [-977.059] * (-983.575) (-976.989) (-977.160) [-977.369] -- 0:00:46
      231500 -- (-977.676) (-977.037) [-977.538] (-977.617) * (-980.118) (-977.994) [-976.977] (-978.832) -- 0:00:46
      232000 -- (-977.682) (-977.052) [-976.773] (-977.035) * [-977.885] (-978.534) (-976.159) (-978.199) -- 0:00:46
      232500 -- (-980.498) [-977.261] (-984.616) (-976.951) * [-977.848] (-976.084) (-976.047) (-976.287) -- 0:00:46
      233000 -- (-977.211) (-980.784) (-980.330) [-977.632] * (-979.118) (-976.393) (-976.935) [-981.866] -- 0:00:46
      233500 -- [-976.862] (-977.128) (-976.724) (-982.676) * (-977.687) [-978.190] (-979.499) (-977.415) -- 0:00:45
      234000 -- (-978.740) (-977.230) [-980.236] (-986.491) * (-979.563) (-982.432) (-979.038) [-977.145] -- 0:00:45
      234500 -- [-976.246] (-981.029) (-977.616) (-978.294) * (-976.956) (-977.253) [-978.981] (-977.415) -- 0:00:45
      235000 -- (-978.758) [-976.731] (-977.655) (-978.751) * [-976.139] (-976.433) (-976.887) (-978.262) -- 0:00:45

      Average standard deviation of split frequencies: 0.018177

      235500 -- (-981.937) [-977.439] (-977.557) (-977.367) * (-978.303) (-979.091) [-978.881] (-975.843) -- 0:00:45
      236000 -- (-979.079) [-980.267] (-982.327) (-977.465) * (-977.680) [-976.509] (-980.323) (-977.781) -- 0:00:45
      236500 -- (-980.736) (-978.166) (-984.635) [-977.381] * (-979.072) [-977.234] (-978.001) (-977.435) -- 0:00:48
      237000 -- (-980.733) (-977.774) [-976.554] (-979.101) * (-979.369) (-976.020) [-977.075] (-978.049) -- 0:00:48
      237500 -- [-977.745] (-978.408) (-976.700) (-978.334) * (-979.698) (-977.355) [-977.201] (-978.984) -- 0:00:48
      238000 -- [-977.266] (-978.381) (-978.154) (-978.129) * (-976.894) (-977.046) [-980.141] (-979.034) -- 0:00:48
      238500 -- (-977.612) (-981.187) [-978.420] (-976.706) * (-976.656) [-976.695] (-977.522) (-977.093) -- 0:00:47
      239000 -- (-976.668) (-980.905) [-976.174] (-979.160) * (-981.803) (-978.398) (-980.310) [-978.364] -- 0:00:47
      239500 -- (-976.346) [-976.946] (-976.897) (-977.711) * (-978.417) (-979.043) (-980.559) [-976.880] -- 0:00:47
      240000 -- (-978.788) (-976.675) (-982.656) [-977.232] * (-979.580) (-977.223) (-977.583) [-977.132] -- 0:00:47

      Average standard deviation of split frequencies: 0.019484

      240500 -- (-981.125) [-976.994] (-980.565) (-977.316) * (-977.388) (-978.486) [-977.241] (-976.831) -- 0:00:47
      241000 -- [-977.066] (-977.514) (-977.012) (-976.632) * (-981.553) (-977.708) [-978.514] (-981.336) -- 0:00:47
      241500 -- (-979.167) (-979.403) [-979.149] (-976.940) * (-981.047) (-978.897) (-979.028) [-980.014] -- 0:00:47
      242000 -- (-978.023) (-980.760) [-977.970] (-976.940) * (-981.121) (-977.167) [-977.310] (-979.396) -- 0:00:46
      242500 -- (-977.222) (-979.319) (-979.499) [-978.360] * (-978.871) (-978.278) [-977.650] (-981.036) -- 0:00:46
      243000 -- [-977.719] (-977.401) (-978.019) (-977.830) * (-985.574) (-977.139) (-977.248) [-978.861] -- 0:00:46
      243500 -- [-979.257] (-976.762) (-979.764) (-980.646) * (-983.267) (-976.725) [-976.558] (-976.986) -- 0:00:46
      244000 -- [-976.643] (-985.010) (-981.948) (-978.203) * (-980.830) [-977.493] (-977.704) (-976.136) -- 0:00:46
      244500 -- (-976.563) [-985.653] (-980.494) (-978.234) * (-980.980) (-976.494) (-977.664) [-978.335] -- 0:00:46
      245000 -- [-976.518] (-983.553) (-983.140) (-978.967) * [-986.776] (-977.025) (-977.510) (-976.317) -- 0:00:46

      Average standard deviation of split frequencies: 0.019264

      245500 -- (-976.587) (-977.932) [-978.035] (-979.732) * (-983.231) (-976.372) (-977.580) [-982.528] -- 0:00:46
      246000 -- [-980.535] (-977.549) (-979.394) (-978.711) * (-978.046) [-976.346] (-977.611) (-979.022) -- 0:00:45
      246500 -- (-975.925) (-978.023) [-977.596] (-977.751) * (-978.490) [-976.170] (-977.724) (-980.957) -- 0:00:45
      247000 -- [-977.121] (-978.441) (-976.012) (-978.190) * [-976.433] (-976.547) (-977.213) (-980.004) -- 0:00:45
      247500 -- [-976.748] (-979.594) (-976.904) (-976.741) * [-979.126] (-975.981) (-980.243) (-976.846) -- 0:00:45
      248000 -- (-977.863) (-979.422) (-976.788) [-979.497] * (-977.393) [-979.317] (-978.345) (-976.738) -- 0:00:45
      248500 -- (-977.296) (-978.337) (-978.389) [-978.600] * (-978.379) [-977.169] (-980.399) (-980.024) -- 0:00:45
      249000 -- (-978.055) [-978.158] (-980.069) (-976.493) * (-978.284) (-980.165) [-980.880] (-978.243) -- 0:00:45
      249500 -- [-978.171] (-978.157) (-981.590) (-979.257) * (-982.458) (-979.846) (-981.052) [-981.975] -- 0:00:45
      250000 -- [-978.429] (-978.236) (-979.473) (-977.455) * (-977.739) (-980.696) (-977.078) [-980.902] -- 0:00:45

      Average standard deviation of split frequencies: 0.019103

      250500 -- [-982.380] (-978.377) (-978.642) (-977.400) * (-978.898) [-981.047] (-978.218) (-976.207) -- 0:00:44
      251000 -- (-979.364) (-978.797) (-981.843) [-979.644] * (-980.154) (-986.231) (-977.279) [-976.795] -- 0:00:44
      251500 -- [-976.583] (-977.578) (-979.447) (-978.537) * (-985.719) (-980.423) [-978.746] (-975.949) -- 0:00:44
      252000 -- [-978.415] (-978.629) (-978.264) (-979.723) * (-982.174) [-980.763] (-977.368) (-975.919) -- 0:00:44
      252500 -- (-977.512) [-981.505] (-977.481) (-976.860) * (-978.769) [-978.470] (-978.148) (-978.036) -- 0:00:47
      253000 -- (-978.343) [-977.697] (-977.050) (-978.992) * (-979.254) [-977.264] (-977.874) (-980.912) -- 0:00:47
      253500 -- (-981.255) (-976.545) [-978.500] (-979.867) * (-977.508) [-980.188] (-977.705) (-977.871) -- 0:00:47
      254000 -- [-976.113] (-980.706) (-979.283) (-976.958) * [-976.635] (-976.943) (-981.120) (-979.292) -- 0:00:46
      254500 -- (-976.613) [-978.161] (-978.289) (-977.506) * [-977.151] (-979.030) (-980.125) (-976.123) -- 0:00:46
      255000 -- [-976.502] (-978.443) (-982.156) (-976.922) * (-976.290) (-976.785) (-979.657) [-977.593] -- 0:00:46

      Average standard deviation of split frequencies: 0.019822

      255500 -- (-978.949) [-979.561] (-979.205) (-977.207) * (-976.169) [-976.551] (-977.713) (-978.249) -- 0:00:46
      256000 -- [-976.263] (-978.543) (-978.546) (-980.130) * [-977.907] (-977.337) (-980.375) (-978.178) -- 0:00:46
      256500 -- (-977.742) (-978.641) [-977.722] (-979.112) * (-977.480) [-979.183] (-976.768) (-984.615) -- 0:00:46
      257000 -- [-979.088] (-977.695) (-977.428) (-977.521) * (-976.501) (-980.945) (-977.982) [-979.498] -- 0:00:46
      257500 -- [-977.709] (-976.906) (-976.652) (-978.202) * (-977.183) (-982.458) (-980.417) [-978.283] -- 0:00:46
      258000 -- (-977.925) (-978.052) [-976.617] (-979.647) * [-978.461] (-982.464) (-976.969) (-978.229) -- 0:00:46
      258500 -- [-976.796] (-977.852) (-977.156) (-977.859) * [-977.892] (-980.359) (-978.757) (-978.692) -- 0:00:45
      259000 -- (-978.340) (-978.411) (-977.639) [-976.725] * (-978.576) (-983.315) (-980.025) [-976.912] -- 0:00:45
      259500 -- [-977.184] (-978.258) (-976.266) (-979.472) * [-976.683] (-977.615) (-981.595) (-980.464) -- 0:00:45
      260000 -- [-976.794] (-977.781) (-977.067) (-978.169) * [-976.792] (-978.501) (-987.209) (-977.924) -- 0:00:45

      Average standard deviation of split frequencies: 0.021099

      260500 -- (-979.446) (-977.194) [-979.003] (-977.880) * (-977.708) [-977.600] (-988.735) (-976.679) -- 0:00:45
      261000 -- (-978.540) (-978.554) (-978.992) [-977.795] * (-981.076) [-976.854] (-984.720) (-977.913) -- 0:00:45
      261500 -- [-978.665] (-977.690) (-976.797) (-982.178) * (-975.891) (-987.389) (-979.685) [-977.543] -- 0:00:45
      262000 -- (-979.129) (-977.428) (-978.108) [-979.006] * (-978.591) (-982.259) (-979.673) [-977.637] -- 0:00:45
      262500 -- (-979.088) (-977.435) [-977.523] (-984.460) * (-977.912) (-982.691) [-978.357] (-978.148) -- 0:00:44
      263000 -- (-979.940) (-975.841) (-977.110) [-979.119] * (-984.802) (-979.004) (-978.010) [-979.120] -- 0:00:44
      263500 -- (-978.747) (-979.180) (-976.765) [-978.029] * (-977.853) [-978.763] (-977.857) (-977.914) -- 0:00:44
      264000 -- (-981.922) [-977.353] (-979.818) (-978.340) * (-975.994) [-978.474] (-977.054) (-979.277) -- 0:00:44
      264500 -- (-979.985) [-980.337] (-978.890) (-978.765) * [-979.085] (-976.074) (-981.660) (-976.736) -- 0:00:44
      265000 -- (-980.927) (-977.469) [-976.054] (-976.496) * (-979.412) (-978.972) [-977.087] (-978.247) -- 0:00:44

      Average standard deviation of split frequencies: 0.021168

      265500 -- (-982.919) (-976.479) [-979.514] (-977.250) * (-979.737) [-978.406] (-976.702) (-979.575) -- 0:00:44
      266000 -- (-980.304) (-977.456) [-978.513] (-977.115) * (-978.808) [-977.936] (-978.111) (-980.148) -- 0:00:44
      266500 -- [-978.259] (-977.913) (-978.521) (-980.040) * [-976.783] (-978.732) (-978.078) (-980.134) -- 0:00:44
      267000 -- [-979.067] (-977.920) (-978.107) (-979.242) * (-976.526) (-977.254) (-978.736) [-979.367] -- 0:00:43
      267500 -- (-979.298) [-980.395] (-988.303) (-979.738) * (-980.639) (-981.071) (-979.717) [-979.033] -- 0:00:43
      268000 -- (-979.585) (-979.898) (-981.606) [-978.129] * [-983.181] (-977.555) (-979.835) (-978.892) -- 0:00:43
      268500 -- (-981.112) [-976.835] (-980.140) (-977.344) * (-981.688) (-976.576) (-980.726) [-978.280] -- 0:00:43
      269000 -- (-977.922) [-978.809] (-977.812) (-978.870) * (-980.749) (-977.635) (-978.410) [-979.295] -- 0:00:46
      269500 -- (-977.008) (-976.363) (-977.146) [-976.915] * (-976.413) (-983.548) (-978.391) [-977.039] -- 0:00:46
      270000 -- [-976.991] (-979.034) (-977.183) (-976.360) * (-976.836) (-979.320) [-978.031] (-977.413) -- 0:00:45

      Average standard deviation of split frequencies: 0.021383

      270500 -- (-977.184) (-976.475) (-976.948) [-977.702] * [-978.245] (-978.712) (-980.388) (-976.825) -- 0:00:45
      271000 -- (-977.095) (-978.737) (-976.751) [-981.347] * (-981.263) (-978.442) (-977.958) [-976.308] -- 0:00:45
      271500 -- [-979.488] (-979.645) (-977.183) (-979.670) * [-977.834] (-978.795) (-977.865) (-977.790) -- 0:00:45
      272000 -- (-978.048) (-979.230) [-978.066] (-977.782) * (-977.789) (-976.897) (-977.578) [-978.122] -- 0:00:45
      272500 -- (-978.393) [-975.954] (-979.699) (-979.625) * (-978.131) (-975.857) (-978.009) [-977.010] -- 0:00:45
      273000 -- (-979.626) (-975.954) (-977.687) [-977.208] * (-976.327) [-976.401] (-977.321) (-977.201) -- 0:00:45
      273500 -- [-978.096] (-976.769) (-981.399) (-979.967) * [-977.480] (-976.125) (-976.626) (-977.042) -- 0:00:45
      274000 -- [-976.860] (-982.092) (-979.433) (-978.626) * (-977.474) [-977.033] (-976.123) (-977.152) -- 0:00:45
      274500 -- [-976.122] (-976.956) (-978.059) (-977.941) * (-976.183) (-978.641) (-976.341) [-976.624] -- 0:00:44
      275000 -- (-975.968) (-979.025) (-981.838) [-977.540] * (-977.335) (-979.226) (-978.067) [-976.620] -- 0:00:44

      Average standard deviation of split frequencies: 0.020686

      275500 -- [-975.905] (-981.754) (-977.453) (-977.945) * [-978.978] (-976.705) (-978.227) (-977.307) -- 0:00:44
      276000 -- (-977.382) (-982.200) [-979.200] (-977.199) * [-977.705] (-976.344) (-979.899) (-978.614) -- 0:00:44
      276500 -- [-977.559] (-978.034) (-979.739) (-980.304) * [-978.717] (-980.091) (-979.803) (-979.339) -- 0:00:44
      277000 -- [-980.726] (-980.130) (-978.589) (-978.780) * (-977.931) (-982.232) [-980.093] (-978.595) -- 0:00:44
      277500 -- (-980.726) [-978.001] (-977.945) (-978.980) * (-977.708) (-979.927) (-979.489) [-977.731] -- 0:00:44
      278000 -- (-982.938) [-978.860] (-978.055) (-981.066) * (-979.602) [-980.131] (-976.778) (-982.856) -- 0:00:44
      278500 -- (-977.421) (-976.916) (-977.116) [-976.433] * (-982.887) (-979.274) (-977.372) [-979.583] -- 0:00:44
      279000 -- (-977.783) [-977.091] (-978.087) (-976.597) * (-979.874) (-979.752) [-977.558] (-979.702) -- 0:00:43
      279500 -- [-977.608] (-978.824) (-979.451) (-977.961) * (-978.257) [-978.472] (-976.336) (-979.299) -- 0:00:43
      280000 -- (-976.216) [-978.185] (-979.135) (-981.800) * (-979.449) (-979.733) (-976.334) [-976.609] -- 0:00:43

      Average standard deviation of split frequencies: 0.019875

      280500 -- [-976.925] (-977.817) (-980.880) (-981.188) * (-978.093) (-978.777) [-977.427] (-978.525) -- 0:00:43
      281000 -- (-979.894) [-978.911] (-979.309) (-979.463) * (-976.575) (-980.951) [-978.810] (-978.012) -- 0:00:43
      281500 -- (-980.127) (-977.492) (-976.952) [-976.366] * (-976.834) [-979.231] (-982.774) (-976.701) -- 0:00:43
      282000 -- (-980.790) (-979.874) [-977.333] (-979.427) * (-984.507) (-979.477) [-977.678] (-977.959) -- 0:00:43
      282500 -- [-976.565] (-979.372) (-980.424) (-977.021) * (-978.434) (-978.634) [-975.811] (-977.970) -- 0:00:43
      283000 -- [-979.451] (-978.336) (-978.358) (-978.787) * (-976.779) [-976.385] (-977.334) (-980.012) -- 0:00:43
      283500 -- (-978.317) (-979.573) (-977.369) [-979.601] * (-976.809) [-977.149] (-979.117) (-978.173) -- 0:00:42
      284000 -- [-977.858] (-979.854) (-977.927) (-978.113) * (-977.172) [-978.126] (-978.128) (-976.508) -- 0:00:42
      284500 -- (-977.299) (-978.929) (-983.301) [-977.557] * (-980.380) [-980.134] (-979.361) (-980.585) -- 0:00:42
      285000 -- (-979.427) (-980.365) (-979.123) [-978.180] * (-977.641) (-979.588) (-977.374) [-976.603] -- 0:00:45

      Average standard deviation of split frequencies: 0.018131

      285500 -- (-980.197) (-978.313) (-980.506) [-979.266] * (-977.140) [-978.746] (-977.319) (-980.086) -- 0:00:45
      286000 -- (-978.015) (-978.123) (-982.099) [-979.474] * (-985.007) (-980.668) [-976.831] (-978.745) -- 0:00:44
      286500 -- [-976.722] (-979.269) (-978.088) (-977.881) * (-976.644) [-982.660] (-977.555) (-977.945) -- 0:00:44
      287000 -- (-978.073) (-981.785) [-980.228] (-978.507) * (-977.447) [-978.117] (-979.354) (-976.236) -- 0:00:44
      287500 -- (-978.670) [-976.691] (-977.639) (-978.078) * (-980.216) (-978.579) (-978.134) [-976.155] -- 0:00:44
      288000 -- (-978.461) [-976.023] (-979.511) (-976.535) * (-981.594) (-978.009) (-977.455) [-977.873] -- 0:00:44
      288500 -- (-978.388) (-977.869) (-977.303) [-977.401] * (-981.951) (-976.147) (-981.834) [-976.607] -- 0:00:44
      289000 -- [-978.724] (-976.643) (-977.289) (-977.496) * (-978.644) (-980.532) [-976.357] (-976.954) -- 0:00:44
      289500 -- (-976.584) [-977.768] (-978.219) (-980.574) * (-977.507) (-976.709) [-977.689] (-978.401) -- 0:00:44
      290000 -- [-977.988] (-977.012) (-979.090) (-978.641) * (-981.212) (-977.052) [-978.317] (-978.059) -- 0:00:44

      Average standard deviation of split frequencies: 0.019462

      290500 -- (-982.612) [-976.863] (-979.160) (-977.040) * [-979.260] (-978.166) (-976.890) (-977.350) -- 0:00:43
      291000 -- (-979.191) [-976.550] (-977.546) (-977.244) * (-981.998) [-977.194] (-977.245) (-979.626) -- 0:00:43
      291500 -- (-977.817) [-976.717] (-977.088) (-977.221) * [-978.007] (-979.054) (-977.588) (-980.656) -- 0:00:43
      292000 -- (-979.702) [-977.256] (-977.455) (-979.916) * (-977.892) [-977.466] (-978.258) (-978.072) -- 0:00:43
      292500 -- (-980.607) [-977.189] (-978.628) (-982.223) * (-980.305) [-976.926] (-975.977) (-975.845) -- 0:00:43
      293000 -- (-978.198) (-977.230) [-978.511] (-978.057) * (-980.011) [-977.675] (-976.376) (-978.168) -- 0:00:43
      293500 -- (-978.768) [-977.422] (-980.521) (-977.297) * (-977.548) [-976.832] (-976.139) (-980.055) -- 0:00:43
      294000 -- (-979.398) (-978.761) [-976.172] (-981.194) * (-977.475) [-977.340] (-978.020) (-977.229) -- 0:00:43
      294500 -- (-986.934) (-977.570) [-976.788] (-979.758) * (-980.873) (-977.918) (-981.714) [-976.317] -- 0:00:43
      295000 -- (-980.491) [-977.443] (-980.315) (-977.580) * (-978.325) (-977.032) (-979.238) [-976.351] -- 0:00:43

      Average standard deviation of split frequencies: 0.018514

      295500 -- (-979.219) [-979.020] (-976.834) (-978.672) * (-978.451) (-976.011) (-980.934) [-976.518] -- 0:00:42
      296000 -- (-978.633) (-977.654) (-977.407) [-976.147] * (-977.377) (-976.481) (-981.592) [-978.549] -- 0:00:42
      296500 -- [-979.885] (-978.244) (-978.204) (-976.266) * (-977.054) (-977.741) [-981.202] (-979.009) -- 0:00:42
      297000 -- [-976.980] (-977.419) (-978.004) (-977.976) * (-980.466) [-977.866] (-978.996) (-978.794) -- 0:00:42
      297500 -- (-978.129) (-980.301) [-978.376] (-978.845) * [-979.129] (-976.857) (-979.667) (-978.043) -- 0:00:42
      298000 -- (-977.833) [-980.004] (-977.047) (-979.469) * (-981.380) [-977.036] (-978.727) (-976.623) -- 0:00:42
      298500 -- (-979.601) [-979.226] (-977.384) (-979.153) * (-979.902) (-977.178) (-980.532) [-976.450] -- 0:00:42
      299000 -- [-977.155] (-977.798) (-979.474) (-977.706) * (-979.833) (-977.545) [-977.428] (-976.865) -- 0:00:42
      299500 -- (-978.236) [-977.152] (-977.645) (-978.735) * (-979.031) [-980.877] (-977.544) (-979.226) -- 0:00:42
      300000 -- (-978.079) (-976.814) [-976.995] (-980.830) * (-977.956) (-977.825) [-976.401] (-979.397) -- 0:00:42

      Average standard deviation of split frequencies: 0.017932

      300500 -- (-976.576) (-976.353) [-977.760] (-978.285) * (-979.247) [-982.593] (-977.723) (-977.365) -- 0:00:41
      301000 -- [-977.026] (-979.435) (-980.064) (-978.322) * [-978.122] (-979.674) (-976.842) (-983.200) -- 0:00:44
      301500 -- (-978.833) (-977.197) (-985.058) [-979.243] * (-977.842) (-979.054) [-977.465] (-982.645) -- 0:00:44
      302000 -- (-976.996) (-979.212) (-979.203) [-979.584] * (-980.275) (-977.255) (-978.764) [-979.979] -- 0:00:43
      302500 -- (-977.615) (-978.482) (-978.942) [-977.714] * (-984.355) [-977.436] (-978.519) (-980.546) -- 0:00:43
      303000 -- (-976.237) [-977.369] (-979.810) (-978.081) * (-980.124) (-976.979) (-977.505) [-976.095] -- 0:00:43
      303500 -- [-977.643] (-980.726) (-977.579) (-976.672) * (-977.036) [-979.899] (-977.274) (-977.161) -- 0:00:43
      304000 -- (-976.963) [-978.468] (-978.550) (-980.601) * (-977.418) (-978.290) [-978.548] (-977.193) -- 0:00:43
      304500 -- [-980.726] (-977.381) (-979.123) (-977.456) * (-976.509) [-977.474] (-979.832) (-978.145) -- 0:00:43
      305000 -- [-981.865] (-977.742) (-980.157) (-977.678) * (-980.992) [-976.396] (-979.776) (-977.171) -- 0:00:43

      Average standard deviation of split frequencies: 0.017235

      305500 -- [-979.881] (-977.154) (-980.784) (-977.250) * (-978.190) (-979.324) (-980.358) [-976.231] -- 0:00:43
      306000 -- (-980.859) (-979.312) [-977.827] (-982.152) * [-978.247] (-978.268) (-979.411) (-976.887) -- 0:00:43
      306500 -- [-977.931] (-977.827) (-980.383) (-979.304) * [-977.699] (-979.374) (-977.871) (-976.732) -- 0:00:42
      307000 -- (-978.471) [-977.361] (-979.229) (-977.992) * [-981.136] (-979.499) (-977.108) (-982.946) -- 0:00:42
      307500 -- [-977.814] (-979.053) (-978.840) (-978.135) * (-978.222) [-977.948] (-980.220) (-976.434) -- 0:00:42
      308000 -- [-980.229] (-976.241) (-977.591) (-978.128) * (-977.438) (-980.108) [-978.831] (-977.258) -- 0:00:42
      308500 -- (-979.661) (-977.012) [-978.780] (-975.886) * (-977.691) [-977.366] (-979.911) (-976.310) -- 0:00:42
      309000 -- (-981.422) (-979.943) (-978.861) [-977.203] * (-977.250) (-978.248) [-978.876] (-976.606) -- 0:00:42
      309500 -- [-977.584] (-978.636) (-987.496) (-976.454) * (-979.150) [-976.275] (-980.364) (-980.096) -- 0:00:42
      310000 -- (-976.840) (-976.855) (-986.828) [-977.984] * (-978.050) (-976.506) (-978.458) [-977.187] -- 0:00:42

      Average standard deviation of split frequencies: 0.017227

      310500 -- [-980.452] (-979.434) (-981.202) (-976.615) * (-977.058) [-976.102] (-977.398) (-977.486) -- 0:00:42
      311000 -- (-980.236) (-976.887) (-981.666) [-978.483] * (-976.302) [-977.790] (-977.733) (-978.309) -- 0:00:42
      311500 -- (-977.163) (-976.246) (-979.092) [-981.137] * (-978.989) (-979.204) (-976.985) [-978.062] -- 0:00:41
      312000 -- (-980.831) [-979.818] (-977.100) (-978.347) * (-978.675) [-976.541] (-978.096) (-981.931) -- 0:00:41
      312500 -- (-979.282) [-977.095] (-977.100) (-979.164) * (-981.715) (-976.250) (-977.656) [-976.509] -- 0:00:41
      313000 -- (-979.458) (-976.922) (-977.801) [-978.164] * (-980.451) (-977.339) [-977.362] (-978.384) -- 0:00:41
      313500 -- [-977.711] (-981.123) (-977.885) (-983.484) * (-976.328) [-978.095] (-976.957) (-976.611) -- 0:00:41
      314000 -- (-976.645) (-981.688) [-976.968] (-977.905) * (-977.845) [-979.394] (-982.146) (-977.113) -- 0:00:41
      314500 -- (-979.021) (-977.283) (-976.667) [-977.219] * (-978.699) (-979.331) [-978.510] (-979.613) -- 0:00:41
      315000 -- [-979.077] (-975.997) (-979.132) (-976.240) * (-979.734) (-979.322) (-978.449) [-980.065] -- 0:00:41

      Average standard deviation of split frequencies: 0.016327

      315500 -- (-977.407) (-976.193) [-976.284] (-976.666) * (-979.124) (-977.690) (-980.574) [-980.439] -- 0:00:41
      316000 -- [-976.607] (-981.252) (-976.992) (-977.029) * [-977.980] (-980.722) (-976.793) (-982.707) -- 0:00:41
      316500 -- [-976.467] (-978.429) (-976.498) (-978.227) * (-979.421) (-978.957) (-977.079) [-977.365] -- 0:00:41
      317000 -- [-977.428] (-981.663) (-977.035) (-977.659) * (-978.727) [-976.879] (-976.292) (-979.071) -- 0:00:43
      317500 -- [-976.911] (-980.889) (-980.730) (-977.519) * (-978.927) (-977.894) (-978.028) [-979.203] -- 0:00:42
      318000 -- (-977.407) (-981.014) (-980.224) [-978.902] * (-981.444) (-976.748) [-978.521] (-979.076) -- 0:00:42
      318500 -- [-976.934] (-976.733) (-979.624) (-978.312) * (-980.147) [-976.608] (-978.770) (-981.784) -- 0:00:42
      319000 -- (-977.769) [-976.393] (-978.338) (-981.137) * (-982.064) (-979.177) [-979.769] (-980.693) -- 0:00:42
      319500 -- [-976.484] (-976.381) (-979.451) (-981.755) * (-979.403) (-976.836) [-980.367] (-978.395) -- 0:00:42
      320000 -- [-977.003] (-977.785) (-977.623) (-984.673) * [-979.050] (-977.442) (-978.830) (-980.017) -- 0:00:42

      Average standard deviation of split frequencies: 0.015436

      320500 -- (-977.168) [-978.375] (-977.874) (-981.575) * (-980.920) [-976.970] (-977.147) (-980.568) -- 0:00:42
      321000 -- (-977.378) (-978.656) [-977.873] (-977.916) * (-976.563) (-979.042) [-978.982] (-980.025) -- 0:00:42
      321500 -- (-977.631) (-977.463) (-977.553) [-976.806] * (-977.024) [-976.562] (-978.592) (-977.601) -- 0:00:42
      322000 -- (-979.028) [-977.065] (-976.674) (-976.808) * (-976.680) (-976.741) (-980.583) [-980.014] -- 0:00:42
      322500 -- [-980.898] (-977.046) (-976.563) (-976.185) * [-976.495] (-979.563) (-977.540) (-980.720) -- 0:00:42
      323000 -- (-982.685) [-976.495] (-977.408) (-976.774) * (-977.576) (-983.457) [-976.034] (-977.669) -- 0:00:41
      323500 -- (-976.571) (-976.479) (-977.306) [-977.845] * (-976.292) [-977.529] (-976.368) (-983.194) -- 0:00:41
      324000 -- [-976.715] (-978.675) (-976.625) (-976.800) * (-979.570) (-976.352) (-977.265) [-978.625] -- 0:00:41
      324500 -- (-976.742) (-978.260) [-976.401] (-978.799) * (-978.184) (-976.039) (-976.455) [-976.707] -- 0:00:41
      325000 -- (-976.578) [-978.644] (-976.051) (-980.831) * (-979.029) [-978.628] (-978.155) (-976.513) -- 0:00:41

      Average standard deviation of split frequencies: 0.014942

      325500 -- (-981.731) [-977.233] (-976.103) (-977.073) * (-979.274) [-978.513] (-977.006) (-977.475) -- 0:00:41
      326000 -- (-978.839) (-978.166) [-976.277] (-976.548) * (-976.363) (-977.637) (-977.384) [-977.001] -- 0:00:41
      326500 -- (-979.925) [-976.406] (-976.324) (-977.852) * (-976.456) [-977.453] (-977.884) (-976.676) -- 0:00:41
      327000 -- (-979.166) (-976.346) [-980.809] (-979.408) * (-978.254) [-980.341] (-978.889) (-981.096) -- 0:00:41
      327500 -- (-979.322) [-976.570] (-978.513) (-978.282) * (-978.107) [-977.288] (-977.635) (-980.959) -- 0:00:41
      328000 -- (-977.053) (-979.906) [-980.069] (-976.883) * (-980.860) (-980.219) [-978.946] (-977.164) -- 0:00:40
      328500 -- (-976.362) (-977.212) [-978.312] (-976.511) * (-981.038) (-980.162) [-979.780] (-977.651) -- 0:00:40
      329000 -- [-978.202] (-977.058) (-979.432) (-975.934) * (-981.040) [-976.827] (-976.501) (-979.366) -- 0:00:40
      329500 -- [-976.694] (-979.600) (-978.904) (-981.391) * [-977.119] (-976.251) (-980.454) (-980.301) -- 0:00:40
      330000 -- (-976.683) (-980.924) [-980.272] (-981.032) * (-977.254) (-979.979) (-977.763) [-979.258] -- 0:00:40

      Average standard deviation of split frequencies: 0.013939

      330500 -- (-977.463) (-978.447) [-978.313] (-980.039) * (-977.092) [-978.282] (-976.969) (-981.371) -- 0:00:40
      331000 -- (-976.684) (-981.267) [-977.972] (-979.005) * [-980.001] (-978.790) (-978.071) (-977.549) -- 0:00:40
      331500 -- (-977.589) (-979.407) (-977.281) [-977.053] * (-977.689) (-978.235) [-976.688] (-979.316) -- 0:00:40
      332000 -- (-976.749) (-977.981) (-978.160) [-976.628] * (-977.603) (-978.279) [-976.773] (-979.689) -- 0:00:40
      332500 -- (-977.851) (-979.084) (-981.428) [-977.115] * (-979.460) [-977.567] (-977.170) (-984.034) -- 0:00:40
      333000 -- (-977.995) (-980.916) (-980.033) [-978.050] * (-979.705) [-976.826] (-978.189) (-978.201) -- 0:00:42
      333500 -- (-980.800) (-978.347) [-978.988] (-981.719) * (-980.971) (-978.912) (-979.902) [-978.093] -- 0:00:41
      334000 -- (-978.792) [-977.076] (-978.793) (-981.659) * (-977.664) (-979.330) (-977.174) [-979.450] -- 0:00:41
      334500 -- (-987.292) (-979.563) [-978.992] (-977.863) * (-977.032) (-981.212) (-977.760) [-978.520] -- 0:00:41
      335000 -- (-981.574) (-978.431) [-979.147] (-978.363) * [-977.179] (-982.752) (-979.463) (-978.834) -- 0:00:41

      Average standard deviation of split frequencies: 0.014773

      335500 -- (-976.658) [-978.286] (-982.178) (-977.415) * [-976.957] (-979.098) (-980.760) (-980.689) -- 0:00:41
      336000 -- [-978.448] (-977.477) (-980.177) (-977.209) * (-978.805) (-978.958) (-978.234) [-980.908] -- 0:00:41
      336500 -- (-978.972) [-980.344] (-979.512) (-979.546) * (-980.290) (-981.684) (-977.006) [-979.054] -- 0:00:41
      337000 -- (-977.554) (-980.742) (-980.834) [-977.120] * (-979.868) [-979.877] (-979.057) (-976.968) -- 0:00:41
      337500 -- [-976.097] (-980.289) (-977.086) (-976.897) * [-978.259] (-976.765) (-980.386) (-983.027) -- 0:00:41
      338000 -- (-976.949) [-977.357] (-978.483) (-976.221) * (-977.505) [-979.162] (-978.940) (-978.082) -- 0:00:41
      338500 -- (-977.172) (-977.613) [-979.291] (-982.010) * (-977.937) (-978.781) [-977.938] (-985.863) -- 0:00:41
      339000 -- [-978.179] (-979.998) (-979.632) (-976.755) * (-977.242) (-980.667) (-979.031) [-979.021] -- 0:00:40
      339500 -- [-976.868] (-979.440) (-977.629) (-977.554) * (-977.044) [-980.197] (-977.656) (-979.721) -- 0:00:40
      340000 -- (-980.844) (-982.605) (-977.869) [-979.386] * (-976.606) (-980.575) [-979.670] (-978.793) -- 0:00:40

      Average standard deviation of split frequencies: 0.016086

      340500 -- (-977.551) (-979.677) [-980.961] (-977.633) * (-977.973) [-976.550] (-978.864) (-978.302) -- 0:00:40
      341000 -- (-976.972) (-977.283) [-977.012] (-977.125) * (-977.082) [-977.766] (-976.411) (-979.724) -- 0:00:40
      341500 -- (-980.981) (-978.314) [-976.960] (-979.813) * [-977.603] (-976.949) (-976.861) (-976.463) -- 0:00:40
      342000 -- [-978.525] (-980.585) (-978.197) (-981.314) * [-977.956] (-977.806) (-979.538) (-976.999) -- 0:00:40
      342500 -- (-978.175) (-978.367) [-978.644] (-980.223) * (-979.346) [-979.088] (-978.034) (-977.170) -- 0:00:40
      343000 -- (-979.902) (-978.978) [-980.860] (-978.985) * (-981.136) [-977.092] (-977.298) (-983.016) -- 0:00:40
      343500 -- (-978.037) (-977.511) (-979.899) [-978.422] * (-981.372) (-980.040) (-977.460) [-979.313] -- 0:00:40
      344000 -- [-979.250] (-977.741) (-982.419) (-979.166) * (-980.430) (-980.187) (-976.884) [-976.967] -- 0:00:40
      344500 -- [-979.638] (-977.682) (-976.205) (-977.349) * (-978.082) (-980.377) [-976.613] (-982.844) -- 0:00:39
      345000 -- (-982.675) (-978.214) [-977.386] (-977.507) * (-978.900) (-979.814) [-978.184] (-979.076) -- 0:00:39

      Average standard deviation of split frequencies: 0.014628

      345500 -- (-977.613) (-978.778) [-977.191] (-978.037) * (-979.193) (-978.033) (-977.351) [-977.158] -- 0:00:39
      346000 -- (-978.692) [-977.644] (-975.890) (-976.270) * (-977.044) (-978.358) (-977.897) [-978.903] -- 0:00:39
      346500 -- (-977.823) [-977.029] (-977.819) (-976.231) * (-976.807) [-979.572] (-977.899) (-980.968) -- 0:00:39
      347000 -- (-981.145) (-976.913) [-979.707] (-976.770) * [-977.913] (-977.038) (-977.251) (-978.496) -- 0:00:39
      347500 -- [-978.853] (-976.098) (-980.116) (-978.675) * (-979.396) [-981.070] (-978.115) (-977.450) -- 0:00:39
      348000 -- (-978.692) (-977.786) (-976.978) [-980.562] * (-978.235) (-978.833) (-979.820) [-977.899] -- 0:00:39
      348500 -- (-979.359) [-977.785] (-981.029) (-979.880) * (-979.062) [-979.147] (-979.348) (-977.473) -- 0:00:39
      349000 -- (-980.682) (-981.535) [-976.544] (-977.110) * [-982.833] (-978.348) (-978.471) (-982.001) -- 0:00:39
      349500 -- (-981.503) (-976.750) (-977.245) [-979.717] * (-977.289) [-977.787] (-978.137) (-976.722) -- 0:00:40
      350000 -- (-980.678) (-976.817) [-976.515] (-976.316) * (-977.637) [-976.303] (-976.945) (-978.346) -- 0:00:40

      Average standard deviation of split frequencies: 0.015636

      350500 -- (-984.243) (-976.662) [-978.694] (-977.103) * [-978.092] (-981.476) (-976.968) (-979.642) -- 0:00:40
      351000 -- (-979.690) (-977.305) (-980.919) [-977.702] * [-978.492] (-979.670) (-976.693) (-978.996) -- 0:00:40
      351500 -- (-978.665) [-978.773] (-977.541) (-977.976) * (-979.802) (-979.214) [-976.048] (-977.340) -- 0:00:40
      352000 -- (-978.498) (-980.874) (-977.560) [-977.246] * (-977.941) (-983.561) [-979.376] (-978.126) -- 0:00:40
      352500 -- (-977.397) (-980.564) (-976.382) [-977.090] * (-979.769) (-982.885) [-978.418] (-976.766) -- 0:00:40
      353000 -- (-977.418) (-982.672) (-977.142) [-979.072] * (-976.736) [-978.211] (-977.043) (-983.322) -- 0:00:40
      353500 -- (-976.410) (-976.726) [-976.122] (-981.525) * (-976.931) (-978.444) [-979.213] (-977.251) -- 0:00:40
      354000 -- (-976.761) (-980.494) [-977.128] (-977.810) * (-976.507) (-978.419) (-981.097) [-978.369] -- 0:00:40
      354500 -- (-977.409) (-979.047) [-981.272] (-977.670) * (-976.894) (-979.313) (-978.502) [-980.432] -- 0:00:40
      355000 -- [-977.712] (-980.401) (-981.487) (-980.681) * (-981.060) (-979.896) (-980.062) [-978.064] -- 0:00:39

      Average standard deviation of split frequencies: 0.016202

      355500 -- (-982.184) [-980.261] (-979.009) (-978.872) * [-976.919] (-985.450) (-976.153) (-976.983) -- 0:00:39
      356000 -- [-976.935] (-977.885) (-977.880) (-979.690) * (-982.038) (-980.117) [-977.738] (-977.250) -- 0:00:39
      356500 -- [-979.144] (-978.033) (-977.640) (-984.212) * (-982.058) (-983.478) [-980.718] (-979.180) -- 0:00:39
      357000 -- [-978.778] (-976.846) (-977.811) (-978.990) * (-979.153) [-981.446] (-977.096) (-978.079) -- 0:00:39
      357500 -- (-979.049) (-976.801) (-980.184) [-979.531] * [-977.849] (-980.573) (-976.822) (-979.684) -- 0:00:39
      358000 -- (-976.330) [-976.324] (-979.714) (-978.306) * (-977.616) (-984.337) [-976.570] (-978.832) -- 0:00:39
      358500 -- (-976.876) (-978.139) [-977.948] (-978.718) * (-979.532) (-979.031) [-978.643] (-977.935) -- 0:00:39
      359000 -- (-976.964) (-978.058) [-976.704] (-978.202) * (-978.087) [-978.816] (-977.494) (-978.273) -- 0:00:39
      359500 -- (-977.446) [-977.823] (-979.073) (-978.203) * (-982.504) (-981.402) [-978.822] (-979.025) -- 0:00:39
      360000 -- [-979.253] (-979.251) (-983.786) (-977.336) * (-976.473) (-978.186) [-976.453] (-977.239) -- 0:00:39

      Average standard deviation of split frequencies: 0.014916

      360500 -- [-982.606] (-978.302) (-979.312) (-981.301) * [-978.224] (-976.918) (-979.253) (-979.989) -- 0:00:39
      361000 -- (-978.327) (-978.190) (-977.338) [-980.335] * (-977.484) [-977.193] (-976.824) (-976.321) -- 0:00:38
      361500 -- (-977.496) (-978.073) (-978.586) [-976.995] * (-977.644) [-978.305] (-977.937) (-980.362) -- 0:00:38
      362000 -- [-977.953] (-984.613) (-981.061) (-976.340) * [-979.085] (-976.940) (-976.910) (-982.465) -- 0:00:38
      362500 -- (-977.530) (-979.440) [-977.947] (-976.380) * (-979.408) (-975.859) (-981.080) [-978.091] -- 0:00:38
      363000 -- (-976.373) [-976.581] (-977.862) (-977.565) * [-979.682] (-980.348) (-978.366) (-978.141) -- 0:00:38
      363500 -- (-976.974) [-976.714] (-980.642) (-987.180) * (-981.130) (-977.536) (-982.763) [-978.774] -- 0:00:38
      364000 -- (-976.082) [-977.201] (-978.681) (-981.820) * (-981.013) (-977.172) (-976.942) [-978.850] -- 0:00:38
      364500 -- (-977.696) [-978.481] (-976.343) (-977.321) * (-983.315) (-978.048) (-977.487) [-979.699] -- 0:00:38
      365000 -- (-978.648) (-976.982) (-978.063) [-978.235] * (-979.345) (-977.917) [-978.699] (-977.474) -- 0:00:38

      Average standard deviation of split frequencies: 0.014395

      365500 -- (-977.432) (-979.835) [-980.107] (-976.657) * (-977.017) (-977.636) (-977.977) [-979.303] -- 0:00:39
      366000 -- (-976.209) [-978.722] (-977.476) (-976.473) * (-976.430) (-977.373) (-976.482) [-980.100] -- 0:00:39
      366500 -- (-978.048) (-978.666) [-977.975] (-981.119) * [-978.805] (-981.510) (-976.168) (-979.558) -- 0:00:39
      367000 -- (-978.048) (-979.234) (-979.163) [-978.149] * [-979.084] (-978.395) (-976.168) (-979.933) -- 0:00:39
      367500 -- [-977.941] (-979.958) (-979.632) (-980.740) * (-979.303) (-978.986) (-979.106) [-976.232] -- 0:00:39
      368000 -- (-981.743) (-981.625) (-978.385) [-979.282] * (-977.741) (-977.042) (-977.601) [-983.900] -- 0:00:39
      368500 -- (-981.896) [-981.093] (-977.797) (-979.312) * [-977.966] (-978.983) (-977.055) (-981.335) -- 0:00:39
      369000 -- (-978.308) (-979.769) (-976.750) [-977.186] * (-976.292) (-983.150) [-979.442] (-979.275) -- 0:00:39
      369500 -- [-977.976] (-980.699) (-977.344) (-979.794) * [-977.129] (-977.611) (-977.397) (-976.918) -- 0:00:39
      370000 -- [-976.770] (-977.829) (-978.283) (-981.273) * (-979.487) (-979.377) (-980.148) [-976.993] -- 0:00:39

      Average standard deviation of split frequencies: 0.013566

      370500 -- [-977.009] (-976.862) (-978.336) (-978.136) * [-978.962] (-978.114) (-977.701) (-977.213) -- 0:00:39
      371000 -- (-979.383) (-979.215) [-981.077] (-978.300) * (-977.387) (-977.524) [-981.168] (-976.945) -- 0:00:38
      371500 -- (-976.631) (-979.088) (-980.965) [-979.158] * (-979.953) (-981.492) (-978.366) [-979.487] -- 0:00:38
      372000 -- (-979.650) (-977.273) (-980.735) [-978.093] * (-979.749) (-983.966) (-979.977) [-977.773] -- 0:00:38
      372500 -- [-977.162] (-976.393) (-979.347) (-976.841) * [-976.223] (-981.033) (-976.046) (-977.662) -- 0:00:38
      373000 -- (-980.713) [-979.860] (-977.587) (-977.760) * (-976.708) (-980.074) (-978.038) [-976.678] -- 0:00:38
      373500 -- (-978.466) (-983.429) (-982.779) [-977.643] * [-977.863] (-978.134) (-976.994) (-976.250) -- 0:00:38
      374000 -- [-977.543] (-977.029) (-976.245) (-981.068) * (-976.490) [-977.246] (-977.416) (-976.289) -- 0:00:38
      374500 -- [-978.634] (-978.172) (-977.737) (-980.638) * (-979.520) (-978.169) (-976.774) [-976.536] -- 0:00:38
      375000 -- (-980.669) [-976.131] (-977.330) (-981.119) * (-977.420) (-976.281) [-976.559] (-977.409) -- 0:00:38

      Average standard deviation of split frequencies: 0.014627

      375500 -- [-981.505] (-976.426) (-980.161) (-980.797) * (-978.108) (-976.129) [-978.190] (-979.394) -- 0:00:38
      376000 -- (-979.552) [-976.541] (-979.465) (-978.580) * [-977.568] (-977.412) (-982.605) (-978.534) -- 0:00:38
      376500 -- (-978.419) (-976.620) [-977.802] (-977.341) * (-976.401) (-976.375) (-983.721) [-978.466] -- 0:00:38
      377000 -- (-980.518) (-979.761) [-981.200] (-977.988) * (-978.591) [-977.628] (-978.183) (-978.677) -- 0:00:38
      377500 -- (-979.277) (-979.531) (-979.812) [-976.628] * [-977.418] (-976.881) (-983.609) (-980.600) -- 0:00:37
      378000 -- (-979.184) (-981.442) (-980.110) [-976.785] * (-977.926) (-982.686) [-977.211] (-979.144) -- 0:00:37
      378500 -- [-979.294] (-982.724) (-982.856) (-976.387) * (-979.547) [-982.054] (-983.288) (-978.876) -- 0:00:37
      379000 -- (-980.527) (-980.573) [-977.784] (-977.440) * (-978.020) (-980.047) (-979.078) [-978.976] -- 0:00:37
      379500 -- [-980.856] (-979.343) (-976.989) (-979.646) * (-978.333) [-977.970] (-976.934) (-979.168) -- 0:00:37
      380000 -- (-979.612) [-977.506] (-976.567) (-982.003) * (-978.627) (-977.213) [-978.916] (-977.237) -- 0:00:37

      Average standard deviation of split frequencies: 0.014516

      380500 -- (-978.554) (-979.182) [-976.324] (-979.808) * (-978.507) (-978.832) [-978.616] (-977.479) -- 0:00:37
      381000 -- [-980.293] (-981.124) (-978.190) (-980.617) * (-980.173) [-977.739] (-981.946) (-980.202) -- 0:00:37
      381500 -- [-977.251] (-976.914) (-976.668) (-978.919) * [-976.764] (-977.786) (-978.024) (-980.081) -- 0:00:38
      382000 -- [-978.026] (-980.789) (-978.377) (-979.215) * (-979.540) [-978.634] (-980.354) (-977.711) -- 0:00:38
      382500 -- [-977.411] (-977.470) (-977.321) (-977.560) * (-979.583) (-979.076) [-976.563] (-983.063) -- 0:00:38
      383000 -- (-981.931) [-976.289] (-976.479) (-986.654) * (-978.224) (-979.747) [-976.589] (-982.139) -- 0:00:38
      383500 -- (-985.226) (-976.901) (-977.032) [-979.186] * [-978.187] (-978.927) (-976.146) (-978.824) -- 0:00:38
      384000 -- (-980.363) [-978.007] (-976.402) (-978.385) * [-979.372] (-978.141) (-980.323) (-978.061) -- 0:00:38
      384500 -- (-978.720) (-977.270) [-976.856] (-978.279) * (-977.486) (-979.121) (-978.806) [-980.667] -- 0:00:38
      385000 -- [-977.592] (-977.350) (-977.718) (-978.433) * (-977.173) (-979.453) (-979.242) [-977.221] -- 0:00:38

      Average standard deviation of split frequencies: 0.014859

      385500 -- [-978.007] (-976.781) (-979.274) (-979.018) * (-978.724) (-977.352) (-976.496) [-977.094] -- 0:00:38
      386000 -- (-979.779) (-976.663) (-978.942) [-978.458] * (-981.022) (-977.094) [-977.206] (-978.264) -- 0:00:38
      386500 -- (-980.200) (-977.240) (-980.514) [-978.215] * (-981.105) (-978.707) (-979.260) [-980.503] -- 0:00:38
      387000 -- [-980.287] (-979.393) (-977.572) (-976.788) * [-976.927] (-981.091) (-978.542) (-979.488) -- 0:00:38
      387500 -- (-985.604) [-977.849] (-976.847) (-977.759) * (-978.657) [-978.559] (-976.950) (-979.096) -- 0:00:37
      388000 -- [-977.235] (-979.840) (-978.902) (-977.596) * [-978.837] (-980.334) (-977.832) (-977.114) -- 0:00:37
      388500 -- (-976.672) (-979.201) (-980.109) [-981.000] * (-978.004) [-976.629] (-983.088) (-981.804) -- 0:00:37
      389000 -- [-977.903] (-980.524) (-980.628) (-976.563) * (-980.462) (-978.740) [-977.363] (-977.683) -- 0:00:37
      389500 -- [-979.314] (-983.776) (-977.946) (-979.985) * (-978.595) (-978.824) (-978.717) [-977.341] -- 0:00:37
      390000 -- [-977.578] (-980.737) (-976.856) (-980.375) * (-977.049) [-977.834] (-977.913) (-982.528) -- 0:00:37

      Average standard deviation of split frequencies: 0.013609

      390500 -- (-978.430) (-977.448) (-978.206) [-979.076] * [-976.889] (-978.449) (-977.012) (-978.335) -- 0:00:37
      391000 -- (-978.426) [-979.413] (-978.417) (-978.081) * (-977.673) (-980.717) (-977.600) [-978.749] -- 0:00:37
      391500 -- (-979.990) (-978.948) (-981.348) [-978.948] * (-978.759) [-977.160] (-978.473) (-982.634) -- 0:00:37
      392000 -- (-977.553) [-979.392] (-977.113) (-977.033) * (-978.244) (-979.267) (-981.578) [-977.467] -- 0:00:37
      392500 -- [-980.850] (-978.265) (-979.131) (-978.779) * (-978.513) (-978.753) (-977.801) [-979.239] -- 0:00:37
      393000 -- [-978.093] (-978.118) (-979.133) (-982.874) * [-980.454] (-980.533) (-979.968) (-977.616) -- 0:00:37
      393500 -- [-982.209] (-980.377) (-978.750) (-976.985) * (-981.283) [-980.017] (-979.007) (-980.045) -- 0:00:36
      394000 -- [-977.942] (-977.779) (-977.863) (-976.622) * (-977.332) [-977.021] (-976.942) (-982.339) -- 0:00:36
      394500 -- (-982.018) (-976.953) [-979.215] (-978.400) * (-980.532) [-977.760] (-979.120) (-977.284) -- 0:00:36
      395000 -- [-977.747] (-977.714) (-984.210) (-979.294) * (-981.568) (-977.719) (-979.628) [-977.285] -- 0:00:36

      Average standard deviation of split frequencies: 0.014550

      395500 -- (-980.626) (-979.640) (-981.043) [-977.214] * [-979.535] (-976.922) (-979.316) (-977.285) -- 0:00:36
      396000 -- (-981.622) (-977.584) [-977.800] (-979.237) * (-981.605) [-976.841] (-980.172) (-977.562) -- 0:00:36
      396500 -- (-983.397) (-978.747) [-976.627] (-978.745) * [-976.319] (-978.218) (-982.230) (-976.761) -- 0:00:36
      397000 -- (-979.772) (-978.755) [-978.457] (-980.834) * (-980.824) [-981.139] (-979.434) (-980.442) -- 0:00:36
      397500 -- (-977.498) (-980.253) (-977.952) [-978.294] * (-979.705) (-979.293) [-980.181] (-976.582) -- 0:00:37
      398000 -- (-979.736) (-977.066) [-977.657] (-979.502) * (-979.586) [-976.541] (-981.579) (-981.100) -- 0:00:37
      398500 -- (-980.499) (-977.315) (-977.632) [-977.625] * (-982.728) (-977.186) (-977.856) [-977.994] -- 0:00:37
      399000 -- (-977.736) (-978.545) (-975.954) [-980.878] * (-979.742) (-984.948) (-976.555) [-976.932] -- 0:00:37
      399500 -- (-976.499) (-978.166) (-977.992) [-980.713] * [-977.554] (-981.403) (-976.622) (-976.738) -- 0:00:37
      400000 -- [-976.092] (-979.525) (-980.719) (-977.399) * [-977.493] (-979.829) (-980.743) (-978.103) -- 0:00:37

      Average standard deviation of split frequencies: 0.014184

      400500 -- (-977.405) (-976.830) [-976.689] (-976.300) * (-979.532) (-978.225) (-977.753) [-977.994] -- 0:00:37
      401000 -- (-979.617) (-978.432) [-977.153] (-977.406) * [-978.821] (-979.421) (-976.723) (-977.888) -- 0:00:37
      401500 -- (-979.384) (-979.872) [-977.991] (-978.468) * [-979.089] (-978.614) (-977.927) (-976.445) -- 0:00:37
      402000 -- (-978.771) [-978.150] (-978.606) (-976.237) * (-975.789) (-977.382) [-978.275] (-978.651) -- 0:00:37
      402500 -- (-978.990) (-980.059) (-978.208) [-976.267] * [-975.789] (-978.230) (-977.593) (-979.331) -- 0:00:37
      403000 -- (-977.047) (-980.438) (-978.956) [-976.858] * (-983.230) [-978.627] (-979.883) (-977.042) -- 0:00:37
      403500 -- [-981.663] (-978.792) (-981.492) (-982.586) * (-982.431) (-976.880) (-981.008) [-977.621] -- 0:00:36
      404000 -- (-983.781) (-978.478) (-977.223) [-976.797] * (-981.022) (-977.150) (-979.498) [-979.616] -- 0:00:36
      404500 -- (-984.135) (-979.452) (-977.972) [-976.904] * (-977.949) [-977.311] (-979.035) (-981.317) -- 0:00:36
      405000 -- (-976.981) (-979.292) (-977.671) [-976.977] * (-977.555) (-976.916) (-978.659) [-979.818] -- 0:00:36

      Average standard deviation of split frequencies: 0.015033

      405500 -- (-976.776) (-981.261) [-978.973] (-978.905) * (-977.938) [-979.846] (-983.457) (-978.770) -- 0:00:36
      406000 -- (-976.230) (-980.138) [-981.248] (-978.326) * [-977.400] (-976.281) (-978.939) (-978.707) -- 0:00:36
      406500 -- (-977.185) [-977.170] (-979.323) (-977.163) * [-977.581] (-977.365) (-978.814) (-979.608) -- 0:00:36
      407000 -- (-977.032) (-977.515) (-978.661) [-976.558] * (-977.677) [-976.471] (-976.075) (-978.326) -- 0:00:36
      407500 -- [-978.872] (-976.865) (-979.074) (-977.570) * (-981.211) [-977.625] (-976.556) (-976.761) -- 0:00:36
      408000 -- (-977.071) (-977.293) [-977.264] (-977.099) * [-977.695] (-978.449) (-979.472) (-976.339) -- 0:00:36
      408500 -- (-977.311) (-977.286) (-977.264) [-976.433] * (-977.259) (-982.726) [-978.778] (-976.566) -- 0:00:36
      409000 -- (-984.326) [-976.238] (-975.755) (-976.724) * (-978.604) [-977.252] (-977.637) (-978.005) -- 0:00:36
      409500 -- (-979.497) [-976.617] (-976.360) (-977.038) * (-979.052) [-977.456] (-977.942) (-979.703) -- 0:00:36
      410000 -- (-980.547) (-976.409) [-978.733] (-978.363) * (-977.488) [-976.304] (-980.610) (-978.272) -- 0:00:35

      Average standard deviation of split frequencies: 0.013966

      410500 -- (-978.910) (-981.783) (-978.576) [-978.798] * (-981.953) (-976.931) [-978.447] (-977.277) -- 0:00:35
      411000 -- (-978.822) [-981.981] (-979.728) (-979.997) * (-978.230) (-980.256) (-977.241) [-977.294] -- 0:00:35
      411500 -- (-977.817) (-982.417) [-976.530] (-977.043) * (-976.721) (-978.681) (-977.240) [-978.143] -- 0:00:35
      412000 -- (-976.935) [-979.960] (-978.430) (-977.148) * (-979.556) (-977.265) [-978.718] (-976.484) -- 0:00:35
      412500 -- (-978.476) [-978.703] (-979.382) (-978.552) * (-977.004) [-977.781] (-977.247) (-976.332) -- 0:00:35
      413000 -- (-977.080) (-977.468) [-979.195] (-977.445) * (-976.994) [-976.825] (-979.491) (-977.122) -- 0:00:35
      413500 -- (-978.676) (-979.147) (-979.040) [-979.862] * (-977.156) (-977.612) (-981.210) [-978.092] -- 0:00:36
      414000 -- (-977.182) (-979.706) [-978.104] (-976.057) * (-978.400) (-979.781) (-981.116) [-978.533] -- 0:00:36
      414500 -- (-977.375) (-977.864) [-977.326] (-979.988) * (-983.518) (-978.767) (-976.617) [-977.907] -- 0:00:36
      415000 -- (-978.129) (-978.622) [-978.258] (-983.290) * (-981.455) (-984.080) [-976.535] (-977.660) -- 0:00:36

      Average standard deviation of split frequencies: 0.014102

      415500 -- (-978.965) (-976.577) [-976.728] (-976.720) * (-977.419) (-979.871) [-976.515] (-976.653) -- 0:00:36
      416000 -- (-978.313) (-976.032) (-979.588) [-976.645] * (-979.312) [-977.794] (-978.222) (-978.689) -- 0:00:36
      416500 -- (-978.786) (-977.512) [-981.147] (-976.622) * (-979.436) (-978.001) (-979.449) [-977.812] -- 0:00:36
      417000 -- (-978.938) (-978.851) (-978.872) [-976.499] * (-978.401) (-981.706) [-977.541] (-981.237) -- 0:00:36
      417500 -- (-977.810) [-978.081] (-982.824) (-979.615) * [-976.858] (-984.979) (-978.304) (-984.229) -- 0:00:36
      418000 -- (-987.149) (-977.073) [-976.255] (-981.311) * (-976.196) (-989.510) [-977.651] (-979.645) -- 0:00:36
      418500 -- (-981.902) [-977.109] (-976.352) (-976.847) * (-976.238) (-981.483) [-976.795] (-982.656) -- 0:00:36
      419000 -- (-980.725) (-980.036) (-976.430) [-976.287] * [-977.934] (-979.603) (-978.790) (-977.028) -- 0:00:36
      419500 -- (-977.169) (-977.266) (-976.979) [-976.888] * [-976.805] (-976.803) (-979.763) (-978.056) -- 0:00:35
      420000 -- (-980.811) [-978.059] (-983.083) (-978.565) * (-980.840) (-976.979) (-984.010) [-980.381] -- 0:00:35

      Average standard deviation of split frequencies: 0.014988

      420500 -- (-977.386) [-979.099] (-977.962) (-980.066) * (-979.782) [-980.630] (-985.726) (-978.332) -- 0:00:35
      421000 -- (-981.198) [-979.661] (-977.354) (-982.324) * [-979.610] (-979.436) (-982.207) (-980.786) -- 0:00:35
      421500 -- (-979.594) (-979.950) [-977.208] (-978.895) * (-979.497) (-980.153) (-982.958) [-976.963] -- 0:00:35
      422000 -- [-976.201] (-983.015) (-976.962) (-977.692) * (-977.450) (-977.497) [-980.741] (-978.401) -- 0:00:35
      422500 -- (-977.060) (-978.473) [-977.936] (-977.142) * (-976.253) [-978.088] (-981.135) (-977.720) -- 0:00:35
      423000 -- [-979.134] (-977.328) (-980.057) (-977.862) * (-975.946) (-977.890) (-980.285) [-977.860] -- 0:00:35
      423500 -- (-982.382) (-977.349) (-976.968) [-977.492] * [-977.082] (-978.491) (-979.007) (-978.272) -- 0:00:35
      424000 -- (-979.488) [-976.629] (-982.320) (-980.087) * [-977.624] (-980.299) (-978.899) (-978.289) -- 0:00:35
      424500 -- [-979.709] (-980.318) (-981.708) (-978.748) * (-978.273) (-983.600) (-978.326) [-977.962] -- 0:00:35
      425000 -- (-977.057) (-976.816) (-977.408) [-978.018] * [-980.682] (-976.892) (-977.661) (-978.635) -- 0:00:35

      Average standard deviation of split frequencies: 0.014125

      425500 -- (-979.461) [-976.602] (-977.137) (-978.454) * [-978.949] (-976.849) (-978.092) (-980.724) -- 0:00:35
      426000 -- [-977.424] (-977.668) (-977.050) (-977.711) * (-982.436) (-977.219) [-976.870] (-980.411) -- 0:00:35
      426500 -- (-978.657) (-977.159) [-976.890] (-979.657) * (-978.045) (-977.239) [-976.570] (-980.458) -- 0:00:34
      427000 -- (-981.731) [-977.408] (-981.104) (-981.459) * (-978.560) (-977.087) [-977.249] (-979.896) -- 0:00:34
      427500 -- (-977.589) (-979.278) (-975.928) [-978.385] * (-978.616) (-978.203) (-977.084) [-977.679] -- 0:00:34
      428000 -- (-979.045) (-977.509) (-979.677) [-977.705] * (-979.404) [-975.966] (-979.338) (-980.821) -- 0:00:34
      428500 -- (-976.818) (-979.054) (-984.182) [-979.828] * (-978.552) [-976.386] (-976.420) (-981.112) -- 0:00:34
      429000 -- (-977.092) (-978.362) [-977.919] (-977.979) * [-976.978] (-980.830) (-977.138) (-980.567) -- 0:00:34
      429500 -- [-976.300] (-978.096) (-976.323) (-977.638) * (-977.615) (-979.275) (-982.452) [-978.175] -- 0:00:34
      430000 -- [-977.650] (-980.650) (-978.419) (-979.278) * (-978.535) (-977.086) (-977.508) [-981.085] -- 0:00:35

      Average standard deviation of split frequencies: 0.015393

      430500 -- (-978.380) [-976.619] (-978.367) (-977.481) * (-978.987) [-976.913] (-979.522) (-980.630) -- 0:00:35
      431000 -- (-977.273) [-978.150] (-978.343) (-977.610) * (-978.039) [-976.488] (-977.173) (-985.877) -- 0:00:35
      431500 -- (-978.450) [-977.634] (-980.931) (-978.621) * (-977.016) [-976.494] (-980.205) (-981.710) -- 0:00:35
      432000 -- (-976.602) (-976.847) (-979.769) [-976.202] * (-976.778) (-982.181) [-976.810] (-978.365) -- 0:00:35
      432500 -- (-976.910) [-976.510] (-981.633) (-976.223) * (-976.778) (-980.092) [-977.010] (-978.890) -- 0:00:35
      433000 -- [-977.548] (-979.423) (-979.168) (-976.939) * [-978.030] (-978.710) (-978.867) (-978.211) -- 0:00:35
      433500 -- (-976.924) [-978.420] (-976.812) (-976.871) * (-978.807) (-982.967) (-976.880) [-978.934] -- 0:00:35
      434000 -- (-980.614) [-977.505] (-977.281) (-979.506) * (-979.714) (-982.492) [-978.723] (-977.872) -- 0:00:35
      434500 -- (-979.482) [-978.433] (-979.200) (-978.142) * (-979.952) (-976.728) [-978.585] (-978.449) -- 0:00:35
      435000 -- [-977.474] (-979.260) (-978.999) (-979.760) * (-977.212) (-979.010) (-985.406) [-977.283] -- 0:00:35

      Average standard deviation of split frequencies: 0.015073

      435500 -- (-977.969) (-978.349) (-978.956) [-979.316] * (-978.884) (-976.959) [-983.346] (-978.797) -- 0:00:34
      436000 -- [-977.587] (-978.353) (-980.199) (-977.831) * (-978.802) (-978.573) [-979.818] (-978.142) -- 0:00:34
      436500 -- (-978.626) [-976.959] (-978.900) (-977.628) * [-978.932] (-980.649) (-976.743) (-980.230) -- 0:00:34
      437000 -- (-979.385) [-976.711] (-978.285) (-977.993) * (-979.213) [-980.248] (-978.553) (-977.089) -- 0:00:34
      437500 -- (-978.470) (-979.343) [-978.039] (-977.684) * [-977.285] (-976.709) (-980.238) (-976.289) -- 0:00:34
      438000 -- [-982.084] (-978.015) (-976.486) (-978.296) * [-976.468] (-981.176) (-979.160) (-977.550) -- 0:00:34
      438500 -- (-978.141) (-980.546) (-976.743) [-977.755] * (-978.914) [-980.534] (-979.451) (-977.148) -- 0:00:34
      439000 -- (-977.739) (-979.133) [-977.812] (-979.628) * (-976.966) (-978.466) [-976.679] (-975.808) -- 0:00:34
      439500 -- (-976.942) [-979.081] (-976.805) (-977.007) * (-978.314) [-978.448] (-978.476) (-975.920) -- 0:00:34
      440000 -- (-976.622) (-978.069) (-980.197) [-977.330] * [-976.554] (-979.711) (-978.334) (-976.817) -- 0:00:34

      Average standard deviation of split frequencies: 0.014033

      440500 -- (-977.668) [-977.687] (-979.343) (-976.901) * [-977.377] (-977.098) (-975.989) (-981.045) -- 0:00:34
      441000 -- (-977.555) (-981.180) (-977.742) [-976.909] * (-977.484) (-976.902) (-983.027) [-978.783] -- 0:00:34
      441500 -- (-977.691) [-978.298] (-980.802) (-977.480) * (-981.107) [-977.330] (-979.869) (-980.505) -- 0:00:34
      442000 -- [-976.435] (-977.689) (-982.248) (-979.457) * (-977.581) (-981.407) (-982.497) [-978.837] -- 0:00:34
      442500 -- (-979.097) [-978.165] (-980.494) (-978.992) * (-982.161) (-977.830) (-983.324) [-978.652] -- 0:00:34
      443000 -- (-979.592) (-980.110) (-980.948) [-976.300] * (-979.585) [-976.461] (-979.569) (-978.708) -- 0:00:33
      443500 -- [-979.503] (-977.086) (-985.089) (-978.220) * [-979.230] (-976.803) (-978.856) (-978.210) -- 0:00:33
      444000 -- (-977.730) [-978.386] (-981.452) (-977.907) * (-981.392) (-976.718) [-977.931] (-976.012) -- 0:00:33
      444500 -- (-979.235) (-976.680) (-985.035) [-978.197] * (-978.745) [-978.299] (-976.407) (-976.043) -- 0:00:33
      445000 -- (-977.964) (-976.856) (-978.408) [-977.803] * [-978.497] (-980.059) (-981.625) (-976.093) -- 0:00:33

      Average standard deviation of split frequencies: 0.013181

      445500 -- (-981.622) [-976.797] (-984.239) (-980.225) * (-977.203) (-976.241) [-977.922] (-977.422) -- 0:00:33
      446000 -- (-978.155) [-976.646] (-978.401) (-978.224) * (-978.403) (-976.564) (-980.748) [-979.623] -- 0:00:34
      446500 -- [-979.421] (-976.630) (-976.654) (-978.911) * (-979.194) (-976.239) (-981.796) [-980.421] -- 0:00:34
      447000 -- (-982.327) (-976.481) [-977.563] (-980.746) * (-979.699) [-976.239] (-978.597) (-979.258) -- 0:00:34
      447500 -- (-978.011) (-976.645) (-980.681) [-981.239] * (-977.377) [-976.234] (-981.315) (-976.852) -- 0:00:34
      448000 -- (-976.706) (-977.012) (-978.927) [-977.563] * (-978.897) (-978.018) [-982.615] (-979.814) -- 0:00:34
      448500 -- (-978.068) (-976.399) [-980.343] (-985.725) * (-976.391) (-976.566) (-980.589) [-976.273] -- 0:00:34
      449000 -- (-978.832) (-976.904) (-984.647) [-981.772] * [-976.666] (-980.902) (-977.006) (-977.934) -- 0:00:34
      449500 -- (-978.392) [-979.847] (-983.514) (-977.857) * (-978.831) [-977.324] (-977.006) (-978.832) -- 0:00:34
      450000 -- (-980.090) (-977.364) (-976.716) [-976.888] * (-979.236) [-978.137] (-976.840) (-980.345) -- 0:00:34

      Average standard deviation of split frequencies: 0.012491

      450500 -- (-977.025) [-976.336] (-980.933) (-978.846) * [-980.642] (-977.976) (-979.403) (-978.640) -- 0:00:34
      451000 -- (-976.709) (-978.084) (-978.891) [-978.082] * (-981.283) [-976.950] (-982.505) (-978.803) -- 0:00:34
      451500 -- (-980.410) (-977.445) (-977.303) [-979.393] * (-980.699) [-978.123] (-981.516) (-977.357) -- 0:00:34
      452000 -- (-976.831) (-978.748) [-977.897] (-977.840) * (-979.394) (-978.869) (-976.408) [-976.014] -- 0:00:33
      452500 -- (-978.571) [-978.192] (-977.924) (-976.338) * (-982.663) (-976.939) (-976.387) [-975.965] -- 0:00:33
      453000 -- (-978.414) (-978.499) [-976.728] (-977.440) * (-978.035) (-976.756) [-979.836] (-977.761) -- 0:00:33
      453500 -- (-976.353) (-979.822) [-979.237] (-979.155) * [-978.417] (-977.301) (-980.295) (-977.357) -- 0:00:33
      454000 -- (-978.122) (-977.473) (-976.424) [-979.199] * (-980.855) [-977.001] (-978.663) (-979.975) -- 0:00:33
      454500 -- (-980.574) (-976.525) [-977.293] (-976.810) * [-980.130] (-976.574) (-979.885) (-980.624) -- 0:00:33
      455000 -- (-978.787) [-976.109] (-977.293) (-978.009) * (-977.016) (-978.336) (-979.123) [-982.414] -- 0:00:33

      Average standard deviation of split frequencies: 0.012284

      455500 -- (-977.275) (-978.704) [-978.159] (-978.663) * [-977.679] (-981.026) (-983.266) (-977.673) -- 0:00:33
      456000 -- (-979.007) (-976.994) (-977.815) [-977.274] * (-977.825) (-978.572) [-977.940] (-976.759) -- 0:00:33
      456500 -- (-978.526) [-978.853] (-980.322) (-977.862) * [-979.799] (-978.566) (-979.259) (-977.485) -- 0:00:33
      457000 -- (-978.777) (-978.523) (-979.262) [-978.409] * (-976.983) (-980.415) (-979.685) [-979.919] -- 0:00:33
      457500 -- [-978.739] (-978.637) (-979.098) (-978.064) * (-976.656) [-978.255] (-978.803) (-981.550) -- 0:00:33
      458000 -- (-980.629) [-981.276] (-983.228) (-978.370) * (-976.838) [-979.062] (-979.837) (-982.303) -- 0:00:33
      458500 -- (-979.504) [-978.442] (-980.053) (-976.749) * (-980.602) [-977.235] (-979.438) (-977.878) -- 0:00:33
      459000 -- (-976.938) (-977.097) [-978.259] (-977.843) * (-983.202) (-980.916) (-977.697) [-977.019] -- 0:00:33
      459500 -- [-980.185] (-978.887) (-979.225) (-976.376) * (-977.566) [-977.675] (-978.160) (-976.392) -- 0:00:32
      460000 -- (-978.199) (-977.386) [-979.905] (-976.796) * (-977.187) (-981.517) (-977.531) [-977.087] -- 0:00:32

      Average standard deviation of split frequencies: 0.013062

      460500 -- [-978.311] (-978.884) (-980.055) (-979.576) * [-977.778] (-980.336) (-977.827) (-976.785) -- 0:00:32
      461000 -- [-977.417] (-981.234) (-984.930) (-982.358) * (-978.739) (-982.324) [-976.820] (-977.293) -- 0:00:32
      461500 -- (-979.055) [-978.690] (-987.686) (-976.320) * (-980.434) [-979.182] (-980.894) (-977.127) -- 0:00:32
      462000 -- (-978.004) (-977.913) [-977.554] (-978.482) * (-977.094) [-977.705] (-980.531) (-978.311) -- 0:00:33
      462500 -- (-978.698) [-977.984] (-976.822) (-979.144) * (-976.920) (-980.212) [-981.076] (-978.768) -- 0:00:33
      463000 -- (-980.214) (-976.541) (-976.474) [-977.158] * [-977.519] (-978.499) (-979.464) (-978.625) -- 0:00:33
      463500 -- (-978.346) [-981.089] (-980.053) (-979.197) * (-977.448) (-975.992) (-979.201) [-977.522] -- 0:00:33
      464000 -- (-976.679) (-980.190) (-979.214) [-978.582] * (-978.277) (-979.413) (-979.591) [-976.905] -- 0:00:33
      464500 -- (-977.521) (-981.771) [-978.556] (-980.931) * (-978.611) (-981.589) (-979.696) [-976.793] -- 0:00:33
      465000 -- (-977.753) (-983.356) [-978.147] (-982.509) * (-980.278) [-979.704] (-979.590) (-975.919) -- 0:00:33

      Average standard deviation of split frequencies: 0.012757

      465500 -- [-977.059] (-978.361) (-977.585) (-978.114) * (-976.890) (-980.846) (-979.941) [-977.137] -- 0:00:33
      466000 -- (-977.501) (-979.249) [-980.327] (-980.231) * (-978.653) [-980.861] (-979.481) (-977.437) -- 0:00:33
      466500 -- (-980.429) [-977.008] (-979.025) (-980.307) * [-982.336] (-977.327) (-977.821) (-977.053) -- 0:00:33
      467000 -- [-978.396] (-980.791) (-978.174) (-977.847) * (-981.773) (-976.777) [-977.380] (-979.566) -- 0:00:33
      467500 -- (-977.785) [-981.238] (-976.425) (-977.610) * [-979.713] (-977.094) (-978.442) (-977.348) -- 0:00:33
      468000 -- (-979.471) (-977.597) (-977.132) [-978.262] * (-979.960) (-978.553) (-978.502) [-977.565] -- 0:00:32
      468500 -- (-977.571) (-978.722) [-976.908] (-980.061) * (-980.175) (-977.506) [-978.353] (-980.251) -- 0:00:32
      469000 -- (-977.048) (-978.251) [-978.295] (-983.183) * (-979.665) [-978.465] (-977.685) (-978.022) -- 0:00:32
      469500 -- (-976.480) (-981.395) [-981.540] (-980.899) * (-980.705) (-979.094) [-976.695] (-978.151) -- 0:00:32
      470000 -- (-977.315) (-978.702) [-978.699] (-984.244) * [-977.974] (-979.880) (-978.770) (-980.639) -- 0:00:32

      Average standard deviation of split frequencies: 0.013197

      470500 -- (-977.424) (-978.165) [-978.274] (-977.517) * (-979.614) [-978.055] (-976.964) (-980.401) -- 0:00:32
      471000 -- (-978.483) (-979.415) (-980.046) [-981.084] * [-977.404] (-978.889) (-983.492) (-975.930) -- 0:00:32
      471500 -- [-976.270] (-981.162) (-981.981) (-979.070) * (-976.075) (-979.891) [-978.048] (-977.320) -- 0:00:32
      472000 -- (-978.000) (-982.395) (-979.380) [-977.634] * [-976.064] (-979.476) (-976.859) (-977.798) -- 0:00:32
      472500 -- (-976.206) (-977.972) (-983.063) [-976.651] * (-976.378) (-978.587) (-978.045) [-976.471] -- 0:00:32
      473000 -- (-976.443) [-976.343] (-984.746) (-978.105) * (-977.393) (-977.365) (-977.325) [-978.375] -- 0:00:32
      473500 -- (-978.303) (-980.232) [-976.494] (-978.859) * (-977.666) (-978.027) [-976.677] (-977.541) -- 0:00:32
      474000 -- (-979.813) (-979.337) (-979.150) [-980.483] * [-977.620] (-978.113) (-979.368) (-978.401) -- 0:00:32
      474500 -- (-979.955) (-976.433) [-976.944] (-979.030) * [-979.960] (-977.430) (-976.933) (-979.252) -- 0:00:32
      475000 -- (-977.658) [-978.557] (-977.039) (-977.609) * [-977.780] (-978.943) (-978.593) (-977.055) -- 0:00:32

      Average standard deviation of split frequencies: 0.013493

      475500 -- [-976.788] (-983.063) (-979.070) (-979.062) * [-977.339] (-979.510) (-977.901) (-977.088) -- 0:00:31
      476000 -- (-983.783) [-980.023] (-976.280) (-977.924) * [-976.991] (-978.588) (-977.484) (-978.136) -- 0:00:31
      476500 -- [-978.878] (-978.358) (-981.028) (-978.038) * (-977.982) (-980.310) (-977.927) [-979.037] -- 0:00:31
      477000 -- [-977.992] (-977.020) (-976.909) (-981.659) * (-978.596) (-979.847) (-984.066) [-977.833] -- 0:00:31
      477500 -- (-978.901) (-979.286) (-977.307) [-976.785] * (-978.548) (-977.839) (-979.316) [-976.541] -- 0:00:32
      478000 -- (-976.989) (-978.189) (-979.424) [-976.470] * (-978.984) [-978.104] (-976.337) (-977.458) -- 0:00:32
      478500 -- [-976.948] (-977.302) (-977.256) (-976.761) * (-980.561) (-978.325) (-976.726) [-977.379] -- 0:00:32
      479000 -- (-976.795) (-976.390) [-979.917] (-977.858) * (-978.151) [-979.215] (-979.369) (-976.145) -- 0:00:32
      479500 -- (-976.887) [-978.171] (-977.985) (-977.863) * (-979.390) (-978.755) (-978.528) [-977.457] -- 0:00:32
      480000 -- (-976.826) [-977.905] (-980.552) (-977.384) * (-980.315) [-977.505] (-978.217) (-984.982) -- 0:00:32

      Average standard deviation of split frequencies: 0.013599

      480500 -- [-978.397] (-979.169) (-977.637) (-980.500) * (-980.306) (-977.754) [-977.982] (-980.740) -- 0:00:32
      481000 -- (-980.601) (-978.736) [-977.925] (-980.806) * (-977.526) (-978.295) (-977.267) [-977.134] -- 0:00:32
      481500 -- [-978.647] (-980.954) (-976.485) (-978.247) * (-982.901) (-978.893) (-977.345) [-978.134] -- 0:00:32
      482000 -- (-976.287) (-981.569) [-980.730] (-978.614) * (-982.683) (-977.153) [-977.316] (-979.696) -- 0:00:32
      482500 -- (-982.851) (-977.474) (-978.593) [-978.083] * (-981.304) [-978.548] (-976.661) (-980.796) -- 0:00:32
      483000 -- (-978.441) (-977.983) (-977.028) [-977.855] * [-978.357] (-976.645) (-976.785) (-980.172) -- 0:00:32
      483500 -- [-977.700] (-977.075) (-978.145) (-976.388) * (-977.165) [-976.326] (-978.401) (-979.440) -- 0:00:32
      484000 -- (-977.180) [-977.718] (-981.817) (-977.134) * (-976.849) (-977.147) [-977.079] (-977.938) -- 0:00:31
      484500 -- (-977.964) (-978.951) [-979.587] (-977.207) * (-978.577) (-977.808) [-979.106] (-979.158) -- 0:00:31
      485000 -- (-977.391) (-978.824) (-979.373) [-977.281] * (-981.460) [-980.637] (-978.093) (-978.415) -- 0:00:31

      Average standard deviation of split frequencies: 0.013276

      485500 -- (-978.295) (-978.191) [-976.934] (-977.701) * [-984.292] (-977.340) (-978.051) (-977.424) -- 0:00:31
      486000 -- (-977.468) (-979.401) [-976.960] (-977.716) * (-978.579) (-978.674) [-978.340] (-977.120) -- 0:00:31
      486500 -- (-977.595) [-979.440] (-977.680) (-982.700) * (-979.094) (-979.550) [-976.477] (-980.203) -- 0:00:31
      487000 -- (-976.886) (-976.960) (-980.145) [-977.759] * (-976.662) (-978.687) (-980.132) [-976.296] -- 0:00:31
      487500 -- [-977.935] (-976.754) (-980.401) (-980.521) * (-980.608) (-978.866) [-977.857] (-978.166) -- 0:00:31
      488000 -- [-978.849] (-977.859) (-976.683) (-977.363) * (-983.067) [-977.907] (-982.742) (-979.197) -- 0:00:31
      488500 -- [-977.254] (-977.437) (-976.633) (-980.292) * (-980.407) (-977.262) (-980.692) [-977.343] -- 0:00:31
      489000 -- (-982.070) [-978.554] (-977.734) (-978.942) * [-978.498] (-977.657) (-980.227) (-981.347) -- 0:00:31
      489500 -- [-976.756] (-977.247) (-979.724) (-981.667) * [-977.363] (-980.386) (-979.202) (-981.878) -- 0:00:31
      490000 -- [-978.042] (-977.246) (-977.914) (-983.598) * (-976.488) [-978.333] (-977.227) (-979.998) -- 0:00:31

      Average standard deviation of split frequencies: 0.013090

      490500 -- [-977.943] (-976.564) (-976.891) (-980.947) * [-980.378] (-978.276) (-978.118) (-978.673) -- 0:00:31
      491000 -- [-977.641] (-976.666) (-975.873) (-977.408) * (-978.321) (-980.799) (-978.273) [-977.117] -- 0:00:31
      491500 -- (-981.057) (-977.057) [-975.873] (-980.095) * (-976.458) (-980.440) (-978.324) [-978.886] -- 0:00:31
      492000 -- (-984.313) [-977.732] (-977.951) (-981.133) * (-976.936) (-976.732) [-977.553] (-978.022) -- 0:00:30
      492500 -- (-978.158) (-983.957) [-977.371] (-978.259) * (-979.544) [-978.095] (-980.344) (-981.081) -- 0:00:30
      493000 -- [-978.005] (-986.049) (-976.174) (-977.299) * (-979.173) (-975.957) (-977.361) [-981.494] -- 0:00:30
      493500 -- [-983.581] (-980.830) (-977.689) (-977.850) * (-976.474) (-976.534) (-977.370) [-978.137] -- 0:00:30
      494000 -- (-977.836) (-977.986) [-978.114] (-980.110) * (-976.951) [-978.308] (-977.607) (-977.799) -- 0:00:31
      494500 -- [-978.221] (-978.437) (-977.752) (-978.189) * (-978.673) (-978.130) (-980.000) [-978.239] -- 0:00:31
      495000 -- [-979.729] (-979.139) (-976.386) (-983.273) * (-976.622) (-977.636) (-976.469) [-981.001] -- 0:00:31

      Average standard deviation of split frequencies: 0.012652

      495500 -- (-978.991) (-981.432) (-976.766) [-976.764] * (-980.237) (-978.420) [-978.550] (-977.843) -- 0:00:31
      496000 -- (-982.964) (-981.706) (-980.225) [-976.007] * (-981.632) (-976.582) (-982.015) [-977.466] -- 0:00:31
      496500 -- [-976.469] (-978.027) (-979.742) (-976.647) * [-977.225] (-976.578) (-977.328) (-977.757) -- 0:00:31
      497000 -- (-978.334) [-977.467] (-978.664) (-978.496) * [-975.908] (-976.322) (-978.827) (-977.115) -- 0:00:31
      497500 -- [-977.921] (-977.885) (-979.999) (-978.008) * (-978.204) (-976.709) [-978.519] (-980.647) -- 0:00:31
      498000 -- (-976.767) [-977.586] (-977.060) (-977.055) * (-979.660) (-976.496) (-976.354) [-977.598] -- 0:00:31
      498500 -- (-976.924) (-978.528) (-979.362) [-978.297] * (-977.250) (-976.483) [-983.101] (-980.552) -- 0:00:31
      499000 -- (-978.367) (-977.948) [-976.901] (-981.312) * (-978.655) [-976.600] (-981.627) (-977.001) -- 0:00:31
      499500 -- (-977.437) [-978.410] (-979.698) (-980.998) * (-978.946) [-977.014] (-977.466) (-980.013) -- 0:00:31
      500000 -- (-978.131) (-983.606) (-976.335) [-977.171] * (-979.649) (-977.178) (-977.919) [-978.218] -- 0:00:31

      Average standard deviation of split frequencies: 0.012742

      500500 -- (-979.757) [-978.448] (-976.946) (-977.314) * [-980.905] (-977.517) (-978.198) (-978.079) -- 0:00:30
      501000 -- [-979.236] (-977.156) (-979.256) (-976.245) * (-977.880) (-977.512) (-979.054) [-976.766] -- 0:00:30
      501500 -- (-979.769) [-976.519] (-980.564) (-977.763) * (-976.787) (-979.911) [-978.245] (-978.676) -- 0:00:30
      502000 -- [-978.193] (-978.003) (-977.208) (-976.596) * [-979.114] (-978.998) (-980.209) (-976.918) -- 0:00:30
      502500 -- (-977.349) (-977.854) [-976.751] (-976.997) * [-979.462] (-978.618) (-978.985) (-978.647) -- 0:00:30
      503000 -- (-977.030) (-977.792) (-977.460) [-976.868] * (-980.078) (-979.911) [-978.337] (-977.103) -- 0:00:30
      503500 -- [-977.398] (-978.256) (-976.661) (-979.132) * (-979.588) (-978.880) (-979.420) [-978.702] -- 0:00:30
      504000 -- (-979.872) (-979.600) [-976.795] (-981.632) * (-983.327) (-982.941) (-981.459) [-976.740] -- 0:00:30
      504500 -- [-982.567] (-977.564) (-981.346) (-982.421) * [-976.521] (-980.796) (-980.624) (-978.844) -- 0:00:30
      505000 -- (-980.885) (-983.676) [-976.218] (-980.853) * [-976.530] (-976.920) (-978.971) (-977.549) -- 0:00:30

      Average standard deviation of split frequencies: 0.012794

      505500 -- [-977.484] (-980.416) (-979.217) (-976.209) * [-976.111] (-978.648) (-977.113) (-977.384) -- 0:00:30
      506000 -- (-981.322) (-978.758) (-980.827) [-977.162] * (-977.738) [-979.119] (-976.632) (-978.166) -- 0:00:30
      506500 -- (-979.560) [-977.782] (-977.226) (-977.203) * (-980.702) (-979.528) [-976.460] (-981.787) -- 0:00:30
      507000 -- [-977.567] (-978.016) (-977.011) (-977.338) * (-978.512) [-979.308] (-978.972) (-977.727) -- 0:00:30
      507500 -- [-976.520] (-976.592) (-976.904) (-976.547) * [-978.709] (-977.109) (-981.892) (-978.447) -- 0:00:30
      508000 -- (-976.444) (-979.533) (-976.807) [-976.748] * (-975.969) [-977.426] (-980.403) (-976.746) -- 0:00:30
      508500 -- (-977.213) (-979.571) (-978.877) [-976.953] * [-976.730] (-978.392) (-977.224) (-976.661) -- 0:00:29
      509000 -- (-977.329) [-977.962] (-976.762) (-978.453) * [-980.541] (-978.152) (-977.973) (-978.706) -- 0:00:29
      509500 -- (-976.946) (-978.070) [-977.206] (-977.999) * (-978.550) (-982.343) [-977.777] (-977.243) -- 0:00:29
      510000 -- (-978.664) (-978.241) [-980.154] (-978.297) * (-978.517) [-978.258] (-978.010) (-984.250) -- 0:00:30

      Average standard deviation of split frequencies: 0.012801

      510500 -- (-979.106) (-978.037) (-978.318) [-977.695] * [-980.811] (-977.706) (-978.442) (-980.274) -- 0:00:30
      511000 -- [-980.931] (-978.774) (-977.493) (-979.195) * (-977.980) [-978.420] (-978.135) (-978.105) -- 0:00:30
      511500 -- (-987.859) (-976.579) [-976.750] (-980.437) * (-978.869) (-977.304) [-980.094] (-977.106) -- 0:00:30
      512000 -- (-981.266) (-979.380) [-977.349] (-982.271) * [-978.690] (-980.260) (-979.733) (-977.305) -- 0:00:30
      512500 -- [-978.295] (-977.835) (-980.948) (-981.154) * (-976.959) [-977.513] (-977.648) (-978.875) -- 0:00:30
      513000 -- [-978.880] (-980.455) (-977.073) (-977.837) * (-979.361) (-977.702) (-979.188) [-978.573] -- 0:00:30
      513500 -- (-978.522) (-977.631) [-982.288] (-977.326) * (-980.059) (-978.633) (-980.922) [-978.253] -- 0:00:30
      514000 -- (-981.000) (-977.509) (-976.397) [-978.302] * (-978.335) (-979.970) [-976.697] (-980.573) -- 0:00:30
      514500 -- (-976.392) [-978.079] (-976.246) (-977.319) * (-977.451) [-976.537] (-978.885) (-977.772) -- 0:00:30
      515000 -- [-976.982] (-978.945) (-978.308) (-980.030) * (-977.182) [-978.076] (-976.582) (-978.421) -- 0:00:30

      Average standard deviation of split frequencies: 0.012607

      515500 -- [-977.098] (-978.620) (-978.965) (-978.999) * (-977.182) (-976.287) [-976.583] (-977.087) -- 0:00:30
      516000 -- [-976.240] (-980.507) (-978.241) (-978.243) * [-980.760] (-977.080) (-978.418) (-979.008) -- 0:00:30
      516500 -- (-976.947) (-976.925) (-980.701) [-982.694] * (-976.461) (-981.605) [-979.071] (-982.847) -- 0:00:29
      517000 -- [-978.919] (-976.474) (-980.200) (-976.717) * (-977.775) (-978.067) [-976.108] (-978.012) -- 0:00:29
      517500 -- (-981.086) (-978.279) (-977.988) [-978.078] * (-979.105) [-979.162] (-980.583) (-978.186) -- 0:00:29
      518000 -- [-978.467] (-978.111) (-977.116) (-978.433) * (-983.440) (-980.072) [-978.562] (-977.637) -- 0:00:29
      518500 -- (-980.044) (-983.461) [-978.516] (-977.399) * (-976.489) [-978.628] (-978.700) (-978.720) -- 0:00:29
      519000 -- (-980.860) (-977.915) [-978.172] (-981.782) * (-980.593) (-976.996) [-978.363] (-980.383) -- 0:00:29
      519500 -- [-981.036] (-976.858) (-979.391) (-980.418) * (-980.153) (-976.876) (-979.234) [-980.499] -- 0:00:29
      520000 -- (-976.256) (-975.808) (-979.892) [-978.723] * (-978.186) [-976.494] (-978.861) (-980.856) -- 0:00:29

      Average standard deviation of split frequencies: 0.013339

      520500 -- [-979.863] (-976.765) (-977.021) (-978.186) * (-977.296) (-976.541) (-979.414) [-977.685] -- 0:00:29
      521000 -- (-980.965) (-977.546) [-978.937] (-978.193) * (-976.662) [-976.919] (-979.606) (-978.339) -- 0:00:29
      521500 -- (-979.784) [-980.065] (-984.950) (-981.764) * [-977.954] (-977.872) (-976.211) (-977.312) -- 0:00:29
      522000 -- (-976.035) (-976.191) [-976.939] (-981.076) * (-979.958) (-977.162) (-976.815) [-977.018] -- 0:00:29
      522500 -- [-977.803] (-977.265) (-979.157) (-976.826) * (-978.408) [-977.705] (-978.979) (-979.379) -- 0:00:29
      523000 -- (-978.265) [-979.620] (-977.421) (-978.685) * (-978.109) (-976.812) (-978.831) [-978.696] -- 0:00:29
      523500 -- [-978.256] (-978.578) (-977.211) (-977.439) * (-980.493) [-976.705] (-979.313) (-979.381) -- 0:00:29
      524000 -- [-978.257] (-976.254) (-977.460) (-979.719) * (-977.132) (-976.296) (-978.329) [-976.147] -- 0:00:29
      524500 -- [-977.797] (-978.053) (-977.499) (-978.846) * (-983.139) [-976.190] (-977.892) (-977.230) -- 0:00:29
      525000 -- [-979.829] (-978.368) (-979.715) (-978.132) * (-978.723) [-978.637] (-976.769) (-981.863) -- 0:00:28

      Average standard deviation of split frequencies: 0.012607

      525500 -- (-978.086) (-977.450) (-978.690) [-979.283] * (-977.642) [-980.254] (-978.669) (-980.154) -- 0:00:28
      526000 -- (-979.020) (-977.002) (-978.854) [-979.330] * (-976.885) [-977.145] (-979.033) (-977.997) -- 0:00:29
      526500 -- (-977.255) (-977.673) [-977.664] (-979.575) * (-980.675) [-977.082] (-978.221) (-980.968) -- 0:00:29
      527000 -- (-978.512) (-979.676) [-978.121] (-978.689) * [-978.416] (-977.275) (-978.923) (-977.930) -- 0:00:29
      527500 -- [-976.316] (-979.432) (-982.389) (-983.550) * [-978.767] (-977.352) (-978.883) (-979.034) -- 0:00:29
      528000 -- [-979.219] (-978.629) (-977.716) (-981.646) * (-977.672) (-978.003) (-978.087) [-978.304] -- 0:00:29
      528500 -- (-976.406) (-977.974) [-977.200] (-979.594) * [-980.104] (-978.188) (-978.398) (-977.438) -- 0:00:29
      529000 -- (-976.174) [-977.259] (-984.818) (-980.251) * (-978.404) (-977.849) [-978.717] (-982.866) -- 0:00:29
      529500 -- [-976.466] (-980.588) (-988.581) (-977.652) * (-977.760) (-978.384) (-979.160) [-977.361] -- 0:00:29
      530000 -- (-979.083) (-976.757) (-984.883) [-978.673] * (-977.390) [-978.894] (-976.967) (-978.144) -- 0:00:29

      Average standard deviation of split frequencies: 0.012673

      530500 -- (-978.853) [-977.801] (-988.635) (-980.854) * (-977.513) [-978.237] (-977.585) (-977.902) -- 0:00:29
      531000 -- [-979.653] (-978.033) (-984.088) (-977.149) * (-977.831) [-977.858] (-976.480) (-980.053) -- 0:00:29
      531500 -- (-983.750) (-979.717) [-977.493] (-978.873) * [-983.310] (-977.352) (-978.573) (-978.164) -- 0:00:29
      532000 -- (-986.210) (-978.918) (-979.160) [-979.318] * (-979.467) (-979.051) (-977.129) [-976.166] -- 0:00:29
      532500 -- (-980.308) [-978.685] (-977.524) (-979.359) * (-979.617) (-977.921) [-976.921] (-976.969) -- 0:00:28
      533000 -- (-980.213) [-976.729] (-976.873) (-977.717) * (-981.200) (-977.179) [-977.161] (-977.095) -- 0:00:28
      533500 -- (-978.417) (-978.729) [-977.032] (-978.008) * (-978.589) (-981.065) [-977.704] (-980.069) -- 0:00:28
      534000 -- [-977.430] (-981.812) (-976.735) (-981.304) * [-977.896] (-977.634) (-977.868) (-978.140) -- 0:00:28
      534500 -- [-979.428] (-978.008) (-980.815) (-980.300) * (-977.510) (-977.150) (-978.466) [-977.426] -- 0:00:28
      535000 -- (-978.606) [-977.626] (-979.102) (-983.223) * (-980.830) (-976.395) (-978.100) [-978.365] -- 0:00:28

      Average standard deviation of split frequencies: 0.013134

      535500 -- [-979.018] (-978.219) (-978.965) (-978.825) * [-978.832] (-977.012) (-976.504) (-978.297) -- 0:00:28
      536000 -- (-977.018) (-978.467) [-978.806] (-979.272) * (-978.698) (-976.887) (-979.765) [-977.607] -- 0:00:28
      536500 -- (-984.560) (-981.974) [-977.699] (-977.212) * (-979.630) (-977.117) [-978.971] (-979.587) -- 0:00:28
      537000 -- [-976.684] (-979.070) (-977.396) (-976.930) * (-981.875) (-978.168) [-980.311] (-979.732) -- 0:00:28
      537500 -- [-979.088] (-977.079) (-977.523) (-977.029) * (-977.973) (-977.937) [-982.883] (-978.013) -- 0:00:28
      538000 -- (-977.849) (-977.753) (-976.601) [-979.534] * (-976.633) [-979.601] (-978.107) (-982.063) -- 0:00:28
      538500 -- (-984.893) [-979.406] (-976.208) (-977.327) * (-976.158) (-978.031) (-977.117) [-979.101] -- 0:00:28
      539000 -- (-977.343) [-981.605] (-976.731) (-976.933) * [-977.875] (-983.311) (-978.116) (-979.640) -- 0:00:28
      539500 -- (-976.923) (-976.853) (-977.218) [-977.343] * (-978.242) (-978.181) [-976.711] (-977.945) -- 0:00:28
      540000 -- (-976.457) (-976.021) [-978.185] (-977.780) * (-980.435) (-978.100) (-977.494) [-977.539] -- 0:00:28

      Average standard deviation of split frequencies: 0.013137

      540500 -- (-976.637) (-982.359) [-977.458] (-976.953) * (-980.843) [-977.513] (-977.449) (-981.418) -- 0:00:28
      541000 -- (-983.525) [-981.723] (-977.257) (-981.499) * [-982.944] (-977.952) (-977.702) (-980.147) -- 0:00:27
      541500 -- (-979.318) (-978.896) [-978.823] (-977.965) * (-976.304) (-981.584) [-978.193] (-977.428) -- 0:00:27
      542000 -- [-978.210] (-976.945) (-977.701) (-981.670) * (-979.223) (-980.266) [-977.162] (-980.739) -- 0:00:28
      542500 -- (-976.929) [-977.889] (-978.185) (-980.174) * (-977.550) (-979.878) (-978.066) [-979.513] -- 0:00:28
      543000 -- [-978.352] (-979.057) (-980.157) (-977.550) * (-977.499) (-980.713) (-976.736) [-976.548] -- 0:00:28
      543500 -- [-980.120] (-979.501) (-980.011) (-979.824) * (-979.171) (-976.665) (-977.717) [-976.647] -- 0:00:28
      544000 -- (-977.193) (-978.021) (-980.485) [-976.888] * (-976.677) (-977.844) (-978.018) [-976.997] -- 0:00:28
      544500 -- (-977.421) (-977.478) [-983.117] (-977.121) * (-980.514) (-981.561) (-978.617) [-976.771] -- 0:00:28
      545000 -- (-978.414) (-981.851) [-976.299] (-977.052) * (-980.668) (-979.596) [-977.993] (-976.930) -- 0:00:28

      Average standard deviation of split frequencies: 0.012548

      545500 -- [-978.624] (-984.054) (-976.624) (-976.174) * (-978.435) (-980.157) (-982.743) [-985.000] -- 0:00:28
      546000 -- (-980.448) (-979.731) (-978.075) [-975.882] * [-979.813] (-979.032) (-981.565) (-978.678) -- 0:00:28
      546500 -- (-984.534) (-980.805) (-977.094) [-976.573] * (-980.334) [-978.649] (-979.727) (-981.597) -- 0:00:28
      547000 -- [-980.803] (-982.562) (-977.312) (-977.578) * [-977.397] (-981.803) (-978.169) (-979.767) -- 0:00:28
      547500 -- (-979.203) [-980.499] (-976.461) (-977.910) * (-981.946) (-981.509) [-977.427] (-977.220) -- 0:00:28
      548000 -- [-977.740] (-979.529) (-978.929) (-979.872) * (-978.336) [-978.622] (-980.616) (-979.169) -- 0:00:28
      548500 -- (-980.145) [-978.293] (-976.828) (-979.500) * (-980.811) [-977.630] (-977.773) (-979.190) -- 0:00:27
      549000 -- (-977.687) [-979.008] (-982.657) (-976.399) * (-978.984) (-980.759) [-977.082] (-977.964) -- 0:00:27
      549500 -- (-980.174) [-978.371] (-979.496) (-976.750) * (-978.621) (-981.054) (-978.780) [-979.054] -- 0:00:27
      550000 -- (-977.433) (-978.119) (-977.695) [-977.203] * (-982.097) [-979.569] (-983.879) (-977.209) -- 0:00:27

      Average standard deviation of split frequencies: 0.012156

      550500 -- (-977.387) (-979.455) [-977.554] (-976.792) * (-979.294) (-980.101) (-977.939) [-984.508] -- 0:00:27
      551000 -- (-978.392) (-982.964) [-977.564] (-979.868) * (-978.790) [-978.565] (-977.341) (-977.698) -- 0:00:27
      551500 -- (-979.155) [-980.667] (-987.713) (-976.217) * (-979.052) (-976.792) (-977.841) [-978.546] -- 0:00:27
      552000 -- (-981.225) (-976.597) (-978.411) [-976.712] * (-977.601) (-978.857) [-979.240] (-980.194) -- 0:00:27
      552500 -- (-980.775) [-978.017] (-978.134) (-987.096) * (-980.094) (-979.486) [-977.268] (-979.149) -- 0:00:27
      553000 -- (-977.840) (-977.254) [-978.569] (-981.234) * (-983.045) (-977.667) [-976.750] (-979.884) -- 0:00:27
      553500 -- [-977.565] (-977.174) (-977.679) (-978.492) * (-978.062) (-978.327) (-979.001) [-976.805] -- 0:00:27
      554000 -- [-976.721] (-978.663) (-983.199) (-978.862) * (-977.085) [-979.975] (-978.930) (-978.781) -- 0:00:27
      554500 -- [-977.608] (-977.866) (-980.056) (-977.688) * (-977.598) (-976.051) (-979.354) [-977.484] -- 0:00:27
      555000 -- (-978.500) (-981.169) (-978.495) [-979.148] * (-982.356) [-977.425] (-978.510) (-978.828) -- 0:00:27

      Average standard deviation of split frequencies: 0.011022

      555500 -- [-982.285] (-980.144) (-977.526) (-983.002) * (-977.894) (-978.591) (-977.297) [-977.813] -- 0:00:27
      556000 -- (-977.923) (-979.363) [-978.969] (-978.000) * (-981.226) [-980.450] (-979.699) (-977.561) -- 0:00:27
      556500 -- (-977.092) (-983.129) [-977.760] (-981.375) * (-980.949) (-978.932) (-983.504) [-977.186] -- 0:00:27
      557000 -- (-977.761) [-980.791] (-977.383) (-981.784) * (-977.503) (-979.140) (-980.998) [-976.311] -- 0:00:27
      557500 -- (-976.698) (-977.043) [-978.938] (-983.403) * [-977.361] (-981.350) (-976.903) (-977.691) -- 0:00:27
      558000 -- (-979.000) (-978.503) [-979.670] (-979.557) * (-977.924) (-978.580) [-980.795] (-977.045) -- 0:00:27
      558500 -- (-979.423) (-979.617) (-977.690) [-977.697] * (-976.220) (-976.370) [-977.796] (-981.699) -- 0:00:27
      559000 -- (-979.169) (-976.872) [-977.718] (-978.793) * (-982.754) [-978.102] (-978.140) (-982.411) -- 0:00:27
      559500 -- (-980.615) (-977.012) [-977.276] (-978.844) * [-977.132] (-977.746) (-978.979) (-979.552) -- 0:00:27
      560000 -- [-982.833] (-979.073) (-982.496) (-978.727) * (-979.728) (-979.850) [-976.148] (-978.982) -- 0:00:27

      Average standard deviation of split frequencies: 0.011715

      560500 -- (-976.600) [-977.285] (-984.043) (-982.579) * (-984.602) (-980.298) [-978.145] (-977.533) -- 0:00:27
      561000 -- (-976.084) (-976.689) (-977.416) [-976.006] * (-980.005) (-980.036) [-981.633] (-977.457) -- 0:00:27
      561500 -- (-977.124) (-976.294) (-978.908) [-977.633] * [-977.502] (-978.784) (-978.839) (-978.494) -- 0:00:27
      562000 -- (-978.048) (-980.442) (-977.810) [-980.115] * (-981.365) [-980.723] (-980.327) (-976.364) -- 0:00:27
      562500 -- (-977.698) (-980.158) [-978.653] (-985.697) * (-985.033) [-976.885] (-978.242) (-978.748) -- 0:00:27
      563000 -- (-977.301) (-979.623) [-977.631] (-978.758) * (-976.894) (-976.602) [-976.866] (-976.602) -- 0:00:27
      563500 -- (-977.168) (-978.291) (-976.340) [-978.468] * [-979.324] (-977.483) (-976.776) (-977.484) -- 0:00:27
      564000 -- (-977.244) (-977.070) [-977.417] (-976.661) * (-976.917) (-978.738) [-977.654] (-977.203) -- 0:00:27
      564500 -- (-976.377) [-978.500] (-977.855) (-976.669) * (-976.630) (-976.350) [-976.222] (-979.558) -- 0:00:27
      565000 -- (-976.936) (-979.503) (-976.589) [-979.515] * [-979.458] (-976.333) (-976.315) (-979.541) -- 0:00:26

      Average standard deviation of split frequencies: 0.011272

      565500 -- (-980.335) (-977.694) (-980.351) [-980.412] * (-976.513) [-977.044] (-976.690) (-976.376) -- 0:00:26
      566000 -- (-978.498) [-978.320] (-981.124) (-977.215) * (-980.965) [-980.952] (-983.244) (-978.628) -- 0:00:26
      566500 -- [-978.460] (-976.801) (-979.795) (-977.231) * [-979.219] (-979.027) (-985.030) (-978.433) -- 0:00:26
      567000 -- (-978.278) (-977.098) (-978.201) [-976.195] * (-977.824) (-976.291) (-978.321) [-978.106] -- 0:00:26
      567500 -- (-976.906) (-977.320) (-978.288) [-977.974] * (-976.989) (-977.530) (-979.245) [-977.119] -- 0:00:26
      568000 -- (-977.802) (-979.153) [-980.008] (-978.665) * (-977.545) (-976.784) [-980.588] (-979.401) -- 0:00:26
      568500 -- (-977.797) (-979.550) (-981.651) [-978.043] * (-979.931) [-976.944] (-978.425) (-981.056) -- 0:00:26
      569000 -- (-979.926) [-978.494] (-982.342) (-977.872) * (-979.714) (-977.212) [-978.500] (-978.034) -- 0:00:26
      569500 -- (-980.636) (-982.499) (-979.191) [-980.307] * (-977.580) (-976.342) [-980.223] (-980.122) -- 0:00:26
      570000 -- (-977.710) (-977.846) (-986.906) [-978.562] * (-980.233) (-977.745) [-977.429] (-978.829) -- 0:00:26

      Average standard deviation of split frequencies: 0.010849

      570500 -- (-978.074) (-984.523) (-978.591) [-976.801] * (-976.906) [-980.069] (-980.139) (-976.415) -- 0:00:26
      571000 -- (-978.197) (-977.764) (-979.837) [-977.640] * (-978.234) (-976.879) (-980.827) [-977.656] -- 0:00:26
      571500 -- (-980.142) (-979.530) [-978.493] (-977.829) * (-981.999) (-977.158) (-980.874) [-976.205] -- 0:00:26
      572000 -- [-980.368] (-976.766) (-980.057) (-978.566) * (-978.639) (-977.369) (-976.456) [-977.128] -- 0:00:26
      572500 -- [-980.184] (-977.280) (-976.031) (-977.845) * (-980.094) (-979.811) [-977.471] (-980.726) -- 0:00:26
      573000 -- (-978.275) (-978.067) [-976.962] (-976.197) * (-978.768) (-977.039) [-977.045] (-979.424) -- 0:00:26
      573500 -- [-976.965] (-975.776) (-976.399) (-977.815) * [-979.039] (-977.615) (-976.149) (-977.843) -- 0:00:26
      574000 -- [-979.018] (-977.857) (-977.004) (-976.808) * (-976.697) (-977.989) (-978.897) [-977.058] -- 0:00:26
      574500 -- (-980.400) (-976.496) (-979.565) [-978.051] * (-976.947) [-977.723] (-980.847) (-977.475) -- 0:00:26
      575000 -- (-977.440) (-976.401) [-979.808] (-982.257) * (-977.716) (-977.640) [-980.297] (-978.500) -- 0:00:26

      Average standard deviation of split frequencies: 0.010148

      575500 -- (-979.780) (-977.493) [-980.701] (-978.092) * (-979.766) [-977.726] (-977.023) (-976.568) -- 0:00:26
      576000 -- (-977.660) [-979.388] (-980.893) (-978.197) * (-981.707) (-978.962) (-976.685) [-978.071] -- 0:00:26
      576500 -- (-977.235) [-978.913] (-980.792) (-979.070) * (-983.842) [-979.411] (-978.700) (-983.651) -- 0:00:26
      577000 -- [-978.778] (-977.801) (-981.241) (-981.059) * (-981.579) (-978.578) (-977.223) [-981.156] -- 0:00:26
      577500 -- (-976.663) (-980.463) [-979.291] (-981.964) * (-978.327) [-976.893] (-978.139) (-981.438) -- 0:00:26
      578000 -- (-977.179) [-978.127] (-979.226) (-983.204) * [-976.843] (-979.735) (-978.546) (-979.807) -- 0:00:26
      578500 -- (-977.956) [-976.930] (-978.589) (-977.196) * (-977.958) (-978.647) (-978.450) [-978.023] -- 0:00:26
      579000 -- (-979.590) (-981.708) (-976.989) [-977.237] * (-980.204) [-979.839] (-979.763) (-977.827) -- 0:00:26
      579500 -- (-977.371) (-977.620) [-979.383] (-980.966) * (-977.869) [-977.205] (-977.545) (-978.043) -- 0:00:26
      580000 -- (-977.618) [-976.681] (-977.896) (-980.490) * (-976.146) (-977.369) (-978.478) [-981.347] -- 0:00:26

      Average standard deviation of split frequencies: 0.010283

      580500 -- (-981.723) (-977.576) [-978.418] (-979.105) * (-976.105) (-978.439) [-977.341] (-981.475) -- 0:00:26
      581000 -- [-976.916] (-978.622) (-979.374) (-978.966) * (-981.047) (-980.421) [-980.211] (-981.143) -- 0:00:25
      581500 -- (-976.991) (-977.318) [-976.682] (-981.453) * (-976.776) [-977.243] (-978.226) (-981.363) -- 0:00:25
      582000 -- [-977.610] (-976.592) (-977.042) (-981.881) * (-975.907) [-978.579] (-978.239) (-980.309) -- 0:00:25
      582500 -- (-980.108) [-978.677] (-976.621) (-977.435) * (-975.900) (-980.276) [-978.174] (-979.161) -- 0:00:25
      583000 -- (-977.927) (-980.213) (-977.744) [-977.933] * (-976.586) (-980.715) (-978.143) [-977.014] -- 0:00:25
      583500 -- (-980.156) [-978.514] (-979.777) (-977.703) * (-977.568) [-979.210] (-979.403) (-979.883) -- 0:00:25
      584000 -- (-976.925) (-978.779) [-977.370] (-979.732) * [-977.760] (-983.259) (-978.048) (-983.275) -- 0:00:25
      584500 -- (-977.667) (-980.124) [-976.870] (-985.909) * (-979.923) [-977.806] (-982.101) (-981.140) -- 0:00:25
      585000 -- (-976.358) [-979.060] (-977.255) (-977.397) * [-978.333] (-978.147) (-982.523) (-982.102) -- 0:00:25

      Average standard deviation of split frequencies: 0.010257

      585500 -- (-978.759) (-979.355) [-977.669] (-978.551) * [-980.577] (-977.168) (-978.851) (-979.277) -- 0:00:25
      586000 -- (-979.192) (-978.710) (-977.774) [-978.389] * (-978.679) (-978.293) (-983.214) [-979.184] -- 0:00:25
      586500 -- (-981.707) (-979.383) (-979.478) [-979.308] * (-979.885) (-978.473) [-980.276] (-980.674) -- 0:00:25
      587000 -- (-980.011) (-977.867) (-977.559) [-978.436] * (-980.133) [-979.203] (-979.101) (-980.490) -- 0:00:25
      587500 -- (-979.010) [-976.966] (-981.875) (-977.500) * (-976.576) (-978.656) (-979.415) [-978.913] -- 0:00:25
      588000 -- [-977.473] (-980.516) (-979.504) (-978.424) * (-976.473) (-979.002) (-980.442) [-978.943] -- 0:00:25
      588500 -- [-979.335] (-978.477) (-978.625) (-976.127) * (-976.504) (-978.900) [-984.196] (-977.550) -- 0:00:25
      589000 -- (-976.754) [-979.687] (-976.676) (-977.840) * (-976.377) (-979.455) [-977.557] (-976.967) -- 0:00:25
      589500 -- (-978.020) [-983.150] (-980.185) (-978.165) * (-979.148) (-978.178) (-978.296) [-980.586] -- 0:00:25
      590000 -- [-976.472] (-979.844) (-980.912) (-979.106) * (-977.690) (-978.632) [-977.320] (-976.842) -- 0:00:25

      Average standard deviation of split frequencies: 0.009417

      590500 -- (-986.784) [-977.933] (-979.718) (-980.652) * [-976.823] (-979.393) (-980.468) (-979.430) -- 0:00:25
      591000 -- (-985.087) [-977.042] (-977.345) (-981.840) * [-977.792] (-982.959) (-977.900) (-976.869) -- 0:00:25
      591500 -- [-980.411] (-977.311) (-977.852) (-978.798) * (-977.397) [-978.021] (-977.954) (-980.223) -- 0:00:25
      592000 -- [-976.923] (-978.492) (-976.362) (-976.284) * (-981.131) [-978.885] (-978.076) (-976.377) -- 0:00:25
      592500 -- [-979.342] (-977.485) (-978.006) (-977.496) * (-982.604) [-977.693] (-976.642) (-982.065) -- 0:00:25
      593000 -- (-977.516) (-979.953) (-979.552) [-979.256] * (-978.212) (-979.145) [-977.181] (-979.529) -- 0:00:25
      593500 -- (-977.082) [-980.767] (-978.918) (-979.843) * [-976.541] (-976.320) (-979.641) (-977.631) -- 0:00:25
      594000 -- (-981.031) (-978.640) [-977.682] (-976.357) * (-976.742) [-977.073] (-979.021) (-977.635) -- 0:00:25
      594500 -- [-976.825] (-978.517) (-981.629) (-977.190) * [-976.422] (-976.639) (-979.516) (-977.511) -- 0:00:25
      595000 -- (-976.763) (-979.040) [-977.980] (-976.502) * (-976.646) (-981.154) [-978.271] (-977.723) -- 0:00:25

      Average standard deviation of split frequencies: 0.010035

      595500 -- (-978.913) (-979.174) [-979.121] (-976.813) * (-980.820) (-977.582) (-978.027) [-978.668] -- 0:00:25
      596000 -- (-976.960) [-976.844] (-978.328) (-977.221) * (-978.906) [-978.040] (-981.063) (-980.074) -- 0:00:25
      596500 -- [-977.761] (-979.711) (-977.732) (-980.241) * (-981.734) (-977.600) (-979.990) [-982.827] -- 0:00:25
      597000 -- (-978.074) (-976.269) (-977.346) [-977.241] * (-980.302) (-980.138) (-983.441) [-977.761] -- 0:00:24
      597500 -- [-977.619] (-976.989) (-976.800) (-976.364) * [-977.753] (-978.159) (-978.632) (-980.435) -- 0:00:24
      598000 -- (-983.103) (-980.567) (-980.908) [-978.126] * (-976.884) (-978.648) [-981.810] (-979.411) -- 0:00:24
      598500 -- (-978.651) (-979.622) (-980.929) [-979.611] * (-980.032) (-981.474) (-983.018) [-976.301] -- 0:00:24
      599000 -- (-978.694) (-979.676) (-982.648) [-976.333] * (-980.114) [-976.319] (-977.581) (-981.368) -- 0:00:24
      599500 -- (-977.707) (-983.909) (-978.888) [-978.305] * [-981.065] (-979.295) (-977.846) (-980.181) -- 0:00:24
      600000 -- (-976.848) (-978.568) [-978.076] (-982.098) * (-982.063) [-983.445] (-982.450) (-976.803) -- 0:00:24

      Average standard deviation of split frequencies: 0.009261

      600500 -- (-978.992) (-979.548) [-978.856] (-977.871) * (-976.811) [-978.884] (-977.444) (-985.003) -- 0:00:24
      601000 -- [-979.503] (-980.566) (-979.911) (-977.793) * [-977.658] (-980.356) (-986.202) (-977.077) -- 0:00:24
      601500 -- (-981.142) [-977.632] (-977.916) (-977.223) * (-983.746) [-976.807] (-979.143) (-978.165) -- 0:00:24
      602000 -- [-976.736] (-978.753) (-978.115) (-978.500) * (-983.459) (-981.949) [-980.201] (-980.215) -- 0:00:24
      602500 -- (-979.311) [-978.746] (-979.757) (-980.742) * [-976.786] (-978.819) (-979.830) (-978.321) -- 0:00:24
      603000 -- (-979.226) (-983.144) (-979.873) [-977.676] * (-986.037) [-979.505] (-979.736) (-978.358) -- 0:00:24
      603500 -- [-976.719] (-985.406) (-977.220) (-984.309) * (-977.583) (-976.510) [-976.188] (-979.450) -- 0:00:24
      604000 -- (-976.452) (-987.288) (-976.674) [-978.866] * [-976.121] (-977.962) (-977.235) (-976.430) -- 0:00:24
      604500 -- [-978.033] (-976.783) (-976.314) (-978.193) * (-977.197) [-980.336] (-977.375) (-978.959) -- 0:00:24
      605000 -- (-976.859) [-979.327] (-977.875) (-980.593) * (-978.463) (-979.272) [-980.249] (-981.843) -- 0:00:24

      Average standard deviation of split frequencies: 0.009140

      605500 -- (-976.136) (-978.535) [-978.711] (-978.027) * (-976.115) (-979.916) [-976.435] (-978.886) -- 0:00:24
      606000 -- (-979.986) (-977.389) [-976.383] (-976.032) * (-977.624) (-977.737) (-978.464) [-976.564] -- 0:00:24
      606500 -- (-979.337) (-978.035) (-978.116) [-976.182] * (-976.971) [-977.144] (-977.211) (-981.571) -- 0:00:24
      607000 -- [-980.648] (-979.191) (-978.312) (-979.948) * (-977.273) (-978.055) [-979.903] (-983.543) -- 0:00:24
      607500 -- (-983.713) (-977.205) (-977.611) [-979.204] * (-977.727) (-980.172) [-980.804] (-978.752) -- 0:00:24
      608000 -- (-978.974) (-982.509) (-977.624) [-980.073] * (-979.189) (-978.865) (-980.312) [-977.203] -- 0:00:24
      608500 -- [-977.685] (-980.623) (-976.219) (-979.195) * (-977.589) (-977.477) (-981.644) [-976.765] -- 0:00:24
      609000 -- [-981.033] (-984.896) (-980.839) (-979.827) * (-976.502) (-981.074) [-977.181] (-981.289) -- 0:00:24
      609500 -- (-979.077) [-980.115] (-976.817) (-978.000) * (-978.524) (-980.385) (-977.203) [-979.036] -- 0:00:24
      610000 -- (-978.150) [-977.693] (-978.779) (-981.539) * (-980.508) (-980.328) [-978.193] (-978.771) -- 0:00:24

      Average standard deviation of split frequencies: 0.009006

      610500 -- (-977.804) [-977.270] (-981.864) (-976.727) * (-977.201) (-981.768) [-977.120] (-980.951) -- 0:00:24
      611000 -- (-979.416) [-978.092] (-980.052) (-978.302) * (-977.004) (-981.144) [-978.469] (-977.956) -- 0:00:24
      611500 -- (-977.353) (-976.715) (-984.681) [-979.346] * (-979.413) [-978.528] (-977.509) (-976.299) -- 0:00:24
      612000 -- [-978.311] (-979.107) (-979.258) (-978.023) * (-981.117) [-978.122] (-977.589) (-980.711) -- 0:00:24
      612500 -- (-978.244) [-980.913] (-980.868) (-979.407) * (-977.727) (-980.337) (-979.541) [-977.745] -- 0:00:24
      613000 -- [-978.303] (-979.904) (-979.358) (-979.593) * (-977.309) (-976.165) [-977.877] (-978.253) -- 0:00:23
      613500 -- [-978.471] (-979.080) (-982.963) (-977.070) * (-978.329) (-976.942) [-976.230] (-977.597) -- 0:00:23
      614000 -- [-977.550] (-978.658) (-981.061) (-979.512) * (-980.014) [-977.832] (-977.145) (-978.153) -- 0:00:23
      614500 -- [-977.308] (-978.559) (-981.434) (-977.372) * (-978.483) (-978.852) (-979.887) [-976.450] -- 0:00:23
      615000 -- (-979.129) (-976.403) [-977.367] (-978.278) * (-977.695) [-979.654] (-977.712) (-976.953) -- 0:00:23

      Average standard deviation of split frequencies: 0.009438

      615500 -- (-980.159) (-976.787) [-980.372] (-977.878) * (-976.231) (-977.543) (-979.641) [-977.110] -- 0:00:23
      616000 -- (-978.421) (-977.335) (-977.998) [-978.681] * (-978.190) (-977.429) (-977.104) [-976.583] -- 0:00:23
      616500 -- (-978.326) [-978.615] (-980.595) (-976.886) * (-979.545) [-978.497] (-976.483) (-979.605) -- 0:00:23
      617000 -- [-979.347] (-977.019) (-979.219) (-977.986) * (-977.005) (-979.916) [-978.336] (-978.223) -- 0:00:23
      617500 -- (-977.092) [-980.023] (-977.135) (-977.986) * (-977.581) [-979.666] (-977.669) (-977.914) -- 0:00:23
      618000 -- (-977.929) (-977.016) (-979.922) [-976.280] * (-980.209) [-983.488] (-978.310) (-977.021) -- 0:00:23
      618500 -- (-977.993) (-976.851) [-977.432] (-978.307) * [-980.831] (-978.061) (-980.905) (-978.535) -- 0:00:23
      619000 -- (-984.054) (-979.637) (-976.504) [-976.278] * [-977.938] (-977.907) (-978.866) (-977.840) -- 0:00:23
      619500 -- (-977.413) (-980.639) (-977.126) [-978.821] * (-977.422) [-976.506] (-978.477) (-977.150) -- 0:00:23
      620000 -- (-979.950) (-978.804) (-977.084) [-977.494] * (-977.540) (-982.861) (-981.973) [-978.242] -- 0:00:23

      Average standard deviation of split frequencies: 0.009367

      620500 -- [-979.062] (-977.718) (-978.017) (-977.897) * (-981.371) (-979.125) [-976.800] (-978.518) -- 0:00:23
      621000 -- (-977.990) (-977.160) [-977.198] (-976.771) * (-980.332) [-978.927] (-977.369) (-979.368) -- 0:00:23
      621500 -- (-979.245) [-977.739] (-978.978) (-981.772) * (-979.191) [-979.095] (-977.788) (-975.997) -- 0:00:23
      622000 -- (-979.357) (-980.382) (-978.441) [-978.138] * (-978.310) (-978.578) [-976.477] (-976.361) -- 0:00:23
      622500 -- (-976.868) (-978.557) (-978.884) [-977.574] * [-978.585] (-977.506) (-978.200) (-979.823) -- 0:00:23
      623000 -- (-978.014) (-981.262) (-987.637) [-977.028] * (-978.885) (-976.009) [-976.630] (-979.249) -- 0:00:23
      623500 -- [-976.744] (-978.409) (-980.621) (-977.609) * (-980.134) (-979.799) [-977.653] (-978.933) -- 0:00:23
      624000 -- (-976.808) (-978.399) [-977.510] (-979.644) * (-980.394) [-976.892] (-986.837) (-977.838) -- 0:00:23
      624500 -- [-977.940] (-979.270) (-977.480) (-979.334) * [-978.113] (-976.801) (-978.548) (-978.196) -- 0:00:23
      625000 -- (-977.979) (-979.089) [-978.294] (-977.067) * (-979.472) (-978.688) [-978.281] (-980.918) -- 0:00:23

      Average standard deviation of split frequencies: 0.009388

      625500 -- [-978.047] (-978.307) (-978.074) (-977.874) * [-977.481] (-979.890) (-977.921) (-980.425) -- 0:00:23
      626000 -- (-976.293) (-979.353) [-978.965] (-977.631) * (-978.993) (-979.848) (-982.745) [-977.379] -- 0:00:23
      626500 -- (-976.728) [-980.089] (-977.256) (-978.065) * (-979.692) (-976.985) [-976.631] (-977.646) -- 0:00:23
      627000 -- [-978.494] (-976.385) (-979.338) (-979.985) * (-979.190) (-976.372) [-977.689] (-982.611) -- 0:00:23
      627500 -- (-984.096) (-976.620) (-979.959) [-977.873] * (-977.095) [-978.423] (-986.528) (-977.390) -- 0:00:23
      628000 -- [-980.580] (-978.606) (-981.231) (-984.612) * (-978.517) (-977.495) [-980.323] (-978.725) -- 0:00:23
      628500 -- (-979.314) (-979.345) (-980.880) [-981.691] * [-976.644] (-976.958) (-978.512) (-982.536) -- 0:00:23
      629000 -- (-982.737) [-979.933] (-979.194) (-981.036) * (-977.576) (-978.938) [-978.726] (-976.596) -- 0:00:23
      629500 -- (-980.143) [-979.761] (-981.480) (-977.829) * (-977.758) (-976.885) (-978.385) [-981.313] -- 0:00:22
      630000 -- (-982.578) (-977.360) [-978.607] (-976.669) * (-978.122) (-979.420) [-976.948] (-977.057) -- 0:00:22

      Average standard deviation of split frequencies: 0.009219

      630500 -- (-980.088) (-978.155) [-977.551] (-978.046) * (-978.342) [-979.270] (-979.739) (-979.404) -- 0:00:22
      631000 -- [-976.785] (-981.314) (-978.769) (-981.525) * (-979.316) (-979.474) [-979.648] (-980.930) -- 0:00:22
      631500 -- (-981.980) (-979.074) (-978.695) [-976.841] * [-977.647] (-988.067) (-978.534) (-978.360) -- 0:00:22
      632000 -- (-981.185) (-976.579) (-980.757) [-976.686] * [-978.069] (-984.207) (-983.375) (-976.740) -- 0:00:22
      632500 -- (-984.507) [-979.116] (-978.447) (-980.867) * (-979.284) [-979.387] (-979.518) (-977.503) -- 0:00:22
      633000 -- [-978.023] (-978.312) (-979.178) (-981.022) * [-979.231] (-978.307) (-977.706) (-980.043) -- 0:00:22
      633500 -- (-976.305) [-977.224] (-978.369) (-982.005) * (-976.728) [-976.843] (-976.276) (-980.944) -- 0:00:22
      634000 -- [-976.092] (-976.381) (-976.615) (-978.473) * (-977.932) (-979.164) (-976.300) [-977.272] -- 0:00:22
      634500 -- (-976.083) (-979.908) [-978.052] (-976.986) * (-987.305) (-980.350) (-977.697) [-976.730] -- 0:00:22
      635000 -- (-977.411) (-983.657) [-977.155] (-979.431) * (-980.321) (-976.871) [-976.977] (-977.720) -- 0:00:22

      Average standard deviation of split frequencies: 0.009191

      635500 -- (-980.648) [-979.526] (-976.238) (-977.552) * (-981.038) (-978.075) [-978.050] (-978.124) -- 0:00:22
      636000 -- (-978.378) (-978.719) [-977.950] (-976.821) * (-980.668) (-978.666) (-978.827) [-982.919] -- 0:00:22
      636500 -- (-980.866) [-977.921] (-976.858) (-976.280) * [-977.617] (-982.291) (-977.220) (-977.435) -- 0:00:22
      637000 -- [-980.050] (-982.118) (-980.867) (-978.295) * (-977.515) [-977.981] (-977.507) (-976.843) -- 0:00:22
      637500 -- (-980.161) (-977.675) (-980.111) [-978.456] * (-976.506) (-978.103) (-977.499) [-976.402] -- 0:00:22
      638000 -- (-980.088) (-977.914) (-978.887) [-976.339] * [-976.361] (-977.021) (-980.456) (-977.846) -- 0:00:22
      638500 -- (-977.389) (-976.827) [-976.928] (-980.014) * (-977.550) [-978.606] (-977.052) (-978.102) -- 0:00:22
      639000 -- (-977.972) [-979.225] (-977.176) (-979.779) * (-977.890) [-976.681] (-976.296) (-978.871) -- 0:00:22
      639500 -- (-976.944) [-981.680] (-978.651) (-978.043) * (-979.783) [-978.173] (-978.620) (-979.438) -- 0:00:22
      640000 -- (-978.868) (-980.312) [-978.261] (-977.962) * (-978.168) (-978.698) [-980.315] (-978.718) -- 0:00:22

      Average standard deviation of split frequencies: 0.009473

      640500 -- (-977.113) (-981.740) (-977.932) [-977.415] * [-977.461] (-977.616) (-978.301) (-978.202) -- 0:00:22
      641000 -- (-979.975) (-987.308) (-977.305) [-979.093] * [-977.561] (-978.365) (-979.003) (-980.217) -- 0:00:22
      641500 -- [-976.530] (-977.747) (-977.401) (-980.153) * (-977.804) [-977.528] (-978.687) (-976.997) -- 0:00:22
      642000 -- [-976.287] (-980.498) (-977.727) (-980.151) * (-982.380) (-980.487) [-978.029] (-979.041) -- 0:00:22
      642500 -- (-976.822) (-979.811) (-983.354) [-977.979] * (-978.245) [-976.811] (-976.596) (-979.750) -- 0:00:22
      643000 -- [-976.371] (-982.855) (-980.601) (-978.457) * [-978.514] (-978.724) (-980.160) (-980.488) -- 0:00:22
      643500 -- [-977.151] (-980.006) (-978.573) (-980.582) * (-976.914) [-979.554] (-979.336) (-979.479) -- 0:00:22
      644000 -- (-981.490) (-981.163) (-979.654) [-980.871] * [-977.585] (-977.665) (-977.939) (-980.854) -- 0:00:22
      644500 -- [-980.773] (-979.476) (-977.240) (-976.424) * (-976.457) [-977.625] (-978.928) (-980.688) -- 0:00:22
      645000 -- (-980.201) (-976.439) [-976.501] (-979.924) * (-977.138) [-977.521] (-977.272) (-977.514) -- 0:00:22

      Average standard deviation of split frequencies: 0.009304

      645500 -- (-978.362) [-978.226] (-981.231) (-977.632) * [-977.425] (-977.388) (-976.929) (-977.285) -- 0:00:21
      646000 -- [-980.859] (-977.978) (-976.367) (-983.513) * (-978.733) (-979.055) (-977.191) [-976.797] -- 0:00:21
      646500 -- (-976.792) [-979.078] (-978.321) (-979.580) * (-977.252) (-979.326) (-979.780) [-976.613] -- 0:00:21
      647000 -- (-977.210) [-978.923] (-979.401) (-978.125) * (-977.791) (-980.802) [-978.037] (-979.182) -- 0:00:21
      647500 -- (-980.132) (-979.262) [-977.342] (-978.901) * [-976.349] (-979.709) (-981.286) (-980.886) -- 0:00:21
      648000 -- (-977.570) (-977.407) [-976.637] (-977.339) * (-976.398) (-977.049) (-980.188) [-983.344] -- 0:00:21
      648500 -- (-979.538) [-977.350] (-978.478) (-977.752) * (-979.002) [-979.435] (-980.448) (-977.981) -- 0:00:21
      649000 -- (-986.391) [-977.599] (-976.674) (-977.801) * (-977.206) [-980.431] (-978.269) (-982.598) -- 0:00:21
      649500 -- (-977.775) [-978.020] (-976.364) (-978.119) * (-977.698) [-978.537] (-978.558) (-987.415) -- 0:00:21
      650000 -- (-977.988) [-976.446] (-978.754) (-977.618) * (-979.176) (-981.904) [-976.660] (-979.806) -- 0:00:21

      Average standard deviation of split frequencies: 0.009373

      650500 -- [-978.165] (-976.393) (-977.786) (-978.076) * (-978.607) [-977.385] (-976.808) (-978.318) -- 0:00:21
      651000 -- (-980.318) (-978.342) [-979.226] (-978.323) * (-979.467) [-979.149] (-978.579) (-976.503) -- 0:00:21
      651500 -- (-978.775) [-977.668] (-978.998) (-979.284) * (-978.400) (-976.177) [-978.307] (-976.463) -- 0:00:21
      652000 -- (-979.407) (-982.739) [-977.291] (-977.154) * (-977.160) [-978.543] (-976.996) (-977.518) -- 0:00:21
      652500 -- (-977.543) (-983.324) (-979.013) [-977.394] * (-980.140) (-981.142) (-978.323) [-977.243] -- 0:00:21
      653000 -- [-978.481] (-980.004) (-981.213) (-976.814) * (-977.606) (-976.306) [-976.615] (-976.329) -- 0:00:21
      653500 -- (-977.409) [-977.989] (-979.143) (-981.479) * (-982.461) (-986.722) [-976.405] (-977.483) -- 0:00:21
      654000 -- [-982.165] (-977.669) (-977.713) (-979.422) * (-982.862) (-977.054) (-976.461) [-977.806] -- 0:00:21
      654500 -- (-981.633) [-976.584] (-980.945) (-987.535) * (-981.822) (-977.317) [-976.375] (-977.261) -- 0:00:21
      655000 -- (-978.180) (-977.580) [-979.538] (-979.384) * (-977.144) (-978.103) (-979.265) [-978.384] -- 0:00:21

      Average standard deviation of split frequencies: 0.009486

      655500 -- (-981.778) (-980.226) [-979.767] (-980.128) * [-976.320] (-977.824) (-983.467) (-976.070) -- 0:00:21
      656000 -- [-977.233] (-979.778) (-977.428) (-976.378) * (-980.916) [-980.678] (-978.902) (-978.182) -- 0:00:21
      656500 -- [-977.658] (-977.897) (-980.721) (-978.749) * (-977.678) [-976.438] (-976.418) (-976.484) -- 0:00:21
      657000 -- (-977.172) (-982.365) (-979.444) [-980.110] * (-977.036) (-976.885) [-976.051] (-976.622) -- 0:00:21
      657500 -- [-975.997] (-978.987) (-979.017) (-977.143) * (-976.873) (-976.623) [-976.962] (-978.368) -- 0:00:21
      658000 -- (-979.327) (-983.064) (-976.806) [-976.221] * (-978.361) (-977.317) (-977.908) [-979.268] -- 0:00:21
      658500 -- [-980.772] (-982.283) (-978.715) (-977.304) * [-978.299] (-978.204) (-977.336) (-980.383) -- 0:00:21
      659000 -- (-980.041) (-978.070) (-977.128) [-976.557] * (-976.987) (-983.317) [-977.201] (-978.718) -- 0:00:21
      659500 -- (-978.165) (-977.167) (-978.003) [-977.104] * [-977.276] (-978.607) (-978.341) (-979.471) -- 0:00:21
      660000 -- (-978.064) (-977.252) (-978.002) [-976.277] * (-981.032) (-979.518) (-979.603) [-980.263] -- 0:00:21

      Average standard deviation of split frequencies: 0.009181

      660500 -- (-981.103) (-977.850) (-978.892) [-976.451] * [-980.026] (-981.344) (-978.808) (-976.222) -- 0:00:21
      661000 -- (-981.163) (-981.331) (-980.216) [-976.867] * [-978.808] (-977.829) (-978.680) (-978.566) -- 0:00:21
      661500 -- (-979.943) (-979.279) (-977.168) [-981.229] * (-978.467) (-976.675) [-982.667] (-982.846) -- 0:00:20
      662000 -- [-978.949] (-980.925) (-984.079) (-980.320) * (-977.323) [-979.535] (-984.864) (-982.707) -- 0:00:20
      662500 -- (-978.458) (-978.892) [-979.130] (-976.926) * (-976.861) [-978.911] (-980.976) (-980.107) -- 0:00:20
      663000 -- [-978.095] (-976.149) (-976.878) (-976.499) * [-978.352] (-976.240) (-979.093) (-977.983) -- 0:00:20
      663500 -- (-979.498) [-977.145] (-978.738) (-978.117) * (-977.236) [-978.131] (-980.734) (-977.052) -- 0:00:20
      664000 -- (-978.456) (-977.737) (-981.258) [-976.015] * [-976.766] (-981.874) (-979.108) (-976.337) -- 0:00:20
      664500 -- (-976.274) (-977.300) [-976.850] (-977.649) * [-976.843] (-977.932) (-980.521) (-978.125) -- 0:00:20
      665000 -- (-976.305) (-978.145) [-977.384] (-976.653) * (-980.243) (-979.718) [-980.927] (-976.726) -- 0:00:20

      Average standard deviation of split frequencies: 0.009154

      665500 -- (-977.491) [-980.158] (-976.927) (-983.147) * (-977.229) (-984.617) (-984.706) [-976.920] -- 0:00:20
      666000 -- (-977.672) [-977.453] (-980.283) (-981.543) * (-976.402) (-980.451) (-980.777) [-976.512] -- 0:00:20
      666500 -- (-977.356) [-981.824] (-977.892) (-977.381) * [-978.569] (-976.554) (-985.820) (-976.605) -- 0:00:20
      667000 -- (-977.176) (-981.182) (-976.531) [-976.305] * (-976.706) (-976.495) (-979.822) [-976.405] -- 0:00:20
      667500 -- (-975.956) (-979.700) (-976.315) [-980.711] * (-978.290) (-976.468) [-977.133] (-977.487) -- 0:00:20
      668000 -- (-982.899) (-980.767) (-980.876) [-980.069] * (-977.724) (-979.711) (-976.743) [-976.660] -- 0:00:20
      668500 -- [-977.487] (-977.017) (-981.529) (-977.309) * (-977.425) (-979.859) [-978.849] (-978.650) -- 0:00:20
      669000 -- (-977.618) [-979.195] (-979.110) (-978.854) * [-976.837] (-980.357) (-978.111) (-977.989) -- 0:00:20
      669500 -- (-977.188) (-978.836) [-977.330] (-981.590) * (-977.499) (-980.282) [-976.395] (-980.909) -- 0:00:20
      670000 -- (-978.115) (-978.686) (-977.166) [-976.205] * (-978.986) (-984.971) (-977.844) [-978.254] -- 0:00:20

      Average standard deviation of split frequencies: 0.009700

      670500 -- (-981.146) (-977.369) [-975.994] (-977.004) * (-976.693) [-977.346] (-976.857) (-982.112) -- 0:00:20
      671000 -- [-978.346] (-978.779) (-977.545) (-977.974) * (-977.451) (-981.684) [-979.564] (-983.233) -- 0:00:20
      671500 -- (-979.245) (-976.453) (-977.343) [-976.543] * (-978.190) [-981.381] (-980.250) (-977.998) -- 0:00:20
      672000 -- [-976.672] (-979.307) (-979.429) (-977.923) * (-980.117) [-980.844] (-976.879) (-978.577) -- 0:00:20
      672500 -- (-979.863) (-978.391) [-978.878] (-977.403) * (-978.078) (-984.067) [-976.791] (-978.220) -- 0:00:20
      673000 -- (-980.323) (-978.954) [-978.841] (-978.955) * (-977.032) (-976.781) [-977.738] (-980.011) -- 0:00:20
      673500 -- [-977.403] (-977.718) (-980.300) (-978.812) * (-978.335) [-979.639] (-976.323) (-978.157) -- 0:00:20
      674000 -- (-978.835) [-978.019] (-978.484) (-985.287) * (-981.103) (-985.688) [-980.953] (-979.260) -- 0:00:20
      674500 -- [-977.124] (-983.181) (-979.080) (-980.228) * (-983.175) (-982.170) [-976.878] (-976.363) -- 0:00:20
      675000 -- (-977.945) (-978.683) [-980.675] (-979.667) * (-981.370) (-979.108) [-979.098] (-978.813) -- 0:00:20

      Average standard deviation of split frequencies: 0.009484

      675500 -- (-979.238) (-976.482) [-978.671] (-978.369) * (-978.269) (-978.086) (-976.538) [-977.619] -- 0:00:20
      676000 -- (-979.164) (-977.502) [-976.020] (-976.341) * (-977.501) [-977.444] (-980.583) (-976.923) -- 0:00:20
      676500 -- (-980.142) [-977.251] (-977.402) (-977.165) * (-977.386) [-979.839] (-977.389) (-977.480) -- 0:00:20
      677000 -- (-980.596) [-979.468] (-979.831) (-978.526) * (-979.989) [-977.211] (-980.163) (-977.431) -- 0:00:20
      677500 -- [-978.621] (-979.402) (-977.507) (-976.878) * (-978.733) [-977.727] (-981.551) (-975.916) -- 0:00:19
      678000 -- (-977.592) (-979.876) (-976.279) [-977.202] * (-976.996) [-977.440] (-977.465) (-979.671) -- 0:00:19
      678500 -- (-977.807) (-978.449) (-977.819) [-980.570] * (-982.164) (-977.670) (-977.009) [-978.576] -- 0:00:19
      679000 -- (-977.436) [-983.069] (-980.950) (-980.783) * (-978.224) (-988.145) (-979.266) [-978.018] -- 0:00:19
      679500 -- (-976.866) [-978.287] (-978.703) (-977.394) * (-977.711) (-981.686) (-979.484) [-977.343] -- 0:00:19
      680000 -- (-978.557) (-978.141) (-979.325) [-978.152] * (-981.092) (-978.485) (-979.273) [-978.806] -- 0:00:19

      Average standard deviation of split frequencies: 0.009327

      680500 -- [-981.851] (-976.541) (-977.605) (-976.772) * (-978.502) (-978.077) [-980.053] (-979.220) -- 0:00:19
      681000 -- (-976.587) (-977.640) [-977.608] (-978.543) * (-978.678) (-979.013) [-977.175] (-977.979) -- 0:00:19
      681500 -- [-977.985] (-978.249) (-983.433) (-979.430) * (-977.613) (-980.675) (-977.463) [-977.994] -- 0:00:19
      682000 -- (-978.583) (-978.816) (-979.555) [-979.104] * (-977.778) (-980.717) [-982.669] (-977.003) -- 0:00:19
      682500 -- (-983.144) (-976.045) [-976.941] (-977.421) * [-978.484] (-977.533) (-976.541) (-977.244) -- 0:00:19
      683000 -- (-976.084) (-979.295) (-977.483) [-977.335] * (-979.195) (-980.599) [-976.022] (-977.195) -- 0:00:19
      683500 -- (-979.450) (-978.761) [-976.850] (-980.880) * (-977.385) (-980.658) (-977.032) [-976.733] -- 0:00:19
      684000 -- [-977.278] (-978.593) (-978.331) (-979.016) * (-976.053) (-980.099) (-979.259) [-976.180] -- 0:00:19
      684500 -- (-981.684) (-978.631) [-978.193] (-976.099) * [-977.819] (-977.866) (-977.201) (-978.435) -- 0:00:19
      685000 -- (-977.693) [-979.866] (-978.184) (-977.822) * [-978.465] (-979.214) (-976.117) (-978.853) -- 0:00:19

      Average standard deviation of split frequencies: 0.010050

      685500 -- (-977.575) (-978.885) (-980.872) [-977.769] * (-982.034) (-980.609) [-976.244] (-978.155) -- 0:00:19
      686000 -- (-976.921) [-977.560] (-979.737) (-976.475) * (-984.135) [-978.129] (-977.882) (-978.734) -- 0:00:19
      686500 -- (-978.832) (-978.322) [-981.212] (-981.126) * [-977.335] (-981.779) (-976.633) (-978.601) -- 0:00:19
      687000 -- (-978.280) (-980.424) [-977.463] (-983.272) * (-978.795) (-979.147) (-978.053) [-979.962] -- 0:00:19
      687500 -- [-978.852] (-979.029) (-978.321) (-982.692) * [-976.799] (-979.544) (-976.901) (-987.226) -- 0:00:19
      688000 -- [-981.185] (-977.117) (-978.971) (-982.680) * [-978.276] (-984.679) (-977.931) (-976.580) -- 0:00:19
      688500 -- (-978.662) [-982.003] (-978.386) (-980.302) * (-979.061) (-982.306) [-977.148] (-977.540) -- 0:00:19
      689000 -- [-979.840] (-979.136) (-982.114) (-978.611) * (-980.608) (-987.318) [-979.314] (-978.219) -- 0:00:19
      689500 -- (-980.321) (-977.557) [-980.509] (-979.409) * [-978.248] (-982.521) (-984.118) (-981.080) -- 0:00:19
      690000 -- (-979.863) (-979.120) [-983.221] (-979.550) * (-978.336) (-979.871) [-978.950] (-976.991) -- 0:00:19

      Average standard deviation of split frequencies: 0.009385

      690500 -- (-983.370) [-978.184] (-979.217) (-979.878) * (-977.561) (-983.322) [-981.073] (-977.607) -- 0:00:19
      691000 -- [-977.646] (-976.455) (-978.896) (-982.418) * [-979.713] (-985.857) (-981.563) (-977.960) -- 0:00:19
      691500 -- [-978.802] (-982.435) (-982.335) (-982.095) * (-976.836) (-978.349) (-977.878) [-978.426] -- 0:00:19
      692000 -- (-