--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:26:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/plsB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -3192.54         -3196.43
2      -3192.63         -3196.64
--------------------------------------
TOTAL    -3192.58         -3196.54
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899589    0.088246    0.346164    1.482820    0.865309   1436.58   1467.77    1.000
r(A<->C){all}   0.172657    0.019858    0.000087    0.450722    0.135305     70.11    181.88    1.002
r(A<->G){all}   0.162078    0.017326    0.000065    0.425721    0.129300    146.90    332.11    1.003
r(A<->T){all}   0.155320    0.017088    0.000081    0.418754    0.123792    216.72    234.27    1.000
r(C<->G){all}   0.177988    0.020550    0.000005    0.459690    0.144076     84.44    123.23    1.000
r(C<->T){all}   0.172341    0.020495    0.000085    0.462833    0.136674    173.48    192.95    1.000
r(G<->T){all}   0.159615    0.018106    0.000061    0.437427    0.121934    352.28    383.46    1.000
pi(A){all}      0.196047    0.000069    0.181072    0.213583    0.196171   1462.63   1481.81    1.000
pi(C){all}      0.267128    0.000083    0.249641    0.284984    0.267040   1154.84   1327.92    1.000
pi(G){all}      0.307385    0.000093    0.288256    0.326124    0.307429   1178.20   1222.24    1.000
pi(T){all}      0.229440    0.000076    0.212105    0.245910    0.229444   1310.99   1320.53    1.001
alpha{1,2}      0.430638    0.246600    0.000140    1.439981    0.254052   1074.28   1287.64    1.000
alpha{3}        0.458460    0.236911    0.000174    1.455406    0.302087   1283.01   1305.67    1.000
pinvar{all}     0.999358    0.000001    0.997922    1.000000    0.999619   1030.11   1107.40    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3101.724475
Model 2: PositiveSelection	-3101.724475
Model 0: one-ratio	-3101.725611
Model 7: beta	-3101.724475
Model 8: beta&w>1	-3101.724475


Model 0 vs 1	0.0022719999997207196

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C2
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C3
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C4
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C5
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C6
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=775 

C1              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C2              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C3              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C4              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C5              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C6              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
                **************************************************

C1              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C2              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C3              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C4              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C5              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C6              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
                **************************************************

C1              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C2              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C3              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C4              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C5              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C6              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
                **************************************************

C1              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C2              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C3              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C4              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C5              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C6              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
                **************************************************

C1              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C2              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C3              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C4              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C5              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C6              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
                **************************************************

C1              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C2              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C3              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C4              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C5              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C6              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
                **************************************************

C1              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C2              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C3              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C4              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C5              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C6              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
                **************************************************

C1              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C2              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C3              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C4              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C5              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C6              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
                **************************************************

C1              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C2              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C3              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C4              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C5              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C6              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
                **************************************************

C1              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C2              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C3              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C4              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C5              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C6              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
                **************************************************

C1              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C2              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C3              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C4              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C5              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C6              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
                **************************************************

C1              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C2              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C3              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C4              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C5              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C6              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
                **************************************************

C1              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C2              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C3              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C4              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C5              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C6              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
                **************************************************

C1              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C2              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C3              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C4              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C5              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C6              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
                **************************************************

C1              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C2              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C3              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C4              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C5              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C6              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
                **************************************************

C1              DIRRDFDYVEQIARSRFIVREFKSR
C2              DIRRDFDYVEQIARSRFIVREFKSR
C3              DIRRDFDYVEQIARSRFIVREFKSR
C4              DIRRDFDYVEQIARSRFIVREFKSR
C5              DIRRDFDYVEQIARSRFIVREFKSR
C6              DIRRDFDYVEQIARSRFIVREFKSR
                *************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  775 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  775 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [23250]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [23250]--->[23250]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.633 Mb, Max= 31.431 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C2              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C3              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C4              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C5              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
C6              VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
                **************************************************

C1              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C2              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C3              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C4              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C5              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
C6              LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
                **************************************************

C1              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C2              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C3              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C4              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C5              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
C6              LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
                **************************************************

C1              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C2              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C3              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C4              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C5              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
C6              ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
                **************************************************

C1              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C2              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C3              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C4              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C5              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
C6              ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
                **************************************************

C1              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C2              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C3              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C4              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C5              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
C6              AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
                **************************************************

C1              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C2              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C3              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C4              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C5              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
C6              LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
                **************************************************

C1              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C2              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C3              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C4              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C5              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
C6              SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
                **************************************************

C1              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C2              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C3              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C4              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C5              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
C6              ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
                **************************************************

C1              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C2              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C3              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C4              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C5              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
C6              VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
                **************************************************

C1              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C2              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C3              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C4              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C5              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
C6              LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
                **************************************************

C1              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C2              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C3              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C4              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C5              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
C6              GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
                **************************************************

C1              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C2              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C3              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C4              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C5              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
C6              FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
                **************************************************

C1              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C2              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C3              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C4              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C5              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
C6              AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
                **************************************************

C1              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C2              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C3              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C4              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C5              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
C6              QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
                **************************************************

C1              DIRRDFDYVEQIARSRFIVREFKSR
C2              DIRRDFDYVEQIARSRFIVREFKSR
C3              DIRRDFDYVEQIARSRFIVREFKSR
C4              DIRRDFDYVEQIARSRFIVREFKSR
C5              DIRRDFDYVEQIARSRFIVREFKSR
C6              DIRRDFDYVEQIARSRFIVREFKSR
                *************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
C2              GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
C3              GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
C4              GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
C5              GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
C6              GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
                **************************************************

C1              GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
C2              GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
C3              GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
C4              GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
C5              GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
C6              GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
                **************************************************

C1              ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
C2              ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
C3              ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
C4              ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
C5              ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
C6              ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
                **************************************************

C1              TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
C2              TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
C3              TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
C4              TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
C5              TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
C6              TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
                **************************************************

C1              TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
C2              TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
C3              TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
C4              TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
C5              TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
C6              TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
                **************************************************

C1              TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
C2              TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
C3              TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
C4              TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
C5              TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
C6              TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
                **************************************************

C1              TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
C2              TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
C3              TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
C4              TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
C5              TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
C6              TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
                **************************************************

C1              CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
C2              CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
C3              CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
C4              CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
C5              CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
C6              CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
                **************************************************

C1              AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
C2              AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
C3              AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
C4              AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
C5              AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
C6              AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
                **************************************************

C1              GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
C2              GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
C3              GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
C4              GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
C5              GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
C6              GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
                **************************************************

C1              ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
C2              ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
C3              ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
C4              ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
C5              ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
C6              ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
                **************************************************

C1              TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
C2              TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
C3              TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
C4              TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
C5              TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
C6              TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
                **************************************************

C1              ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
C2              ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
C3              ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
C4              ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
C5              ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
C6              ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
                **************************************************

C1              CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
C2              CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
C3              CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
C4              CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
C5              CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
C6              CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
                **************************************************

C1              TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
C2              TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
C3              TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
C4              TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
C5              TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
C6              TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
                **************************************************

C1              GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
C2              GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
C3              GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
C4              GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
C5              GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
C6              GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
                **************************************************

C1              GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
C2              GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
C3              GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
C4              GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
C5              GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
C6              GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
                **************************************************

C1              ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
C2              ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
C3              ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
C4              ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
C5              ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
C6              ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
                **************************************************

C1              TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
C2              TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
C3              TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
C4              TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
C5              TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
C6              TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
                **************************************************

C1              CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
C2              CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
C3              CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
C4              CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
C5              CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
C6              CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
                **************************************************

C1              ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
C2              ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
C3              ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
C4              ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
C5              ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
C6              ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
                **************************************************

C1              TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
C2              TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
C3              TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
C4              TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
C5              TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
C6              TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
                **************************************************

C1              GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
C2              GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
C3              GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
C4              GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
C5              GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
C6              GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
                **************************************************

C1              TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
C2              TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
C3              TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
C4              TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
C5              TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
C6              TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
                **************************************************

C1              GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
C2              GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
C3              GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
C4              GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
C5              GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
C6              GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
                **************************************************

C1              TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
C2              TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
C3              TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
C4              TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
C5              TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
C6              TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
                **************************************************

C1              CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
C2              CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
C3              CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
C4              CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
C5              CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
C6              CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
                **************************************************

C1              GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
C2              GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
C3              GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
C4              GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
C5              GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
C6              GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
                **************************************************

C1              AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
C2              AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
C3              AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
C4              AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
C5              AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
C6              AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
                **************************************************

C1              TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
C2              TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
C3              TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
C4              TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
C5              TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
C6              TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
                **************************************************

C1              CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
C2              CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
C3              CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
C4              CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
C5              CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
C6              CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
                **************************************************

C1              TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
C2              TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
C3              TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
C4              TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
C5              TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
C6              TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
                **************************************************

C1              CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
C2              CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
C3              CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
C4              CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
C5              CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
C6              CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
                **************************************************

C1              GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
C2              GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
C3              GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
C4              GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
C5              GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
C6              GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
                **************************************************

C1              ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
C2              ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
C3              ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
C4              ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
C5              ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
C6              ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
                **************************************************

C1              AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
C2              AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
C3              AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
C4              AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
C5              AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
C6              AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
                **************************************************

C1              TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
C2              TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
C3              TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
C4              TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
C5              TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
C6              TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
                **************************************************

C1              TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
C2              TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
C3              TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
C4              TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
C5              TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
C6              TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
                **************************************************

C1              GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
C2              GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
C3              GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
C4              GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
C5              GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
C6              GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
                **************************************************

C1              GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
C2              GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
C3              GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
C4              GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
C5              GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
C6              GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
                **************************************************

C1              ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
C2              ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
C3              ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
C4              ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
C5              ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
C6              ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
                **************************************************

C1              CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
C2              CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
C3              CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
C4              CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
C5              CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
C6              CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
                **************************************************

C1              CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
C2              CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
C3              CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
C4              CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
C5              CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
C6              CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
                **************************************************

C1              ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
C2              ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
C3              ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
C4              ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
C5              ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
C6              ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
                **************************************************

C1              CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
C2              CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
C3              CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
C4              CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
C5              CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
C6              CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
                **************************************************

C1              GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
C2              GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
C3              GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
C4              GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
C5              GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
C6              GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
                **************************************************

C1              CATCGTCCGTGAGTTCAAATCGCGT
C2              CATCGTCCGTGAGTTCAAATCGCGT
C3              CATCGTCCGTGAGTTCAAATCGCGT
C4              CATCGTCCGTGAGTTCAAATCGCGT
C5              CATCGTCCGTGAGTTCAAATCGCGT
C6              CATCGTCCGTGAGTTCAAATCGCGT
                *************************



>C1
GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
CATCGTCCGTGAGTTCAAATCGCGT
>C2
GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
CATCGTCCGTGAGTTCAAATCGCGT
>C3
GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
CATCGTCCGTGAGTTCAAATCGCGT
>C4
GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
CATCGTCCGTGAGTTCAAATCGCGT
>C5
GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
CATCGTCCGTGAGTTCAAATCGCGT
>C6
GTGACTGAACCGGATGTAGAAATCAGCTCAGTCCTTACCGGTGAAGACAC
GCTGGTGCTAGCGTCTATGGACACTCCGGCGGAAATTGAGCTGGTCATGG
ATTGGCTATGCCAGCAGCGTAACCGCAACCCGGACATCAAGTTCGACGTA
TTGAAGCTTCCTTCGCGCAACTTAGCGCCCGCGGCGCTGACAGCACTTGT
TGAACAGCTCGAATCCGACGAAGACCGGTCGGTCGTGCCGGTGCGTGTTT
TCTGGATGCCGCCTGCGGAGCGCAGTAAGTTGGCCAAGCTGGCTGGATTG
TTGCCCGGCCGGGATCCTTACCACCCCAACCGGCGCCAGCAGCGCCACAT
CTTAAAAACCGACGCCCGGCGTGCCCTGGTGATTGCTGGCGACTCTGCTA
AAGTGTCCGAGCTCCGCCAATACTGGCGCGATACCACCGTTGGAGAAAAC
GAGTGCGATTTCGCTCAGTTCGTTACTCGCCGCGCCATCTTGGCGATGGA
ACGTGCCGAGTCTCGAATCCTCGGACCACAGTACAAGTCTCCGCGGCTGG
TGAAGCCAGAAATCTTGGCGTCAACGCGGTTTCGTGCTGGACTGGAAAAG
ATCTCGGGCGCAACCGTGGAAGAAGCTGGGAAGATGCTTGACGAACTCGC
CACCGGGTGGAGCAGGGCGTCGGTTGACCTCGTTTCCGTGCTCGGCAGGA
TGCTCAGCCGCGGCTTCGAACCTGAGATCGACTACGACGAGTATCAAGTC
GCGGCGATGCGCGCGGCGTTGGAAGCTCATCCAGCGGTGCTGCTGTTCTC
GCACCGGTCCTACATTGACGGTGCGGTGGTGCCGGTGGCGATGCAGGAGA
ATCGGCTACCACCGGTGCATGTGTTCGCCGGCATCAACCTGTCGTTCGGG
TTAATGGGGCCACTGTTGCGCCGCTCCGGCGTCATTTTCATCCGCCGTAA
CATCGGCGACAATCCGCTCTACAAGTATGTCTTGCGCGAATACGTCGGCT
ACATCGTGGAGAAGCGTTTCAACCTGAGCTGGTCCATTGAGGGCACTCGT
TCGCGTACTGGCAAGATGCTGCCACCCAAGCTCGGTCTGCTCACCTACGT
GGCCGATGCGTACCTGGACGGCCGGAGTGAAGACATCCTGTTGCAGCCGG
TGTCGATCAGTTTCGATCAGTTGCACGAAACCGCCGAGTACGCTGCCTAT
GCTCGTGGCGGCGAAAAGACGCCCGAAGGTGTCGCTTGGCTGTATAGTTT
TATCAAGGCGCAAGGTGAACGTAACTACGGTAAGATCTACGTCCGTTTCC
CGGAAGCGGTCTCGATGCGGCAGTATCTCGGTGCGCCTCACGGTGCATTG
GTTCAAGATCAAGACGCTAAACGGCTTGCGCTCCAAAAGATGTCGTTCGA
AGTTGCATGGCGGATTCTGTGTGCGACGCCAGTGACGGCGACAGCGTTGG
TTTCCGCGCTGCTATTGACCACTCGTGGAGTGGCCTTGACGCTTGATCAA
CTGCATCACACGTTGCAAGAATCACTGGATTACCTGGAACGCAAGCAAAC
TCCTGTGTCGAAGAGTGCGTTGCGGCTGCGTTCGCGTGAAGGCGTGCGTG
CTGCGGTCGACGCATTGTCCAGCGGGCACCCGATCACTCGGGTTGACAGC
GGTCGGGAACCGGTGTGGTATATTACCCCCGGTAATGAACATGCTGCGGC
ATTCTACCGGAACTCGGTGATACACGCCTTCCTGGAGACCTCGATAGTCG
AACTCGCGTTGGCGCATGCCAGGCATGTCGAAGGCGACCGTATGAAGGTT
TTCTGGGCGCAGGCGATGAGGCTGCGTGATCTCTTGAAGTTCGATTTTTA
TTTCGCGGATTCGGCTGCTTTTCGTGCCAATATCGCCGAAGAGATAGCGT
GGCACCAGAATTGGGAGGATCGTGTTTCCGGTGATGGTGATGATATCGAC
GCGATGCTGCTTACTAAGCGACCGTTGATCTCAGATGCGATGTTGCGGGT
ATTTTTTGAAGCGTACGATATTGTCGCTGATGTGTTGCGCGATGCTCCGG
CGGATGTTGGCCAAAAGGAACTGACTGAATTGGCACTTGGTGTCGGACGC
CAGTACGTGGCACAGGGTCGGGTCCGTAGCGGTGAATCGGTGTCTACGCT
ACTATTCGCCACCGCTTACCAGGTTGTTGTCGATCAGAATCTGATAGCGC
CAGCTCCGGATCTCGCTGAACGTCGGATGGTTTTCCGGCGGGAGTTGCGG
GATATTCGGCGAGATTTCGACTACGTCGAACAAATCGCGCGCAGCCGGTT
CATCGTCCGTGAGTTCAAATCGCGT
>C1
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C2
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C3
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C4
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C5
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR
>C6
VTEPDVEISSVLTGEDTLVLASMDTPAEIELVMDWLCQQRNRNPDIKFDV
LKLPSRNLAPAALTALVEQLESDEDRSVVPVRVFWMPPAERSKLAKLAGL
LPGRDPYHPNRRQQRHILKTDARRALVIAGDSAKVSELRQYWRDTTVGEN
ECDFAQFVTRRAILAMERAESRILGPQYKSPRLVKPEILASTRFRAGLEK
ISGATVEEAGKMLDELATGWSRASVDLVSVLGRMLSRGFEPEIDYDEYQV
AAMRAALEAHPAVLLFSHRSYIDGAVVPVAMQENRLPPVHVFAGINLSFG
LMGPLLRRSGVIFIRRNIGDNPLYKYVLREYVGYIVEKRFNLSWSIEGTR
SRTGKMLPPKLGLLTYVADAYLDGRSEDILLQPVSISFDQLHETAEYAAY
ARGGEKTPEGVAWLYSFIKAQGERNYGKIYVRFPEAVSMRQYLGAPHGAL
VQDQDAKRLALQKMSFEVAWRILCATPVTATALVSALLLTTRGVALTLDQ
LHHTLQESLDYLERKQTPVSKSALRLRSREGVRAAVDALSSGHPITRVDS
GREPVWYITPGNEHAAAFYRNSVIHAFLETSIVELALAHARHVEGDRMKV
FWAQAMRLRDLLKFDFYFADSAAFRANIAEEIAWHQNWEDRVSGDGDDID
AMLLTKRPLISDAMLRVFFEAYDIVADVLRDAPADVGQKELTELALGVGR
QYVAQGRVRSGESVSTLLFATAYQVVVDQNLIAPAPDLAERRMVFRRELR
DIRRDFDYVEQIARSRFIVREFKSR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 2325 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785877
      Setting output file names to "/data/10res/plsB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1753202538
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9058322123
      Seed = 1856224542
      Swapseed = 1579785877
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5203.461454 -- -24.965149
         Chain 2 -- -5203.461153 -- -24.965149
         Chain 3 -- -5203.461454 -- -24.965149
         Chain 4 -- -5203.461454 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5203.461153 -- -24.965149
         Chain 2 -- -5203.461454 -- -24.965149
         Chain 3 -- -5203.461454 -- -24.965149
         Chain 4 -- -5203.461454 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5203.461] (-5203.461) (-5203.461) (-5203.461) * [-5203.461] (-5203.461) (-5203.461) (-5203.461) 
        500 -- (-3227.553) (-3213.175) (-3214.487) [-3200.474] * [-3229.428] (-3222.668) (-3201.493) (-3210.709) -- 0:00:00
       1000 -- (-3199.845) (-3216.461) (-3204.201) [-3203.106] * (-3200.392) (-3218.550) (-3198.599) [-3202.939] -- 0:00:00
       1500 -- (-3204.484) (-3213.420) (-3208.240) [-3198.248] * [-3197.709] (-3200.178) (-3206.548) (-3198.777) -- 0:00:00
       2000 -- (-3207.597) (-3201.107) (-3206.457) [-3200.693] * (-3205.143) (-3206.005) [-3199.464] (-3207.221) -- 0:00:00
       2500 -- (-3201.882) (-3198.396) [-3203.941] (-3205.694) * (-3200.528) [-3195.747] (-3202.541) (-3200.481) -- 0:06:39
       3000 -- [-3199.330] (-3205.037) (-3204.040) (-3198.793) * (-3203.845) (-3200.903) (-3202.667) [-3205.062] -- 0:05:32
       3500 -- (-3201.753) (-3207.832) [-3199.045] (-3204.049) * (-3206.699) [-3203.782] (-3194.717) (-3204.531) -- 0:04:44
       4000 -- (-3208.960) [-3201.151] (-3203.944) (-3196.439) * (-3206.489) (-3198.304) [-3204.042] (-3208.269) -- 0:04:09
       4500 -- (-3201.035) (-3209.056) [-3200.969] (-3205.009) * (-3207.448) (-3200.823) [-3198.766] (-3197.058) -- 0:03:41
       5000 -- (-3201.057) [-3199.351] (-3200.553) (-3205.968) * (-3207.620) [-3202.093] (-3206.395) (-3198.078) -- 0:03:19

      Average standard deviation of split frequencies: 0.089791

       5500 -- (-3195.268) [-3204.573] (-3203.089) (-3203.770) * [-3203.190] (-3208.131) (-3210.058) (-3207.401) -- 0:03:00
       6000 -- (-3200.618) (-3206.190) (-3203.963) [-3206.116] * (-3205.183) (-3200.245) [-3205.049] (-3209.874) -- 0:02:45
       6500 -- (-3196.911) (-3197.744) (-3201.648) [-3201.991] * [-3197.821] (-3204.200) (-3212.067) (-3200.225) -- 0:02:32
       7000 -- (-3197.093) (-3197.787) (-3211.552) [-3208.306] * [-3199.538] (-3205.205) (-3207.175) (-3203.696) -- 0:02:21
       7500 -- [-3205.345] (-3202.850) (-3197.478) (-3208.032) * (-3201.444) (-3204.709) [-3201.606] (-3204.278) -- 0:02:12
       8000 -- (-3202.257) (-3209.930) [-3199.824] (-3204.853) * [-3204.653] (-3205.150) (-3206.295) (-3205.055) -- 0:02:04
       8500 -- (-3210.449) (-3202.478) (-3201.403) [-3201.761] * (-3206.851) (-3199.055) (-3199.583) [-3201.417] -- 0:01:56
       9000 -- (-3207.542) [-3202.752] (-3202.800) (-3210.954) * (-3199.065) [-3201.273] (-3202.915) (-3210.754) -- 0:01:50
       9500 -- (-3201.700) (-3200.902) (-3203.956) [-3203.217] * (-3202.895) (-3203.995) [-3199.262] (-3201.738) -- 0:01:44
      10000 -- (-3203.557) [-3200.441] (-3201.457) (-3208.412) * [-3201.430] (-3199.894) (-3205.336) (-3201.700) -- 0:01:39

      Average standard deviation of split frequencies: 0.085626

      10500 -- (-3206.221) (-3204.494) [-3199.962] (-3205.187) * (-3200.675) (-3207.676) (-3203.852) [-3200.758] -- 0:01:34
      11000 -- (-3200.693) [-3200.772] (-3205.596) (-3199.514) * (-3200.357) (-3203.834) (-3220.503) [-3201.838] -- 0:01:29
      11500 -- (-3205.973) (-3210.955) [-3208.096] (-3205.504) * [-3199.348] (-3211.966) (-3198.622) (-3205.061) -- 0:01:25
      12000 -- (-3202.247) [-3198.645] (-3207.870) (-3205.986) * [-3201.842] (-3196.647) (-3209.460) (-3202.506) -- 0:01:22
      12500 -- (-3205.886) [-3206.751] (-3203.125) (-3202.413) * (-3200.354) [-3196.062] (-3201.532) (-3205.985) -- 0:01:19
      13000 -- (-3199.832) (-3206.151) [-3204.207] (-3199.257) * (-3200.807) (-3194.730) (-3202.833) [-3197.572] -- 0:01:15
      13500 -- (-3201.957) (-3207.368) (-3201.392) [-3200.050] * [-3203.124] (-3195.376) (-3203.181) (-3202.310) -- 0:01:13
      14000 -- [-3200.592] (-3211.820) (-3206.195) (-3211.114) * (-3203.605) [-3193.901] (-3203.520) (-3210.684) -- 0:01:10
      14500 -- (-3201.707) (-3201.088) [-3201.722] (-3217.444) * (-3196.415) (-3198.818) (-3203.243) [-3202.675] -- 0:01:07
      15000 -- (-3201.066) (-3202.589) (-3200.100) [-3199.825] * (-3199.899) (-3199.282) [-3196.986] (-3199.991) -- 0:01:05

      Average standard deviation of split frequencies: 0.057084

      15500 -- (-3197.800) (-3206.440) [-3209.857] (-3203.116) * (-3207.436) (-3194.474) (-3209.211) [-3203.228] -- 0:02:07
      16000 -- (-3198.653) (-3206.011) [-3199.895] (-3202.781) * (-3202.240) [-3193.563] (-3199.594) (-3199.161) -- 0:02:03
      16500 -- (-3206.450) [-3202.413] (-3200.226) (-3204.222) * (-3207.900) (-3194.371) [-3203.016] (-3203.448) -- 0:01:59
      17000 -- (-3198.020) [-3204.182] (-3201.991) (-3200.997) * (-3205.993) [-3194.117] (-3198.747) (-3211.975) -- 0:01:55
      17500 -- (-3194.953) [-3203.121] (-3201.400) (-3212.547) * (-3203.824) [-3194.578] (-3209.143) (-3197.131) -- 0:01:52
      18000 -- (-3200.265) (-3199.318) [-3203.331] (-3201.510) * (-3200.173) [-3198.659] (-3202.651) (-3198.918) -- 0:01:49
      18500 -- [-3197.440] (-3200.391) (-3200.027) (-3203.549) * [-3200.753] (-3204.479) (-3204.096) (-3211.303) -- 0:01:46
      19000 -- (-3214.245) (-3206.398) (-3207.732) [-3202.589] * (-3197.790) (-3194.937) [-3197.980] (-3201.294) -- 0:01:43
      19500 -- (-3197.571) (-3201.719) (-3211.867) [-3203.087] * (-3198.275) (-3194.346) [-3196.790] (-3219.806) -- 0:01:40
      20000 -- (-3197.746) (-3200.344) (-3202.887) [-3198.084] * [-3198.677] (-3194.342) (-3200.986) (-3200.906) -- 0:01:38

      Average standard deviation of split frequencies: 0.053223

      20500 -- (-3194.778) (-3206.311) (-3209.467) [-3202.046] * [-3204.338] (-3193.743) (-3204.241) (-3194.711) -- 0:01:35
      21000 -- (-3191.728) (-3198.780) (-3216.813) [-3199.014] * (-3197.613) [-3193.111] (-3202.642) (-3193.995) -- 0:01:33
      21500 -- (-3191.479) (-3198.706) (-3202.739) [-3199.048] * (-3201.559) [-3193.225] (-3206.089) (-3194.653) -- 0:01:31
      22000 -- (-3191.295) [-3204.284] (-3203.071) (-3200.234) * [-3201.862] (-3192.564) (-3207.540) (-3197.298) -- 0:01:28
      22500 -- (-3194.377) (-3201.564) [-3202.783] (-3209.528) * [-3204.707] (-3192.435) (-3204.902) (-3195.921) -- 0:01:26
      23000 -- [-3195.157] (-3204.825) (-3206.175) (-3201.722) * (-3203.041) (-3194.326) [-3204.888] (-3198.213) -- 0:01:24
      23500 -- (-3193.696) (-3201.787) (-3206.206) [-3199.493] * [-3201.515] (-3194.353) (-3204.798) (-3195.051) -- 0:01:23
      24000 -- (-3192.873) (-3192.813) [-3205.891] (-3196.921) * (-3206.720) [-3193.706] (-3201.981) (-3192.597) -- 0:01:21
      24500 -- (-3193.451) [-3196.211] (-3203.338) (-3203.718) * (-3203.001) [-3194.014] (-3206.032) (-3192.417) -- 0:01:19
      25000 -- (-3192.515) (-3196.194) [-3202.300] (-3208.382) * [-3196.674] (-3195.395) (-3204.742) (-3192.899) -- 0:01:18

      Average standard deviation of split frequencies: 0.040795

      25500 -- [-3192.721] (-3197.908) (-3200.202) (-3199.732) * (-3193.434) [-3191.712] (-3204.998) (-3192.304) -- 0:01:16
      26000 -- (-3194.125) (-3197.683) (-3199.825) [-3198.721] * (-3197.075) [-3191.956] (-3195.584) (-3194.416) -- 0:01:14
      26500 -- (-3194.514) [-3196.373] (-3197.044) (-3201.145) * [-3192.798] (-3192.356) (-3198.073) (-3195.311) -- 0:01:13
      27000 -- [-3191.568] (-3194.331) (-3207.185) (-3197.701) * (-3191.282) (-3194.278) [-3196.225] (-3197.877) -- 0:01:12
      27500 -- (-3192.553) (-3193.929) (-3199.433) [-3206.146] * [-3194.109] (-3194.411) (-3202.909) (-3196.831) -- 0:01:10
      28000 -- (-3191.650) (-3194.580) [-3198.450] (-3206.123) * (-3193.159) [-3195.520] (-3198.715) (-3198.054) -- 0:01:09
      28500 -- (-3191.648) (-3194.760) [-3198.236] (-3198.596) * (-3192.195) (-3195.085) (-3206.550) [-3196.042] -- 0:01:42
      29000 -- [-3192.086] (-3194.121) (-3199.501) (-3203.696) * (-3191.148) (-3194.811) (-3205.357) [-3194.650] -- 0:01:40
      29500 -- (-3191.542) [-3193.764] (-3200.872) (-3203.645) * (-3192.487) [-3195.813] (-3199.179) (-3192.967) -- 0:01:38
      30000 -- [-3191.013] (-3195.003) (-3199.884) (-3206.299) * [-3194.028] (-3197.562) (-3202.064) (-3192.508) -- 0:01:37

      Average standard deviation of split frequencies: 0.044578

      30500 -- (-3191.003) (-3193.962) (-3210.643) [-3207.347] * (-3193.422) (-3193.704) (-3209.969) [-3197.621] -- 0:01:35
      31000 -- [-3191.275] (-3193.081) (-3204.347) (-3203.156) * (-3192.050) (-3194.421) [-3199.851] (-3194.924) -- 0:01:33
      31500 -- [-3192.491] (-3194.064) (-3207.683) (-3195.418) * (-3196.613) (-3194.326) [-3207.281] (-3192.785) -- 0:01:32
      32000 -- (-3192.489) (-3193.252) [-3200.895] (-3198.687) * (-3196.839) [-3194.841] (-3202.478) (-3193.334) -- 0:01:30
      32500 -- (-3197.442) (-3197.753) [-3196.908] (-3199.117) * (-3193.646) [-3193.546] (-3205.776) (-3193.911) -- 0:01:29
      33000 -- (-3192.503) (-3196.512) (-3201.724) [-3208.393] * (-3193.866) (-3193.991) (-3206.694) [-3196.058] -- 0:01:27
      33500 -- [-3191.306] (-3195.643) (-3197.888) (-3213.380) * (-3194.069) (-3194.543) [-3196.409] (-3198.329) -- 0:01:26
      34000 -- (-3191.761) (-3192.018) [-3201.420] (-3203.291) * (-3193.224) (-3194.223) [-3204.316] (-3196.002) -- 0:01:25
      34500 -- (-3191.975) [-3192.111] (-3215.136) (-3201.860) * [-3194.104] (-3194.339) (-3201.600) (-3196.465) -- 0:01:23
      35000 -- [-3192.238] (-3195.646) (-3201.364) (-3200.820) * (-3194.937) [-3195.051] (-3208.462) (-3193.204) -- 0:01:22

      Average standard deviation of split frequencies: 0.045176

      35500 -- (-3192.238) (-3193.019) [-3203.476] (-3209.978) * [-3195.018] (-3198.965) (-3205.648) (-3193.798) -- 0:01:21
      36000 -- (-3192.502) [-3195.591] (-3199.341) (-3203.282) * (-3195.180) (-3193.291) (-3199.814) [-3195.329] -- 0:01:20
      36500 -- (-3192.502) [-3191.936] (-3201.638) (-3204.291) * [-3193.711] (-3193.366) (-3200.653) (-3192.562) -- 0:01:19
      37000 -- (-3192.708) [-3191.619] (-3205.357) (-3202.035) * (-3194.494) (-3193.372) (-3203.756) [-3192.771] -- 0:01:18
      37500 -- (-3196.283) (-3191.593) [-3200.344] (-3202.355) * (-3192.464) (-3193.536) [-3196.898] (-3193.360) -- 0:01:17
      38000 -- [-3196.445] (-3197.007) (-3208.051) (-3208.537) * [-3192.554] (-3193.867) (-3200.912) (-3196.192) -- 0:01:15
      38500 -- (-3194.035) (-3194.096) [-3206.950] (-3213.546) * (-3192.960) (-3193.870) [-3201.634] (-3192.744) -- 0:01:14
      39000 -- (-3193.681) (-3192.389) [-3203.544] (-3196.103) * (-3193.932) (-3195.171) [-3199.214] (-3192.078) -- 0:01:13
      39500 -- (-3193.248) (-3192.083) [-3196.485] (-3195.315) * (-3195.065) (-3195.171) (-3199.338) [-3192.035] -- 0:01:12
      40000 -- (-3193.362) [-3191.749] (-3211.842) (-3191.960) * (-3196.485) (-3193.455) [-3194.616] (-3196.059) -- 0:01:12

      Average standard deviation of split frequencies: 0.041860

      40500 -- [-3193.363] (-3192.593) (-3203.464) (-3191.778) * (-3193.471) (-3193.504) (-3202.041) [-3195.510] -- 0:01:11
      41000 -- [-3192.517] (-3193.370) (-3198.732) (-3191.404) * (-3191.975) (-3193.500) [-3206.620] (-3193.419) -- 0:01:10
      41500 -- (-3192.498) (-3193.497) [-3204.240] (-3191.465) * (-3193.637) (-3193.122) [-3200.913] (-3194.549) -- 0:01:09
      42000 -- (-3196.100) (-3191.562) [-3198.638] (-3191.462) * (-3193.857) [-3194.957] (-3201.179) (-3193.126) -- 0:01:08
      42500 -- (-3192.105) [-3191.562] (-3200.385) (-3191.330) * (-3192.886) (-3194.945) [-3203.372] (-3194.194) -- 0:01:30
      43000 -- (-3191.708) (-3192.763) (-3200.597) [-3191.447] * (-3194.353) (-3196.123) [-3203.196] (-3193.414) -- 0:01:29
      43500 -- (-3192.334) (-3192.777) (-3201.376) [-3192.115] * (-3194.964) (-3196.512) [-3203.460] (-3193.415) -- 0:01:27
      44000 -- (-3192.334) (-3192.778) [-3199.276] (-3191.945) * (-3193.282) (-3196.512) [-3206.044] (-3194.126) -- 0:01:26
      44500 -- [-3192.164] (-3192.166) (-3204.884) (-3192.020) * [-3191.729] (-3195.493) (-3207.756) (-3192.884) -- 0:01:25
      45000 -- (-3192.240) (-3192.166) (-3208.668) [-3195.468] * (-3195.503) (-3193.493) (-3200.429) [-3193.202] -- 0:01:24

      Average standard deviation of split frequencies: 0.038834

      45500 -- [-3192.260] (-3192.948) (-3199.589) (-3196.127) * (-3191.317) [-3195.280] (-3204.877) (-3194.952) -- 0:01:23
      46000 -- (-3192.418) [-3193.139] (-3210.533) (-3194.532) * (-3191.251) (-3196.130) (-3210.448) [-3193.795] -- 0:01:22
      46500 -- (-3193.215) (-3193.270) (-3200.346) [-3191.052] * (-3193.133) (-3195.328) (-3201.467) [-3193.895] -- 0:01:22
      47000 -- (-3192.068) (-3192.027) (-3200.390) [-3191.679] * (-3191.780) (-3193.749) [-3204.715] (-3193.937) -- 0:01:21
      47500 -- [-3192.068] (-3192.619) (-3206.789) (-3192.249) * (-3192.191) (-3192.899) (-3209.378) [-3193.112] -- 0:01:20
      48000 -- (-3192.685) (-3192.619) (-3203.598) [-3195.232] * (-3195.535) (-3192.775) (-3201.989) [-3192.667] -- 0:01:19
      48500 -- (-3191.903) [-3191.798] (-3202.943) (-3191.835) * (-3197.139) (-3193.985) (-3201.279) [-3192.250] -- 0:01:18
      49000 -- (-3192.856) (-3191.798) (-3205.685) [-3191.748] * (-3196.461) (-3195.201) [-3208.077] (-3192.352) -- 0:01:17
      49500 -- (-3192.784) (-3192.157) (-3204.466) [-3194.552] * (-3196.139) (-3195.189) (-3201.580) [-3192.384] -- 0:01:16
      50000 -- [-3193.993] (-3192.022) (-3202.729) (-3194.351) * (-3194.944) (-3194.636) (-3198.660) [-3194.852] -- 0:01:16

      Average standard deviation of split frequencies: 0.033960

      50500 -- (-3197.300) [-3192.057] (-3206.044) (-3194.255) * (-3194.082) [-3195.881] (-3200.949) (-3194.094) -- 0:01:15
      51000 -- [-3195.903] (-3192.503) (-3207.636) (-3193.948) * (-3194.786) (-3194.988) [-3207.384] (-3193.185) -- 0:01:14
      51500 -- (-3196.166) [-3192.969] (-3204.116) (-3193.631) * (-3192.857) (-3194.356) [-3200.098] (-3194.656) -- 0:01:13
      52000 -- (-3193.735) [-3192.826] (-3199.537) (-3193.631) * (-3192.816) [-3194.233] (-3204.917) (-3196.190) -- 0:01:12
      52500 -- [-3194.077] (-3193.277) (-3200.184) (-3193.938) * (-3193.284) [-3193.445] (-3207.809) (-3193.019) -- 0:01:12
      53000 -- [-3193.387] (-3192.987) (-3202.537) (-3191.763) * (-3193.886) (-3193.540) [-3202.625] (-3192.980) -- 0:01:11
      53500 -- [-3193.452] (-3192.492) (-3207.388) (-3193.929) * [-3193.684] (-3201.460) (-3201.866) (-3194.295) -- 0:01:10
      54000 -- (-3194.092) (-3192.706) [-3200.290] (-3194.336) * (-3193.773) (-3197.146) (-3211.931) [-3195.790] -- 0:01:10
      54500 -- (-3193.037) (-3192.632) [-3198.568] (-3193.567) * (-3193.327) (-3198.595) (-3204.828) [-3193.401] -- 0:01:09
      55000 -- (-3193.643) (-3193.981) [-3198.732] (-3192.536) * (-3194.167) (-3194.543) (-3207.687) [-3193.460] -- 0:01:08

      Average standard deviation of split frequencies: 0.031691

      55500 -- [-3193.572] (-3203.714) (-3202.265) (-3192.363) * (-3193.935) (-3196.068) [-3206.062] (-3192.504) -- 0:01:25
      56000 -- (-3194.933) (-3198.887) (-3206.427) [-3192.128] * [-3193.747] (-3195.791) (-3209.270) (-3196.074) -- 0:01:24
      56500 -- (-3193.692) (-3198.004) [-3200.704] (-3191.193) * (-3195.279) (-3194.601) (-3204.504) [-3194.149] -- 0:01:23
      57000 -- (-3192.663) [-3193.366] (-3204.315) (-3191.193) * [-3192.887] (-3192.801) (-3206.353) (-3194.060) -- 0:01:22
      57500 -- (-3195.738) [-3199.502] (-3193.726) (-3191.214) * (-3193.279) [-3192.781] (-3202.529) (-3195.191) -- 0:01:21
      58000 -- [-3197.350] (-3193.219) (-3192.503) (-3192.411) * (-3194.980) (-3191.829) [-3198.304] (-3196.453) -- 0:01:21
      58500 -- (-3192.740) (-3193.054) (-3192.880) [-3192.462] * (-3193.282) [-3192.605] (-3203.939) (-3194.063) -- 0:01:20
      59000 -- (-3193.395) [-3193.328] (-3195.216) (-3192.752) * (-3193.926) (-3193.608) [-3200.592] (-3193.502) -- 0:01:19
      59500 -- (-3193.094) (-3193.229) [-3192.024] (-3192.382) * (-3196.873) (-3192.376) [-3200.357] (-3193.890) -- 0:01:19
      60000 -- (-3192.714) (-3193.237) (-3192.594) [-3191.878] * (-3195.121) [-3194.260] (-3206.262) (-3192.733) -- 0:01:18

      Average standard deviation of split frequencies: 0.033535

      60500 -- [-3192.711] (-3194.083) (-3193.177) (-3192.458) * (-3197.686) [-3195.965] (-3205.056) (-3193.362) -- 0:01:17
      61000 -- (-3193.661) (-3194.212) (-3193.830) [-3191.912] * (-3196.218) [-3191.305] (-3201.708) (-3192.285) -- 0:01:16
      61500 -- (-3194.359) (-3194.212) (-3192.720) [-3191.686] * (-3191.542) (-3194.374) [-3201.823] (-3193.377) -- 0:01:16
      62000 -- (-3199.821) [-3195.988] (-3192.720) (-3191.681) * (-3191.884) (-3192.621) (-3196.619) [-3191.703] -- 0:01:15
      62500 -- (-3195.124) (-3193.748) (-3192.435) [-3194.826] * (-3192.567) [-3192.622] (-3207.165) (-3192.965) -- 0:01:15
      63000 -- (-3193.224) (-3193.669) [-3192.103] (-3191.973) * (-3192.482) (-3191.151) [-3203.792] (-3191.865) -- 0:01:14
      63500 -- (-3193.879) (-3193.986) (-3195.023) [-3193.363] * (-3192.591) (-3191.193) [-3194.870] (-3191.865) -- 0:01:13
      64000 -- [-3193.384] (-3193.696) (-3193.002) (-3193.672) * (-3192.592) (-3191.498) (-3202.087) [-3191.865] -- 0:01:13
      64500 -- (-3193.597) [-3193.103] (-3192.989) (-3193.033) * (-3192.469) (-3191.207) [-3209.608] (-3191.514) -- 0:01:12
      65000 -- (-3192.775) (-3193.247) [-3193.264] (-3196.885) * [-3196.041] (-3190.959) (-3198.611) (-3192.210) -- 0:01:11

      Average standard deviation of split frequencies: 0.033570

      65500 -- (-3194.167) (-3195.370) (-3192.932) [-3192.656] * (-3195.369) [-3191.956] (-3198.331) (-3192.416) -- 0:01:11
      66000 -- (-3192.185) [-3195.457] (-3193.063) (-3195.149) * (-3193.841) (-3191.037) [-3197.007] (-3194.415) -- 0:01:10
      66500 -- (-3192.660) (-3195.670) (-3193.063) [-3193.451] * (-3193.099) (-3191.878) [-3199.014] (-3193.687) -- 0:01:10
      67000 -- (-3193.056) (-3194.524) (-3196.472) [-3192.718] * [-3192.519] (-3194.763) (-3206.309) (-3193.763) -- 0:01:09
      67500 -- [-3193.541] (-3194.502) (-3196.038) (-3192.819) * [-3192.226] (-3197.724) (-3199.290) (-3193.717) -- 0:01:09
      68000 -- [-3192.092] (-3194.448) (-3195.083) (-3191.988) * (-3193.119) (-3196.241) [-3198.510] (-3194.872) -- 0:01:08
      68500 -- (-3192.982) [-3194.037] (-3195.039) (-3193.614) * (-3193.870) [-3194.796] (-3202.302) (-3192.611) -- 0:01:07
      69000 -- [-3192.982] (-3193.341) (-3191.837) (-3194.339) * (-3193.667) (-3195.105) (-3198.251) [-3192.589] -- 0:01:07
      69500 -- (-3192.730) (-3192.287) [-3192.283] (-3194.397) * (-3193.335) (-3193.186) (-3207.876) [-3191.725] -- 0:01:20
      70000 -- (-3192.929) (-3195.175) [-3193.161] (-3196.526) * (-3193.601) (-3192.683) (-3207.960) [-3192.696] -- 0:01:19

      Average standard deviation of split frequencies: 0.028685

      70500 -- (-3191.875) (-3194.129) [-3192.845] (-3193.417) * (-3193.607) (-3192.681) (-3204.708) [-3191.319] -- 0:01:19
      71000 -- [-3192.630] (-3195.501) (-3192.977) (-3195.053) * (-3192.991) [-3192.825] (-3215.894) (-3192.248) -- 0:01:18
      71500 -- (-3193.137) (-3195.085) [-3192.352] (-3195.266) * (-3192.048) (-3194.633) [-3200.296] (-3196.145) -- 0:01:17
      72000 -- [-3192.850] (-3196.665) (-3192.503) (-3194.562) * (-3191.725) [-3194.672] (-3202.741) (-3191.245) -- 0:01:17
      72500 -- [-3192.662] (-3197.392) (-3192.493) (-3195.006) * [-3192.368] (-3192.235) (-3207.455) (-3191.227) -- 0:01:16
      73000 -- [-3192.563] (-3194.386) (-3194.555) (-3194.842) * (-3197.636) [-3192.009] (-3205.158) (-3193.645) -- 0:01:16
      73500 -- (-3194.688) (-3194.870) [-3191.741] (-3194.530) * [-3196.955] (-3191.846) (-3204.179) (-3195.215) -- 0:01:15
      74000 -- (-3191.791) (-3194.552) [-3192.386] (-3194.502) * (-3195.034) [-3192.234] (-3207.005) (-3195.204) -- 0:01:15
      74500 -- (-3192.026) [-3192.249] (-3191.985) (-3193.890) * (-3196.085) [-3192.778] (-3199.049) (-3194.812) -- 0:01:14
      75000 -- (-3191.880) (-3193.730) [-3193.866] (-3194.361) * (-3193.415) (-3193.711) (-3208.476) [-3193.679] -- 0:01:14

      Average standard deviation of split frequencies: 0.027749

      75500 -- [-3192.887] (-3194.266) (-3194.706) (-3194.556) * [-3193.693] (-3192.973) (-3202.354) (-3192.130) -- 0:01:13
      76000 -- (-3192.359) [-3191.969] (-3195.460) (-3194.641) * [-3193.973] (-3192.518) (-3209.367) (-3192.927) -- 0:01:12
      76500 -- (-3192.359) (-3192.038) [-3192.802] (-3199.188) * (-3194.782) (-3193.050) (-3201.492) [-3193.802] -- 0:01:12
      77000 -- (-3194.880) [-3191.850] (-3193.493) (-3195.668) * (-3193.094) [-3192.456] (-3200.343) (-3195.082) -- 0:01:11
      77500 -- (-3192.155) (-3191.813) (-3192.230) [-3194.459] * [-3192.769] (-3192.374) (-3200.124) (-3192.887) -- 0:01:11
      78000 -- (-3194.566) [-3192.130] (-3191.573) (-3193.509) * [-3195.127] (-3191.874) (-3192.809) (-3196.092) -- 0:01:10
      78500 -- (-3193.572) (-3192.895) (-3193.392) [-3192.545] * (-3193.082) (-3191.800) [-3191.644] (-3192.297) -- 0:01:10
      79000 -- (-3195.586) [-3197.482] (-3192.615) (-3192.499) * [-3191.883] (-3192.647) (-3191.588) (-3193.089) -- 0:01:09
      79500 -- (-3193.650) [-3193.831] (-3192.941) (-3196.074) * [-3191.265] (-3192.599) (-3191.814) (-3193.094) -- 0:01:09
      80000 -- [-3193.650] (-3195.047) (-3190.967) (-3194.466) * (-3194.218) [-3191.995] (-3193.094) (-3193.103) -- 0:01:09

      Average standard deviation of split frequencies: 0.027681

      80500 -- (-3191.551) (-3206.128) (-3191.531) [-3195.302] * (-3192.891) [-3192.076] (-3191.412) (-3192.517) -- 0:01:08
      81000 -- [-3191.551] (-3199.272) (-3193.657) (-3194.719) * (-3194.010) [-3192.076] (-3194.079) (-3192.010) -- 0:01:08
      81500 -- (-3191.571) (-3198.869) [-3195.042] (-3193.506) * (-3193.303) [-3191.298] (-3195.444) (-3191.705) -- 0:01:07
      82000 -- (-3191.640) (-3198.869) (-3195.421) [-3193.451] * [-3193.311] (-3191.298) (-3192.262) (-3192.321) -- 0:01:07
      82500 -- [-3192.181] (-3202.633) (-3190.932) (-3194.110) * [-3196.746] (-3191.298) (-3192.430) (-3195.749) -- 0:01:06
      83000 -- (-3195.885) (-3199.345) [-3191.961] (-3197.120) * (-3199.230) [-3191.231] (-3194.129) (-3198.314) -- 0:01:17
      83500 -- [-3192.590] (-3200.348) (-3191.483) (-3197.109) * (-3199.826) [-3192.936] (-3192.355) (-3192.194) -- 0:01:16
      84000 -- [-3194.467] (-3198.971) (-3192.159) (-3195.745) * (-3198.297) [-3196.010] (-3191.998) (-3192.568) -- 0:01:16
      84500 -- (-3194.467) (-3200.704) [-3191.613] (-3195.680) * (-3191.800) (-3200.411) [-3191.989] (-3191.163) -- 0:01:15
      85000 -- [-3192.254] (-3194.010) (-3193.092) (-3196.619) * (-3193.918) (-3198.423) (-3192.444) [-3191.455] -- 0:01:15

      Average standard deviation of split frequencies: 0.027681

      85500 -- (-3193.226) (-3193.970) [-3191.877] (-3193.262) * [-3191.907] (-3196.992) (-3191.795) (-3192.684) -- 0:01:14
      86000 -- (-3193.445) (-3197.616) [-3191.518] (-3193.353) * [-3191.906] (-3197.935) (-3193.557) (-3193.708) -- 0:01:14
      86500 -- (-3192.441) (-3192.975) [-3191.518] (-3193.309) * (-3193.801) (-3196.615) (-3193.138) [-3192.829] -- 0:01:13
      87000 -- (-3192.893) [-3192.792] (-3191.500) (-3193.329) * (-3192.677) (-3195.947) (-3193.559) [-3193.423] -- 0:01:13
      87500 -- (-3193.392) (-3192.769) [-3191.355] (-3193.045) * (-3192.457) (-3192.391) (-3191.530) [-3191.855] -- 0:01:13
      88000 -- (-3193.392) [-3195.198] (-3191.856) (-3194.972) * (-3195.131) (-3192.768) [-3197.394] (-3191.975) -- 0:01:12
      88500 -- [-3191.333] (-3193.941) (-3192.980) (-3197.039) * (-3196.285) (-3192.683) (-3191.776) [-3191.730] -- 0:01:12
      89000 -- (-3191.334) (-3194.041) (-3193.202) [-3195.695] * (-3194.379) [-3191.232] (-3193.973) (-3193.187) -- 0:01:11
      89500 -- [-3192.013] (-3194.774) (-3192.636) (-3196.457) * (-3192.712) (-3192.115) [-3192.732] (-3192.569) -- 0:01:11
      90000 -- (-3191.640) (-3196.310) [-3195.576] (-3195.503) * (-3194.205) [-3193.298] (-3193.251) (-3191.972) -- 0:01:10

      Average standard deviation of split frequencies: 0.027296

      90500 -- [-3192.290] (-3198.523) (-3192.778) (-3192.353) * (-3191.972) [-3198.289] (-3192.735) (-3193.115) -- 0:01:10
      91000 -- [-3193.118] (-3193.031) (-3191.991) (-3191.765) * [-3191.727] (-3198.791) (-3193.012) (-3196.951) -- 0:01:09
      91500 -- [-3196.105] (-3193.348) (-3191.986) (-3191.765) * [-3192.521] (-3193.292) (-3192.602) (-3194.837) -- 0:01:09
      92000 -- (-3193.420) (-3193.528) (-3191.605) [-3191.343] * [-3192.497] (-3196.807) (-3194.093) (-3193.395) -- 0:01:09
      92500 -- (-3193.727) (-3194.985) [-3191.536] (-3191.595) * (-3193.757) [-3201.771] (-3193.397) (-3193.346) -- 0:01:08
      93000 -- (-3196.380) (-3193.202) (-3191.550) [-3191.592] * [-3195.637] (-3201.901) (-3192.318) (-3193.324) -- 0:01:08
      93500 -- (-3196.189) (-3194.547) (-3191.551) [-3191.872] * [-3194.221] (-3192.117) (-3192.132) (-3192.805) -- 0:01:07
      94000 -- (-3196.314) (-3195.478) (-3191.485) [-3193.922] * (-3195.596) (-3191.818) [-3191.973] (-3192.803) -- 0:01:07
      94500 -- (-3196.463) (-3192.791) [-3192.057] (-3193.660) * (-3193.119) [-3191.816] (-3192.848) (-3191.618) -- 0:01:07
      95000 -- (-3194.504) [-3194.449] (-3191.657) (-3192.580) * (-3193.515) [-3191.725] (-3192.427) (-3192.538) -- 0:01:06

      Average standard deviation of split frequencies: 0.027990

      95500 -- (-3194.978) (-3197.053) (-3192.769) [-3193.492] * (-3191.760) [-3191.724] (-3195.800) (-3192.547) -- 0:01:06
      96000 -- (-3193.352) [-3194.159] (-3191.873) (-3197.560) * (-3193.514) [-3191.420] (-3194.712) (-3192.753) -- 0:01:05
      96500 -- (-3193.006) (-3193.178) [-3191.766] (-3193.712) * [-3194.575] (-3191.242) (-3194.628) (-3191.923) -- 0:01:05
      97000 -- (-3192.728) (-3193.178) [-3191.746] (-3191.931) * (-3192.383) (-3193.052) (-3194.861) [-3192.399] -- 0:01:14
      97500 -- (-3192.601) [-3193.400] (-3192.051) (-3192.654) * (-3196.311) (-3193.202) (-3193.501) [-3193.462] -- 0:01:14
      98000 -- (-3196.270) (-3196.229) [-3191.719] (-3194.788) * (-3192.148) (-3191.996) (-3193.202) [-3191.850] -- 0:01:13
      98500 -- [-3193.764] (-3191.891) (-3192.471) (-3194.189) * (-3198.940) (-3191.914) [-3193.674] (-3193.515) -- 0:01:13
      99000 -- [-3194.698] (-3192.151) (-3197.473) (-3196.147) * (-3194.614) (-3191.603) (-3196.298) [-3192.954] -- 0:01:12
      99500 -- [-3194.013] (-3193.487) (-3195.679) (-3194.099) * (-3194.154) (-3191.603) (-3198.170) [-3195.264] -- 0:01:12
      100000 -- (-3194.672) [-3191.604] (-3192.150) (-3191.606) * (-3195.086) [-3193.285] (-3198.412) (-3192.692) -- 0:01:12

      Average standard deviation of split frequencies: 0.028799

      100500 -- (-3195.610) (-3197.232) (-3191.729) [-3191.601] * (-3194.508) [-3193.800] (-3198.211) (-3192.413) -- 0:01:11
      101000 -- (-3196.412) (-3197.097) (-3191.800) [-3191.304] * (-3193.528) (-3193.801) (-3200.298) [-3193.419] -- 0:01:11
      101500 -- (-3198.160) (-3195.571) (-3193.265) [-3193.832] * [-3194.840] (-3194.105) (-3199.316) (-3196.168) -- 0:01:10
      102000 -- (-3192.642) [-3194.105] (-3193.332) (-3193.554) * (-3194.124) (-3194.768) (-3193.533) [-3193.413] -- 0:01:10
      102500 -- (-3192.539) (-3194.087) (-3193.761) [-3195.523] * (-3191.681) [-3196.443] (-3193.120) (-3193.195) -- 0:01:10
      103000 -- (-3193.059) [-3192.155] (-3196.381) (-3191.793) * (-3192.941) (-3197.941) [-3192.676] (-3193.551) -- 0:01:09
      103500 -- (-3193.095) (-3197.267) (-3193.575) [-3191.850] * (-3193.077) [-3196.588] (-3192.445) (-3192.847) -- 0:01:09
      104000 -- [-3193.225] (-3193.434) (-3195.249) (-3192.104) * (-3194.330) (-3194.454) (-3193.001) [-3192.558] -- 0:01:08
      104500 -- (-3192.835) [-3194.946] (-3192.317) (-3194.975) * (-3193.295) (-3197.272) [-3194.152] (-3196.035) -- 0:01:08
      105000 -- (-3193.275) (-3196.739) (-3194.259) [-3194.412] * (-3192.611) (-3197.238) (-3192.823) [-3195.529] -- 0:01:08

      Average standard deviation of split frequencies: 0.025349

      105500 -- (-3193.102) [-3195.701] (-3193.692) (-3193.310) * (-3192.611) (-3196.317) [-3195.501] (-3191.903) -- 0:01:07
      106000 -- [-3193.718] (-3195.845) (-3196.866) (-3193.117) * (-3193.974) [-3195.244] (-3194.914) (-3193.875) -- 0:01:07
      106500 -- [-3192.437] (-3192.407) (-3196.260) (-3195.684) * (-3193.881) (-3194.198) (-3193.058) [-3192.050] -- 0:01:07
      107000 -- (-3194.062) (-3194.240) [-3194.209] (-3193.740) * [-3194.736] (-3196.813) (-3194.314) (-3192.814) -- 0:01:06
      107500 -- [-3192.794] (-3193.394) (-3194.937) (-3193.206) * (-3194.012) (-3197.741) (-3193.309) [-3192.642] -- 0:01:06
      108000 -- (-3192.872) (-3193.453) (-3192.721) [-3191.846] * (-3194.617) (-3194.942) [-3191.604] (-3195.544) -- 0:01:06
      108500 -- [-3193.167] (-3194.494) (-3191.324) (-3193.101) * (-3193.744) (-3194.601) (-3191.521) [-3199.952] -- 0:01:05
      109000 -- (-3195.169) (-3194.459) (-3191.948) [-3193.593] * (-3191.419) (-3194.032) (-3193.729) [-3193.118] -- 0:01:05
      109500 -- (-3193.059) [-3195.063] (-3192.383) (-3194.588) * (-3191.999) (-3191.978) (-3192.171) [-3193.406] -- 0:01:05
      110000 -- (-3193.037) (-3193.642) (-3191.691) [-3192.531] * (-3194.925) (-3192.103) [-3191.711] (-3193.573) -- 0:01:04

      Average standard deviation of split frequencies: 0.023641

      110500 -- [-3192.042] (-3194.365) (-3191.685) (-3192.504) * [-3191.813] (-3195.096) (-3191.767) (-3197.929) -- 0:01:04
      111000 -- (-3192.130) (-3195.411) [-3191.241] (-3192.087) * (-3191.897) (-3195.922) (-3193.077) [-3195.554] -- 0:01:12
      111500 -- (-3192.026) (-3192.921) [-3191.635] (-3192.102) * [-3192.303] (-3197.914) (-3192.742) (-3196.608) -- 0:01:11
      112000 -- (-3192.094) (-3196.722) (-3191.948) [-3192.089] * [-3192.176] (-3195.575) (-3192.479) (-3200.362) -- 0:01:11
      112500 -- [-3192.249] (-3198.331) (-3193.408) (-3191.841) * (-3191.899) (-3199.214) [-3192.398] (-3192.772) -- 0:01:11
      113000 -- (-3192.772) [-3193.516] (-3194.679) (-3191.841) * (-3192.074) [-3196.388] (-3192.773) (-3193.010) -- 0:01:10
      113500 -- (-3194.430) (-3193.345) [-3193.398] (-3192.014) * (-3194.118) (-3195.981) (-3194.050) [-3193.750] -- 0:01:10
      114000 -- (-3193.314) (-3191.525) [-3192.849] (-3191.420) * [-3192.610] (-3200.829) (-3192.507) (-3193.812) -- 0:01:09
      114500 -- [-3196.347] (-3191.450) (-3192.630) (-3193.106) * (-3192.069) [-3196.880] (-3193.570) (-3193.103) -- 0:01:09
      115000 -- (-3193.933) (-3192.222) (-3192.420) [-3191.324] * (-3194.627) (-3195.223) (-3192.702) [-3193.963] -- 0:01:09

      Average standard deviation of split frequencies: 0.024609

      115500 -- [-3194.014] (-3193.208) (-3192.559) (-3193.176) * (-3192.402) [-3191.656] (-3194.356) (-3193.236) -- 0:01:08
      116000 -- [-3194.040] (-3193.243) (-3192.834) (-3191.658) * (-3192.087) (-3195.113) (-3194.518) [-3193.140] -- 0:01:08
      116500 -- (-3192.274) [-3192.602] (-3192.629) (-3193.585) * [-3191.981] (-3193.982) (-3194.273) (-3193.560) -- 0:01:08
      117000 -- [-3192.347] (-3192.189) (-3194.455) (-3191.597) * [-3191.747] (-3199.356) (-3196.100) (-3193.167) -- 0:01:07
      117500 -- (-3192.548) (-3191.811) (-3193.166) [-3191.959] * [-3191.808] (-3201.145) (-3196.798) (-3192.550) -- 0:01:07
      118000 -- (-3192.120) (-3192.235) (-3192.611) [-3192.780] * (-3192.067) (-3194.339) (-3194.625) [-3192.935] -- 0:01:07
      118500 -- [-3192.037] (-3191.788) (-3192.728) (-3191.224) * (-3191.944) (-3196.584) (-3196.644) [-3194.433] -- 0:01:06
      119000 -- (-3192.039) (-3192.592) [-3192.459] (-3191.909) * (-3191.938) (-3197.402) [-3198.085] (-3194.801) -- 0:01:06
      119500 -- [-3192.749] (-3192.796) (-3192.459) (-3190.946) * (-3191.920) [-3194.810] (-3193.328) (-3197.181) -- 0:01:06
      120000 -- [-3192.713] (-3191.737) (-3193.514) (-3191.295) * (-3193.108) (-3194.326) [-3193.006] (-3195.354) -- 0:01:06

      Average standard deviation of split frequencies: 0.022001

      120500 -- (-3192.552) [-3191.737] (-3196.524) (-3191.258) * (-3194.202) (-3195.523) (-3192.785) [-3195.522] -- 0:01:05
      121000 -- [-3191.956] (-3191.734) (-3193.420) (-3193.118) * [-3191.937] (-3195.297) (-3192.728) (-3196.329) -- 0:01:05
      121500 -- (-3192.820) [-3191.737] (-3193.408) (-3195.026) * [-3193.245] (-3193.486) (-3193.164) (-3195.240) -- 0:01:05
      122000 -- (-3196.974) (-3192.924) [-3192.894] (-3193.690) * [-3191.710] (-3196.620) (-3191.813) (-3194.608) -- 0:01:04
      122500 -- (-3196.267) [-3194.967] (-3192.946) (-3193.659) * (-3191.699) (-3195.651) (-3194.462) [-3193.657] -- 0:01:04
      123000 -- (-3198.210) (-3195.056) [-3192.088] (-3193.302) * (-3192.975) [-3194.952] (-3194.090) (-3195.167) -- 0:01:04
      123500 -- (-3200.282) [-3197.496] (-3193.862) (-3194.111) * [-3191.334] (-3194.472) (-3191.556) (-3195.761) -- 0:01:03
      124000 -- (-3201.278) (-3194.128) [-3192.443] (-3193.494) * [-3191.236] (-3193.983) (-3192.562) (-3192.444) -- 0:01:03
      124500 -- (-3198.307) (-3194.463) (-3194.131) [-3194.084] * (-3191.662) (-3191.410) [-3192.878] (-3193.075) -- 0:01:03
      125000 -- [-3195.930] (-3193.946) (-3193.484) (-3193.301) * [-3191.677] (-3195.995) (-3196.257) (-3193.242) -- 0:01:03

      Average standard deviation of split frequencies: 0.020764

      125500 -- (-3193.467) (-3194.159) (-3194.038) [-3193.121] * (-3191.388) (-3195.905) (-3194.150) [-3194.192] -- 0:01:09
      126000 -- (-3195.524) (-3193.385) [-3193.441] (-3192.455) * (-3191.223) (-3197.242) (-3193.353) [-3193.838] -- 0:01:09
      126500 -- (-3194.052) (-3193.953) [-3193.884] (-3191.977) * (-3191.953) (-3193.184) [-3193.393] (-3194.846) -- 0:01:09
      127000 -- (-3193.966) [-3193.899] (-3194.754) (-3192.093) * (-3191.944) [-3193.196] (-3194.018) (-3194.809) -- 0:01:08
      127500 -- (-3192.505) [-3194.267] (-3191.370) (-3194.952) * (-3192.778) [-3193.061] (-3193.973) (-3193.941) -- 0:01:08
      128000 -- (-3192.868) [-3195.533] (-3193.756) (-3192.522) * (-3195.622) (-3195.035) (-3193.355) [-3192.859] -- 0:01:08
      128500 -- (-3193.204) (-3193.059) (-3191.846) [-3191.874] * (-3194.277) (-3196.560) (-3193.534) [-3194.862] -- 0:01:07
      129000 -- [-3194.996] (-3192.043) (-3192.850) (-3191.877) * [-3193.530] (-3194.481) (-3193.285) (-3195.176) -- 0:01:07
      129500 -- [-3196.922] (-3192.044) (-3192.893) (-3193.189) * [-3192.796] (-3193.404) (-3193.407) (-3191.845) -- 0:01:07
      130000 -- (-3194.320) (-3192.868) (-3193.930) [-3192.712] * [-3196.004] (-3194.614) (-3193.672) (-3192.593) -- 0:01:06

      Average standard deviation of split frequencies: 0.020203

      130500 -- [-3195.165] (-3192.932) (-3192.695) (-3192.005) * (-3197.290) [-3195.603] (-3194.126) (-3196.135) -- 0:01:06
      131000 -- [-3196.048] (-3192.249) (-3192.059) (-3192.118) * (-3193.573) (-3196.520) (-3192.936) [-3193.485] -- 0:01:06
      131500 -- (-3197.066) (-3193.274) (-3192.422) [-3194.069] * (-3194.166) (-3198.589) [-3193.495] (-3193.082) -- 0:01:06
      132000 -- (-3198.753) (-3192.730) (-3192.625) [-3193.709] * [-3193.084] (-3195.887) (-3193.286) (-3193.277) -- 0:01:05
      132500 -- [-3193.649] (-3195.728) (-3193.257) (-3193.048) * [-3192.370] (-3195.031) (-3192.070) (-3193.498) -- 0:01:05
      133000 -- (-3195.874) (-3193.710) [-3192.291] (-3192.776) * (-3194.064) (-3194.516) (-3193.633) [-3194.208] -- 0:01:05
      133500 -- (-3194.464) [-3193.958] (-3192.158) (-3192.958) * (-3193.309) (-3193.423) (-3193.762) [-3193.864] -- 0:01:04
      134000 -- (-3199.318) (-3192.326) (-3193.824) [-3195.419] * (-3193.710) [-3192.399] (-3197.820) (-3192.991) -- 0:01:04
      134500 -- (-3196.821) (-3193.090) (-3192.380) [-3193.079] * (-3194.671) (-3192.173) [-3194.953] (-3194.960) -- 0:01:04
      135000 -- [-3193.565] (-3194.701) (-3193.696) (-3194.240) * (-3194.017) (-3194.074) [-3193.873] (-3196.104) -- 0:01:04

      Average standard deviation of split frequencies: 0.019064

      135500 -- (-3195.892) (-3191.733) (-3191.763) [-3192.858] * (-3194.388) [-3193.803] (-3193.925) (-3197.021) -- 0:01:03
      136000 -- (-3191.968) [-3192.324] (-3191.770) (-3192.945) * (-3193.259) (-3193.716) [-3194.600] (-3197.027) -- 0:01:03
      136500 -- (-3194.255) (-3192.411) [-3193.447] (-3192.666) * [-3193.436] (-3196.346) (-3196.541) (-3195.863) -- 0:01:03
      137000 -- (-3191.631) [-3192.367] (-3194.235) (-3193.261) * [-3192.918] (-3193.478) (-3197.799) (-3195.216) -- 0:01:02
      137500 -- (-3191.810) (-3192.075) (-3193.551) [-3192.185] * (-3192.744) (-3193.258) [-3194.292] (-3194.995) -- 0:01:02
      138000 -- (-3192.389) (-3191.729) (-3194.390) [-3192.023] * (-3193.618) [-3194.927] (-3192.981) (-3192.567) -- 0:01:02
      138500 -- (-3191.980) [-3191.733] (-3192.526) (-3192.368) * (-3195.061) (-3193.968) [-3192.561] (-3192.919) -- 0:01:02
      139000 -- (-3195.274) [-3193.726] (-3191.653) (-3192.006) * (-3199.978) (-3194.715) (-3192.382) [-3192.869] -- 0:01:08
      139500 -- (-3191.247) [-3193.297] (-3191.377) (-3192.344) * (-3199.359) [-3192.900] (-3192.943) (-3195.102) -- 0:01:07
      140000 -- [-3191.125] (-3192.424) (-3194.091) (-3192.344) * [-3197.253] (-3194.611) (-3192.536) (-3195.053) -- 0:01:07

      Average standard deviation of split frequencies: 0.019176

      140500 -- [-3191.125] (-3191.959) (-3193.577) (-3191.862) * (-3194.873) [-3192.759] (-3192.374) (-3191.624) -- 0:01:07
      141000 -- (-3192.756) (-3193.649) (-3194.034) [-3194.425] * (-3193.662) [-3193.614] (-3192.630) (-3195.895) -- 0:01:07
      141500 -- (-3192.984) (-3196.622) (-3192.548) [-3194.162] * (-3196.265) [-3193.551] (-3193.443) (-3192.080) -- 0:01:06
      142000 -- (-3194.201) (-3191.513) (-3192.564) [-3193.586] * (-3196.459) (-3195.193) [-3193.455] (-3191.763) -- 0:01:06
      142500 -- (-3194.167) (-3191.497) [-3193.911] (-3193.198) * (-3193.992) (-3196.424) (-3196.299) [-3191.768] -- 0:01:06
      143000 -- [-3192.657] (-3192.876) (-3193.898) (-3193.402) * (-3193.199) (-3195.675) (-3191.650) [-3191.617] -- 0:01:05
      143500 -- (-3192.149) (-3192.875) (-3192.057) [-3194.629] * [-3192.042] (-3193.448) (-3193.613) (-3192.389) -- 0:01:05
      144000 -- (-3192.425) (-3191.142) [-3191.900] (-3193.596) * (-3192.404) (-3192.210) (-3192.846) [-3191.689] -- 0:01:05
      144500 -- [-3197.167] (-3192.637) (-3191.750) (-3194.894) * (-3192.036) (-3193.574) [-3195.207] (-3191.591) -- 0:01:05
      145000 -- [-3193.339] (-3194.634) (-3194.228) (-3193.568) * (-3192.470) (-3194.984) (-3195.081) [-3191.320] -- 0:01:04

      Average standard deviation of split frequencies: 0.019883

      145500 -- (-3193.646) [-3194.778] (-3192.989) (-3193.748) * (-3191.861) (-3194.625) (-3192.942) [-3191.514] -- 0:01:04
      146000 -- [-3191.327] (-3193.347) (-3192.946) (-3196.408) * (-3191.924) (-3197.064) [-3193.124] (-3191.076) -- 0:01:04
      146500 -- (-3191.550) [-3192.992] (-3195.415) (-3196.424) * (-3192.601) [-3197.183] (-3191.589) (-3191.076) -- 0:01:04
      147000 -- (-3196.980) (-3192.251) [-3193.142] (-3194.884) * (-3191.603) (-3195.101) (-3191.467) [-3192.604] -- 0:01:03
      147500 -- [-3195.255] (-3192.242) (-3192.164) (-3195.533) * [-3192.305] (-3192.715) (-3191.891) (-3194.156) -- 0:01:03
      148000 -- (-3194.394) (-3193.861) [-3192.697] (-3195.962) * [-3191.520] (-3192.795) (-3192.007) (-3193.465) -- 0:01:03
      148500 -- (-3192.166) (-3195.316) [-3192.570] (-3195.418) * (-3191.533) (-3193.722) (-3193.287) [-3193.469] -- 0:01:03
      149000 -- (-3192.828) (-3195.647) [-3191.795] (-3194.649) * (-3192.026) (-3195.613) [-3192.092] (-3193.290) -- 0:01:02
      149500 -- (-3192.768) (-3194.774) (-3194.455) [-3194.352] * [-3193.894] (-3194.489) (-3192.078) (-3192.804) -- 0:01:02
      150000 -- (-3194.634) (-3194.089) [-3192.952] (-3196.544) * (-3193.894) (-3194.326) [-3191.920] (-3194.202) -- 0:01:02

      Average standard deviation of split frequencies: 0.020024

      150500 -- (-3199.408) (-3194.541) [-3195.404] (-3196.601) * (-3191.663) (-3194.323) (-3191.940) [-3194.645] -- 0:01:02
      151000 -- (-3195.432) [-3193.379] (-3193.175) (-3193.250) * (-3191.481) (-3194.647) [-3193.153] (-3194.192) -- 0:01:01
      151500 -- (-3194.781) (-3196.635) [-3193.478] (-3193.085) * (-3197.334) (-3197.315) [-3192.671] (-3195.748) -- 0:01:01
      152000 -- (-3193.222) [-3195.240] (-3195.182) (-3193.722) * [-3191.714] (-3197.290) (-3193.019) (-3192.940) -- 0:01:01
      152500 -- (-3193.234) (-3191.983) [-3192.792] (-3192.873) * [-3192.898] (-3196.762) (-3193.087) (-3194.568) -- 0:01:01
      153000 -- (-3198.131) [-3191.769] (-3195.707) (-3193.315) * [-3194.517] (-3197.699) (-3193.276) (-3191.559) -- 0:01:06
      153500 -- (-3196.632) [-3193.018] (-3197.437) (-3194.766) * [-3193.459] (-3195.743) (-3192.125) (-3191.559) -- 0:01:06
      154000 -- (-3197.316) (-3193.493) [-3197.473] (-3194.743) * (-3192.493) (-3196.897) (-3194.342) [-3191.559] -- 0:01:05
      154500 -- (-3196.655) (-3192.651) (-3197.080) [-3194.048] * [-3193.478] (-3194.356) (-3194.342) (-3192.185) -- 0:01:05
      155000 -- [-3196.536] (-3193.251) (-3196.878) (-3195.164) * (-3193.541) (-3193.987) (-3193.331) [-3191.534] -- 0:01:05

      Average standard deviation of split frequencies: 0.020517

      155500 -- [-3194.725] (-3191.951) (-3196.359) (-3196.415) * (-3194.472) (-3193.711) [-3193.981] (-3191.366) -- 0:01:05
      156000 -- (-3196.553) (-3193.468) [-3193.948] (-3195.389) * (-3196.369) (-3192.578) (-3192.968) [-3192.263] -- 0:01:04
      156500 -- (-3196.254) [-3192.654] (-3194.536) (-3199.037) * (-3196.364) [-3192.445] (-3192.932) (-3194.501) -- 0:01:04
      157000 -- (-3194.190) [-3192.106] (-3194.623) (-3198.175) * [-3193.179] (-3193.382) (-3195.117) (-3192.829) -- 0:01:04
      157500 -- (-3195.240) [-3191.773] (-3194.041) (-3200.362) * [-3194.129] (-3192.609) (-3195.330) (-3196.267) -- 0:01:04
      158000 -- (-3198.005) (-3191.757) (-3194.637) [-3201.014] * (-3193.064) (-3193.379) [-3192.702] (-3195.781) -- 0:01:03
      158500 -- (-3193.432) [-3192.537] (-3196.580) (-3195.986) * (-3192.506) (-3194.913) [-3193.068] (-3193.366) -- 0:01:03
      159000 -- (-3193.175) (-3192.931) (-319