--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:38:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplN/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -502.00          -505.03
2       -501.91          -505.71
--------------------------------------
TOTAL     -501.96          -505.43
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893050    0.089124    0.350626    1.475254    0.856800   1501.00   1501.00    1.001
r(A<->C){all}   0.176069    0.022756    0.000175    0.485162    0.133619    167.59    214.70    1.002
r(A<->G){all}   0.159537    0.019200    0.000150    0.442904    0.119356    183.22    218.52    1.000
r(A<->T){all}   0.162394    0.019755    0.000239    0.445840    0.124047    176.74    213.20    1.000
r(C<->G){all}   0.164313    0.019169    0.000049    0.440118    0.127171    180.12    234.41    1.003
r(C<->T){all}   0.177145    0.020497    0.000021    0.468158    0.141718    190.41    287.34    1.004
r(G<->T){all}   0.160542    0.017399    0.000068    0.424030    0.128895    196.09    214.44    1.002
pi(A){all}      0.223900    0.000458    0.183823    0.265957    0.223112   1270.87   1385.93    1.000
pi(C){all}      0.289586    0.000533    0.247082    0.336924    0.289138    837.90    998.80    1.000
pi(G){all}      0.303019    0.000562    0.255875    0.349882    0.303087   1010.53   1255.77    1.001
pi(T){all}      0.183495    0.000396    0.147292    0.224578    0.183333   1053.31   1190.82    1.000
alpha{1,2}      0.432761    0.240901    0.000103    1.464271    0.253398   1312.84   1331.48    1.000
alpha{3}        0.449303    0.228757    0.000109    1.455813    0.284373   1164.78   1288.67    1.000
pinvar{all}     0.995724    0.000026    0.986306    0.999997    0.997331   1238.98   1303.55    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-433.063437
Model 2: PositiveSelection	-433.063516
Model 0: one-ratio	-433.063437
Model 7: beta	-433.063437
Model 8: beta&w>1	-433.063437


Model 0 vs 1	0.0

Model 2 vs 1	1.5799999994214886E-4

Model 8 vs 7	0.0
>C1
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C2
VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
RFMKIISLAPEVLooooooooo
>C3
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C4
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C5
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C6
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=131 

C1              VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C2              ---------VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C3              VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C4              VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C5              VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C6              VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
                         *****************************************

C1              NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C2              NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C3              NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C4              NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C5              NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C6              NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
                **************************************************

C1              PVGRELREKRFMKIISLAPEVL---------
C2              PVGRELREKRFMKIISLAPEVLooooooooo
C3              PVGRELREKRFMKIISLAPEVL---------
C4              PVGRELREKRFMKIISLAPEVL---------
C5              PVGRELREKRFMKIISLAPEVL---------
C6              PVGRELREKRFMKIISLAPEVL---------
                **********************         




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  122 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  122 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3710]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3710]--->[3630]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.451 Mb, Max= 30.642 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C2              VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C3              VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C4              VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C5              VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C6              VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
                **************************************************

C1              AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C2              AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C3              AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C4              AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C5              AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C6              AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
                **************************************************

C1              RFMKIISLAPEVL
C2              RFMKIISLAPEVL
C3              RFMKIISLAPEVL
C4              RFMKIISLAPEVL
C5              RFMKIISLAPEVL
C6              RFMKIISLAPEVL
                *************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C2              ---------------------------GTGGCCGACAACACCGGCGCCAA
C3              GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C4              GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C5              GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C6              GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
                                           ***********************

C1              GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C2              GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C3              GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C4              GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C5              GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C6              GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
                **************************************************

C1              GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C2              GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C3              GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C4              GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C5              GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C6              GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
                **************************************************

C1              AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C2              AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C3              AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C4              AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C5              AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C6              AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
                **************************************************

C1              AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C2              AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C3              AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C4              AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C5              AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C6              AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
                **************************************************

C1              CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C2              CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C3              CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C4              CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C5              CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C6              CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
                **************************************************

C1              CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C2              CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C3              CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C4              CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C5              CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C6              CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
                **************************************************

C1              GGCTCCGGAGGTGCTG---------------------------
C2              GGCTCCGGAGGTGCTG---------------------------
C3              GGCTCCGGAGGTGCTG---------------------------
C4              GGCTCCGGAGGTGCTG---------------------------
C5              GGCTCCGGAGGTGCTG---------------------------
C6              GGCTCCGGAGGTGCTG---------------------------
                ****************                           



>C1
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C2
---------------------------GTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C3
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C4
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C5
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C6
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C1
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C2
oooooooooVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C3
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C4
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C5
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C6
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 393 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790201
      Setting output file names to "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 51113878
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0781097559
      Seed = 1908335200
      Swapseed = 1579790201
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 9 unique site patterns
      Division 2 has 9 unique site patterns
      Division 3 has 8 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -816.552464 -- -24.965149
         Chain 2 -- -816.555980 -- -24.965149
         Chain 3 -- -816.555980 -- -24.965149
         Chain 4 -- -816.556261 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -816.555980 -- -24.965149
         Chain 2 -- -816.556214 -- -24.965149
         Chain 3 -- -816.555980 -- -24.965149
         Chain 4 -- -816.556215 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-816.552] (-816.556) (-816.556) (-816.556) * [-816.556] (-816.556) (-816.556) (-816.556) 
        500 -- (-512.335) (-511.797) (-514.563) [-509.010] * (-514.429) [-510.585] (-520.157) (-510.459) -- 0:00:00
       1000 -- (-509.979) [-517.547] (-517.774) (-513.725) * (-517.448) [-507.618] (-505.561) (-515.681) -- 0:00:00
       1500 -- (-508.588) (-517.229) [-515.537] (-508.742) * [-508.685] (-519.316) (-509.638) (-517.497) -- 0:00:00
       2000 -- [-511.380] (-515.108) (-507.891) (-510.804) * [-507.773] (-519.024) (-508.971) (-525.060) -- 0:00:00
       2500 -- (-510.737) (-509.194) (-519.403) [-515.592] * [-509.640] (-523.088) (-510.741) (-508.540) -- 0:00:00
       3000 -- (-519.819) [-509.961] (-512.376) (-514.814) * (-506.980) (-511.562) (-512.056) [-506.665] -- 0:00:00
       3500 -- (-508.863) [-511.295] (-519.118) (-519.659) * (-510.347) [-508.963] (-513.384) (-508.591) -- 0:00:00
       4000 -- [-507.657] (-517.422) (-514.986) (-512.681) * [-506.956] (-512.593) (-511.875) (-512.476) -- 0:00:00
       4500 -- (-510.522) (-512.481) (-511.431) [-507.296] * [-506.544] (-510.938) (-507.070) (-510.735) -- 0:00:00
       5000 -- (-509.871) [-508.770] (-514.486) (-514.762) * [-512.796] (-508.481) (-519.619) (-513.196) -- 0:00:00

      Average standard deviation of split frequencies: 0.100566

       5500 -- (-509.717) [-512.023] (-506.354) (-512.446) * (-517.583) (-515.538) [-512.534] (-520.514) -- 0:00:00
       6000 -- [-506.673] (-511.253) (-511.603) (-514.684) * (-516.032) (-517.330) (-521.601) [-510.979] -- 0:02:45
       6500 -- (-513.799) (-511.309) (-508.214) [-514.209] * (-514.684) (-511.743) [-512.929] (-513.782) -- 0:02:32
       7000 -- (-507.987) [-509.704] (-510.889) (-519.630) * (-517.100) (-507.186) [-511.162] (-510.134) -- 0:02:21
       7500 -- [-512.230] (-513.565) (-511.274) (-510.454) * [-509.286] (-513.541) (-512.581) (-513.462) -- 0:02:12
       8000 -- (-511.330) [-512.092] (-513.731) (-511.625) * [-509.758] (-523.365) (-513.282) (-517.981) -- 0:02:04
       8500 -- [-505.387] (-507.444) (-512.866) (-515.786) * [-510.231] (-521.710) (-513.885) (-508.176) -- 0:01:56
       9000 -- (-507.254) (-517.217) [-513.837] (-517.089) * (-516.259) [-514.337] (-515.187) (-508.547) -- 0:01:50
       9500 -- (-508.041) (-509.613) [-510.521] (-511.958) * (-511.626) (-510.846) (-510.863) [-516.473] -- 0:01:44
      10000 -- [-510.349] (-515.101) (-510.530) (-516.081) * (-510.586) [-513.571] (-522.657) (-510.355) -- 0:01:39

      Average standard deviation of split frequencies: 0.073657

      10500 -- (-507.369) [-510.279] (-507.419) (-512.168) * (-511.886) (-516.901) [-511.693] (-511.787) -- 0:01:34
      11000 -- [-513.291] (-513.774) (-510.246) (-507.624) * (-518.325) [-509.770] (-511.557) (-507.572) -- 0:01:29
      11500 -- [-515.150] (-509.038) (-516.640) (-512.916) * (-515.256) (-507.647) [-509.269] (-521.542) -- 0:01:25
      12000 -- (-509.828) (-512.893) (-529.334) [-508.168] * (-516.039) (-509.480) [-504.290] (-516.220) -- 0:01:22
      12500 -- (-512.535) (-514.703) (-514.259) [-508.031] * (-518.340) [-512.466] (-500.315) (-515.346) -- 0:01:19
      13000 -- [-509.747] (-513.136) (-515.238) (-509.398) * (-516.923) (-510.345) [-500.835] (-521.399) -- 0:01:15
      13500 -- (-513.439) [-510.252] (-511.054) (-510.583) * (-510.131) (-515.785) [-501.301] (-503.908) -- 0:01:13
      14000 -- (-514.185) (-522.038) (-515.408) [-512.928] * (-516.619) (-514.234) (-503.930) [-506.236] -- 0:01:10
      14500 -- (-511.241) (-513.494) [-506.785] (-512.396) * (-519.784) (-518.404) (-501.734) [-503.808] -- 0:01:07
      15000 -- (-517.175) (-512.848) (-512.087) [-516.366] * (-512.014) (-509.740) [-503.298] (-502.482) -- 0:01:05

      Average standard deviation of split frequencies: 0.051172

      15500 -- [-510.178] (-511.550) (-509.961) (-514.747) * [-508.814] (-519.944) (-503.560) (-502.956) -- 0:01:03
      16000 -- (-525.112) [-507.656] (-521.953) (-510.420) * (-513.121) (-510.084) [-501.139] (-505.780) -- 0:01:01
      16500 -- (-516.974) (-516.383) [-511.475] (-511.056) * [-516.161] (-510.465) (-502.680) (-503.996) -- 0:00:59
      17000 -- (-515.624) (-503.590) (-509.995) [-511.027] * (-508.051) (-513.938) (-500.346) [-502.828] -- 0:00:57
      17500 -- (-508.344) (-509.104) (-522.015) [-509.912] * (-514.115) (-511.165) [-501.296] (-503.854) -- 0:00:56
      18000 -- [-501.702] (-515.696) (-511.726) (-517.889) * [-513.542] (-511.829) (-503.825) (-507.951) -- 0:00:54
      18500 -- (-503.047) [-508.890] (-518.999) (-512.415) * (-521.310) (-512.877) [-502.695] (-502.709) -- 0:01:46
      19000 -- (-502.869) [-510.317] (-511.730) (-508.627) * (-510.642) (-511.370) [-501.753] (-506.018) -- 0:01:43
      19500 -- (-503.284) [-513.733] (-506.391) (-509.295) * [-508.889] (-511.380) (-504.513) (-503.258) -- 0:01:40
      20000 -- (-502.919) [-506.643] (-507.628) (-507.141) * [-504.783] (-508.521) (-504.327) (-501.668) -- 0:01:38

      Average standard deviation of split frequencies: 0.038417

      20500 -- (-502.328) (-516.726) [-506.305] (-509.460) * (-510.111) (-513.797) [-501.599] (-501.273) -- 0:01:35
      21000 -- [-501.875] (-511.877) (-522.001) (-514.837) * [-510.438] (-510.879) (-501.353) (-502.533) -- 0:01:33
      21500 -- (-501.703) (-511.568) [-513.913] (-511.888) * (-516.505) (-513.148) (-502.946) [-502.440] -- 0:01:31
      22000 -- (-504.289) [-501.686] (-514.639) (-510.046) * (-510.569) [-507.229] (-503.456) (-502.779) -- 0:01:28
      22500 -- (-502.908) [-502.532] (-511.922) (-515.993) * (-520.294) (-509.803) [-503.697] (-507.755) -- 0:01:26
      23000 -- (-501.869) [-500.732] (-509.192) (-516.208) * (-519.403) (-511.455) [-503.825] (-501.899) -- 0:01:24
      23500 -- [-502.659] (-502.797) (-505.310) (-514.136) * (-509.358) (-509.294) (-501.549) [-502.038] -- 0:01:23
      24000 -- (-507.899) [-502.794] (-508.160) (-519.022) * (-521.681) (-514.643) (-500.744) [-504.743] -- 0:01:21
      24500 -- (-501.707) (-502.184) [-511.641] (-513.582) * (-526.990) (-515.783) [-503.242] (-504.419) -- 0:01:19
      25000 -- [-504.724] (-502.817) (-521.216) (-514.765) * [-514.787] (-515.530) (-507.170) (-506.297) -- 0:01:18

      Average standard deviation of split frequencies: 0.038982

      25500 -- [-503.315] (-504.233) (-509.530) (-510.761) * (-521.486) (-507.550) [-501.135] (-504.501) -- 0:01:16
      26000 -- [-502.222] (-502.759) (-513.394) (-510.457) * (-508.942) [-509.228] (-503.096) (-501.971) -- 0:01:14
      26500 -- (-502.583) [-502.740] (-510.238) (-515.951) * (-525.219) [-508.886] (-503.398) (-502.885) -- 0:01:13
      27000 -- (-503.946) [-501.739] (-514.292) (-512.068) * (-508.125) [-508.812] (-504.281) (-501.023) -- 0:01:12
      27500 -- [-502.973] (-502.854) (-511.923) (-509.215) * (-508.233) (-510.722) [-505.672] (-501.948) -- 0:01:10
      28000 -- (-502.846) [-502.243] (-511.829) (-509.255) * (-504.003) (-513.621) (-507.593) [-500.650] -- 0:01:09
      28500 -- (-501.651) [-504.685] (-510.914) (-506.138) * (-502.253) (-512.042) [-502.760] (-501.405) -- 0:01:08
      29000 -- (-504.068) (-505.603) [-511.000] (-507.692) * (-502.701) [-506.305] (-502.686) (-506.566) -- 0:01:06
      29500 -- [-503.088] (-507.190) (-513.217) (-512.015) * [-506.392] (-508.826) (-501.634) (-501.817) -- 0:01:05
      30000 -- (-505.075) (-512.730) [-511.607] (-512.098) * [-500.976] (-506.305) (-501.301) (-501.797) -- 0:01:04

      Average standard deviation of split frequencies: 0.041504

      30500 -- (-503.382) (-504.430) [-508.749] (-507.336) * (-504.590) [-508.574] (-501.024) (-503.041) -- 0:01:03
      31000 -- (-503.387) (-503.879) [-509.133] (-521.583) * (-504.245) (-509.881) [-502.374] (-500.796) -- 0:01:33
      31500 -- (-501.723) (-503.579) [-511.497] (-512.043) * (-504.066) (-512.521) (-501.644) [-503.866] -- 0:01:32
      32000 -- (-501.605) [-504.200] (-509.149) (-512.236) * (-506.500) (-507.232) [-501.081] (-503.997) -- 0:01:30
      32500 -- [-502.331] (-505.078) (-508.827) (-506.716) * (-505.876) [-510.276] (-502.641) (-501.575) -- 0:01:29
      33000 -- (-500.808) [-503.086] (-512.007) (-509.640) * [-501.852] (-512.319) (-501.667) (-504.013) -- 0:01:27
      33500 -- [-500.626] (-502.151) (-517.228) (-519.014) * (-505.515) [-508.533] (-501.842) (-503.147) -- 0:01:26
      34000 -- (-503.154) (-503.385) [-515.589] (-504.541) * (-502.221) (-514.665) [-504.711] (-502.241) -- 0:01:25
      34500 -- (-503.431) [-501.707] (-513.377) (-504.687) * (-501.224) (-513.246) (-501.396) [-505.894] -- 0:01:23
      35000 -- (-501.061) (-501.788) (-507.291) [-502.816] * (-502.406) [-506.123] (-500.921) (-502.593) -- 0:01:22

      Average standard deviation of split frequencies: 0.048637

      35500 -- (-501.908) (-501.783) [-512.287] (-503.643) * (-501.300) (-513.872) (-503.089) [-500.462] -- 0:01:21
      36000 -- [-502.249] (-503.703) (-516.685) (-502.465) * (-502.453) [-512.286] (-504.765) (-503.517) -- 0:01:20
      36500 -- (-502.162) (-501.757) (-512.481) [-504.068] * [-502.607] (-506.371) (-502.245) (-503.458) -- 0:01:19
      37000 -- (-504.157) (-505.715) [-510.557] (-501.813) * [-504.296] (-516.529) (-505.298) (-502.552) -- 0:01:18
      37500 -- (-502.407) [-501.848] (-517.300) (-502.859) * (-509.170) (-511.798) [-502.108] (-503.848) -- 0:01:17
      38000 -- (-501.146) (-503.497) [-506.149] (-501.864) * [-506.540] (-512.766) (-502.447) (-501.836) -- 0:01:15
      38500 -- (-503.866) (-502.242) (-513.492) [-503.252] * [-502.750] (-514.262) (-504.273) (-502.545) -- 0:01:14
      39000 -- (-503.538) [-501.936] (-516.882) (-502.746) * (-503.746) (-518.424) (-504.731) [-503.632] -- 0:01:13
      39500 -- [-501.941] (-500.800) (-507.036) (-502.395) * (-502.061) [-512.975] (-509.075) (-501.838) -- 0:01:12
      40000 -- (-505.607) [-502.155] (-526.811) (-503.634) * (-503.117) (-511.097) (-507.387) [-501.771] -- 0:01:12

      Average standard deviation of split frequencies: 0.046368

      40500 -- (-501.567) (-502.680) [-510.231] (-505.632) * (-511.125) (-509.645) (-503.091) [-503.619] -- 0:01:11
      41000 -- (-501.107) [-502.809] (-509.607) (-504.287) * (-505.939) [-511.713] (-503.699) (-504.973) -- 0:01:10
      41500 -- (-502.372) (-502.069) [-510.754] (-503.372) * [-503.903] (-516.239) (-501.663) (-502.695) -- 0:01:09
      42000 -- (-504.673) [-502.758] (-508.350) (-503.351) * (-504.695) (-512.882) (-502.737) [-504.449] -- 0:01:08
      42500 -- (-502.250) [-504.089] (-513.831) (-503.728) * [-506.801] (-519.890) (-501.377) (-502.834) -- 0:01:07
      43000 -- (-501.430) (-507.243) (-515.832) [-501.479] * (-502.567) (-501.298) [-503.592] (-501.306) -- 0:01:06
      43500 -- (-510.582) (-501.352) [-513.544] (-500.443) * (-502.360) [-502.746] (-500.480) (-505.395) -- 0:01:05
      44000 -- (-507.575) [-503.454] (-509.056) (-500.694) * [-504.983] (-503.724) (-501.395) (-502.451) -- 0:01:26
      44500 -- [-503.764] (-506.131) (-512.300) (-500.719) * (-503.943) (-505.126) (-500.730) [-505.875] -- 0:01:25
      45000 -- [-502.697] (-505.529) (-512.312) (-501.517) * (-506.199) [-500.932] (-501.961) (-505.425) -- 0:01:24

      Average standard deviation of split frequencies: 0.042529

      45500 -- (-503.979) (-502.576) (-506.580) [-500.902] * (-505.146) (-503.245) (-503.740) [-501.008] -- 0:01:23
      46000 -- [-503.492] (-502.691) (-512.519) (-501.331) * (-502.968) (-504.526) [-503.863] (-504.618) -- 0:01:22
      46500 -- (-509.235) (-501.757) (-512.385) [-502.013] * (-503.040) (-501.519) (-502.064) [-500.440] -- 0:01:22
      47000 -- (-501.455) (-504.870) [-507.505] (-503.372) * (-500.566) [-501.932] (-500.870) (-508.020) -- 0:01:21
      47500 -- [-502.372] (-505.790) (-512.779) (-504.028) * (-500.853) [-500.884] (-502.102) (-503.036) -- 0:01:20
      48000 -- [-503.024] (-500.502) (-512.424) (-501.951) * (-501.500) (-501.787) (-505.542) [-502.492] -- 0:01:19
      48500 -- (-501.323) (-502.722) (-504.307) [-502.817] * (-502.901) (-503.409) (-504.235) [-501.237] -- 0:01:18
      49000 -- (-503.348) (-502.151) (-502.497) [-502.653] * (-502.472) (-503.906) (-502.781) [-500.953] -- 0:01:17
      49500 -- (-503.914) (-501.586) (-501.501) [-504.570] * (-503.181) [-501.163] (-501.013) (-506.072) -- 0:01:16
      50000 -- (-503.293) [-500.292] (-503.515) (-502.815) * (-502.559) (-502.279) (-501.261) [-501.149] -- 0:01:16

      Average standard deviation of split frequencies: 0.041134

      50500 -- (-503.250) (-501.908) [-503.257] (-504.135) * (-502.742) [-503.769] (-502.396) (-502.711) -- 0:01:15
      51000 -- [-501.558] (-501.094) (-501.927) (-503.460) * [-501.392] (-501.861) (-501.755) (-501.978) -- 0:01:14
      51500 -- (-504.413) (-503.840) (-501.408) [-503.195] * [-502.559] (-501.011) (-503.730) (-503.184) -- 0:01:13
      52000 -- [-503.517] (-503.524) (-502.515) (-502.634) * (-501.213) [-502.596] (-504.602) (-504.823) -- 0:01:12
      52500 -- (-502.498) [-503.294] (-501.197) (-503.856) * (-503.189) [-501.973] (-503.238) (-504.652) -- 0:01:12
      53000 -- [-504.925] (-502.106) (-502.174) (-501.456) * [-501.188] (-501.827) (-503.759) (-503.839) -- 0:01:11
      53500 -- [-500.687] (-502.042) (-503.579) (-502.986) * (-507.575) [-504.055] (-504.525) (-501.936) -- 0:01:10
      54000 -- (-501.676) [-503.617] (-504.850) (-501.181) * (-516.082) (-505.036) [-502.531] (-501.916) -- 0:01:10
      54500 -- (-505.672) (-504.144) (-502.649) [-502.014] * [-503.036] (-501.499) (-504.559) (-502.916) -- 0:01:09
      55000 -- [-501.988] (-501.114) (-504.605) (-502.941) * (-503.909) (-502.802) (-500.701) [-502.138] -- 0:01:08

      Average standard deviation of split frequencies: 0.044305

      55500 -- (-506.830) (-501.008) [-501.128] (-506.210) * [-502.453] (-503.816) (-502.180) (-502.320) -- 0:01:08
      56000 -- (-503.158) [-501.588] (-506.250) (-501.187) * (-505.276) (-504.139) [-504.397] (-503.089) -- 0:01:07
      56500 -- (-502.172) (-501.658) [-500.652] (-501.381) * (-502.574) (-505.137) [-500.599] (-504.417) -- 0:01:06
      57000 -- [-502.974] (-502.079) (-500.941) (-503.119) * (-504.178) [-501.198] (-501.205) (-501.556) -- 0:01:22
      57500 -- (-503.614) (-502.370) [-501.727] (-502.147) * [-502.021] (-503.269) (-501.530) (-503.130) -- 0:01:21
      58000 -- [-502.477] (-501.788) (-501.948) (-503.952) * [-504.253] (-501.473) (-500.754) (-501.141) -- 0:01:21
      58500 -- [-502.655] (-500.972) (-505.324) (-502.736) * [-502.004] (-502.827) (-502.264) (-502.642) -- 0:01:20
      59000 -- [-502.907] (-501.063) (-502.321) (-502.632) * (-502.562) (-503.617) (-502.947) [-501.988] -- 0:01:19
      59500 -- (-502.239) [-501.087] (-501.678) (-501.564) * (-502.278) (-504.018) [-503.716] (-503.143) -- 0:01:19
      60000 -- [-502.152] (-503.048) (-501.755) (-503.094) * (-500.748) [-502.362] (-505.121) (-503.314) -- 0:01:18

      Average standard deviation of split frequencies: 0.035171

      60500 -- (-501.261) [-503.519] (-503.685) (-503.891) * (-504.354) [-504.978] (-502.114) (-502.305) -- 0:01:17
      61000 -- (-505.999) (-507.359) (-507.400) [-503.446] * (-501.359) (-505.829) [-504.496] (-503.828) -- 0:01:16
      61500 -- (-502.853) (-506.199) (-504.212) [-501.782] * (-502.854) (-503.400) (-504.177) [-506.054] -- 0:01:16
      62000 -- (-502.057) (-505.824) (-505.209) [-503.051] * (-502.612) [-501.683] (-501.433) (-507.453) -- 0:01:15
      62500 -- (-502.116) [-501.748] (-501.184) (-504.172) * [-502.441] (-501.338) (-502.972) (-505.758) -- 0:01:15
      63000 -- (-504.661) (-506.665) [-501.176] (-501.832) * [-500.613] (-506.843) (-502.481) (-505.735) -- 0:01:14
      63500 -- [-502.099] (-500.825) (-501.524) (-502.949) * (-501.620) (-503.165) (-503.955) [-501.199] -- 0:01:13
      64000 -- (-501.043) (-503.274) [-500.945] (-510.678) * (-502.284) (-501.271) (-502.695) [-502.322] -- 0:01:13
      64500 -- (-501.351) [-502.961] (-503.227) (-502.267) * (-502.998) [-501.382] (-504.455) (-502.108) -- 0:01:12
      65000 -- (-500.910) (-502.218) [-509.412] (-501.960) * (-503.884) [-501.513] (-503.064) (-502.003) -- 0:01:11

      Average standard deviation of split frequencies: 0.030074

      65500 -- (-501.320) [-502.203] (-506.458) (-504.622) * [-505.360] (-501.970) (-503.791) (-501.188) -- 0:01:11
      66000 -- [-501.483] (-502.519) (-508.027) (-501.793) * [-503.359] (-507.703) (-502.042) (-503.136) -- 0:01:10
      66500 -- [-502.545] (-501.352) (-501.553) (-502.793) * [-501.596] (-501.860) (-501.344) (-501.503) -- 0:01:10
      67000 -- (-501.670) (-504.095) [-503.347] (-501.867) * (-502.239) [-501.129] (-503.077) (-502.747) -- 0:01:09
      67500 -- [-501.889] (-501.512) (-504.001) (-507.295) * [-501.695] (-503.841) (-501.767) (-503.234) -- 0:01:09
      68000 -- [-501.859] (-501.310) (-501.202) (-506.848) * (-500.382) [-504.729] (-501.200) (-504.537) -- 0:01:08
      68500 -- (-503.762) (-502.131) (-505.979) [-504.288] * [-501.866] (-502.748) (-504.069) (-501.463) -- 0:01:07
      69000 -- (-501.948) (-503.365) [-502.852] (-503.552) * (-504.381) (-501.067) (-503.277) [-502.304] -- 0:01:07
      69500 -- (-502.547) [-501.763] (-502.950) (-503.621) * [-503.920] (-501.564) (-502.769) (-504.301) -- 0:01:20
      70000 -- [-500.838] (-501.445) (-501.281) (-503.813) * (-502.156) (-501.795) [-504.466] (-502.157) -- 0:01:19

      Average standard deviation of split frequencies: 0.031019

      70500 -- [-502.315] (-504.301) (-501.249) (-504.925) * [-501.365] (-501.993) (-501.315) (-502.584) -- 0:01:19
      71000 -- [-501.622] (-502.548) (-500.677) (-502.611) * (-504.473) [-501.223] (-500.450) (-501.892) -- 0:01:18
      71500 -- [-501.805] (-502.014) (-501.937) (-505.486) * [-505.596] (-503.108) (-501.317) (-501.765) -- 0:01:17
      72000 -- (-502.540) (-503.414) [-501.116] (-502.445) * [-502.299] (-501.329) (-503.763) (-504.228) -- 0:01:17
      72500 -- [-501.479] (-501.636) (-506.247) (-503.824) * [-501.734] (-500.733) (-501.398) (-502.056) -- 0:01:16
      73000 -- (-502.295) [-506.046] (-501.637) (-502.872) * (-503.381) (-505.200) (-501.251) [-502.108] -- 0:01:16
      73500 -- (-503.986) [-501.663] (-501.798) (-502.680) * (-502.173) (-503.759) (-502.461) [-502.932] -- 0:01:15
      74000 -- [-503.053] (-501.399) (-503.141) (-503.838) * [-505.392] (-503.798) (-506.631) (-502.797) -- 0:01:15
      74500 -- (-504.058) [-502.067] (-502.756) (-501.703) * (-503.916) (-502.906) [-501.982] (-503.937) -- 0:01:14
      75000 -- (-505.287) (-507.102) (-501.157) [-504.661] * (-501.356) (-501.920) [-504.068] (-502.170) -- 0:01:14

      Average standard deviation of split frequencies: 0.026117

      75500 -- (-500.987) (-503.694) [-501.162] (-501.961) * (-504.572) (-502.098) (-503.207) [-502.670] -- 0:01:13
      76000 -- (-502.777) (-500.985) (-501.930) [-502.108] * (-501.108) (-501.984) (-502.913) [-504.381] -- 0:01:12
      76500 -- (-502.742) [-502.245] (-505.779) (-501.191) * [-501.990] (-503.725) (-505.234) (-503.431) -- 0:01:12
      77000 -- (-503.812) (-503.668) [-504.580] (-502.355) * [-503.280] (-505.234) (-503.658) (-504.463) -- 0:01:11
      77500 -- (-501.723) (-505.407) (-503.825) [-507.084] * [-500.886] (-504.291) (-502.623) (-503.592) -- 0:01:11
      78000 -- (-502.124) [-502.053] (-508.283) (-501.913) * (-504.522) [-502.332] (-507.764) (-501.767) -- 0:01:10
      78500 -- [-503.110] (-501.607) (-502.382) (-505.180) * (-502.644) [-502.697] (-504.724) (-500.951) -- 0:01:10
      79000 -- [-503.747] (-501.155) (-501.825) (-506.276) * (-502.666) (-504.795) [-502.231] (-500.859) -- 0:01:09
      79500 -- [-502.731] (-501.632) (-505.631) (-506.854) * (-505.497) (-503.898) [-502.001] (-504.268) -- 0:01:09
      80000 -- (-503.282) (-501.553) (-504.903) [-503.224] * (-503.440) (-501.815) (-500.483) [-501.903] -- 0:01:09

      Average standard deviation of split frequencies: 0.028876

      80500 -- (-503.658) (-502.710) (-508.664) [-501.283] * [-507.205] (-501.572) (-501.000) (-502.153) -- 0:01:08
      81000 -- [-502.507] (-505.578) (-503.326) (-506.535) * [-503.950] (-501.345) (-505.890) (-504.058) -- 0:01:08
      81500 -- (-505.470) (-507.275) [-502.460] (-503.027) * [-501.072] (-502.898) (-502.514) (-503.150) -- 0:01:07
      82000 -- [-502.643] (-504.741) (-502.056) (-502.245) * (-502.570) (-503.343) (-501.764) [-501.542] -- 0:01:18
      82500 -- (-504.855) (-505.037) [-501.454] (-500.674) * (-502.365) [-501.052] (-502.880) (-505.327) -- 0:01:17
      83000 -- (-503.928) [-501.275] (-503.675) (-503.608) * (-500.925) (-501.555) [-504.402] (-507.106) -- 0:01:17
      83500 -- (-501.019) (-501.078) (-501.639) [-501.310] * (-504.812) [-501.460] (-502.313) (-506.858) -- 0:01:16
      84000 -- (-503.209) [-502.115] (-505.993) (-508.548) * (-502.069) [-502.557] (-502.793) (-504.268) -- 0:01:16
      84500 -- (-503.732) (-503.787) (-501.893) [-502.663] * (-505.797) (-501.092) [-503.062] (-501.633) -- 0:01:15
      85000 -- (-501.627) [-503.772] (-503.281) (-501.265) * (-501.668) (-507.186) [-501.328] (-504.126) -- 0:01:15

      Average standard deviation of split frequencies: 0.025319

      85500 -- (-501.510) (-501.635) (-502.900) [-501.678] * (-500.832) [-502.505] (-503.942) (-504.259) -- 0:01:14
      86000 -- (-501.182) (-506.259) [-502.206] (-500.549) * (-502.018) (-502.192) (-501.597) [-503.214] -- 0:01:14
      86500 -- [-501.994] (-502.335) (-501.402) (-503.142) * (-502.299) (-502.476) [-501.627] (-503.627) -- 0:01:13
      87000 -- (-500.995) (-503.103) (-502.368) [-502.688] * (-504.350) (-514.124) [-500.828] (-506.359) -- 0:01:13
      87500 -- (-501.321) (-505.467) [-500.621] (-501.608) * (-501.743) (-504.711) [-504.935] (-501.367) -- 0:01:13
      88000 -- [-503.727] (-503.355) (-501.350) (-506.074) * (-503.695) [-501.741] (-501.702) (-502.347) -- 0:01:12
      88500 -- (-502.480) (-504.562) [-501.657] (-502.438) * (-501.080) (-501.643) [-502.091] (-502.320) -- 0:01:12
      89000 -- [-503.279] (-502.736) (-502.062) (-502.089) * (-502.219) (-501.759) (-501.938) [-501.756] -- 0:01:11
      89500 -- [-502.039] (-507.750) (-502.942) (-505.908) * [-502.256] (-502.715) (-503.072) (-502.266) -- 0:01:11
      90000 -- [-501.440] (-501.087) (-503.255) (-503.658) * (-501.423) [-502.632] (-506.053) (-501.617) -- 0:01:10

      Average standard deviation of split frequencies: 0.023026

      90500 -- (-501.886) (-504.219) [-502.017] (-501.599) * (-501.477) [-503.731] (-505.458) (-501.120) -- 0:01:10
      91000 -- (-503.514) [-502.440] (-503.649) (-502.256) * (-506.253) (-507.840) [-502.661] (-500.378) -- 0:01:09
      91500 -- (-505.228) (-501.139) (-505.713) [-501.549] * (-502.024) (-501.280) [-505.829] (-503.286) -- 0:01:09
      92000 -- (-500.779) (-502.781) (-503.125) [-500.979] * [-500.976] (-502.826) (-501.414) (-502.654) -- 0:01:09
      92500 -- [-501.665] (-501.978) (-502.139) (-502.379) * [-503.253] (-500.809) (-501.278) (-501.991) -- 0:01:08
      93000 -- [-501.818] (-504.504) (-502.124) (-500.788) * (-504.285) (-501.360) [-502.731] (-504.538) -- 0:01:08
      93500 -- (-501.887) (-502.302) [-503.946] (-502.259) * [-502.982] (-502.946) (-504.385) (-503.133) -- 0:01:07
      94000 -- (-501.083) (-501.907) [-501.893] (-505.756) * [-501.069] (-504.097) (-504.043) (-504.710) -- 0:01:07
      94500 -- (-502.074) (-504.395) (-502.386) [-501.252] * (-502.572) (-504.188) [-503.322] (-503.802) -- 0:01:07
      95000 -- [-502.898] (-502.769) (-501.774) (-505.146) * (-502.697) (-506.217) [-501.340] (-501.625) -- 0:01:16

      Average standard deviation of split frequencies: 0.022743

      95500 -- (-501.308) (-500.968) [-502.589] (-506.063) * [-504.008] (-504.102) (-501.680) (-504.493) -- 0:01:15
      96000 -- (-504.493) [-502.948] (-501.411) (-500.968) * (-502.551) [-503.360] (-502.768) (-503.469) -- 0:01:15
      96500 -- (-503.540) (-502.397) (-504.486) [-501.016] * (-502.867) [-502.425] (-503.975) (-503.990) -- 0:01:14
      97000 -- (-502.555) (-502.504) [-501.990] (-501.146) * [-503.349] (-505.101) (-503.958) (-502.401) -- 0:01:14
      97500 -- [-501.535] (-501.159) (-502.642) (-505.825) * [-502.518] (-505.497) (-502.970) (-503.700) -- 0:01:14
      98000 -- [-508.468] (-505.584) (-504.402) (-505.240) * (-501.670) [-501.107] (-502.154) (-502.205) -- 0:01:13
      98500 -- (-501.597) [-501.266] (-501.920) (-505.926) * (-500.646) [-502.813] (-501.480) (-502.018) -- 0:01:13
      99000 -- (-504.963) (-500.758) (-501.555) [-501.777] * (-501.980) (-502.882) [-501.034] (-502.961) -- 0:01:12
      99500 -- (-502.749) (-501.733) (-505.084) [-503.003] * (-500.453) (-505.475) (-502.958) [-500.886] -- 0:01:12
      100000 -- (-504.586) [-501.900] (-503.900) (-505.765) * [-501.850] (-502.479) (-500.872) (-502.008) -- 0:01:12

      Average standard deviation of split frequencies: 0.021935

      100500 -- [-503.524] (-501.573) (-502.429) (-507.219) * (-502.884) [-501.035] (-501.211) (-502.097) -- 0:01:11
      101000 -- [-505.111] (-500.539) (-504.528) (-503.143) * (-500.635) (-503.752) (-504.100) [-500.458] -- 0:01:11
      101500 -- [-503.288] (-502.951) (-501.858) (-501.774) * (-501.326) (-504.407) (-506.059) [-503.951] -- 0:01:10
      102000 -- (-503.209) (-503.112) [-511.715] (-503.299) * (-500.561) (-501.451) (-505.323) [-502.945] -- 0:01:10
      102500 -- (-501.354) (-501.699) (-508.104) [-502.886] * (-505.754) (-502.857) (-501.039) [-501.781] -- 0:01:10
      103000 -- (-502.790) (-502.396) (-503.144) [-503.428] * (-505.785) [-502.619] (-506.130) (-502.026) -- 0:01:09
      103500 -- (-504.894) (-503.807) [-501.543] (-504.123) * (-503.398) (-501.455) (-506.283) [-501.507] -- 0:01:09
      104000 -- (-504.817) [-502.247] (-504.876) (-507.119) * (-502.324) (-503.288) [-501.970] (-501.636) -- 0:01:08
      104500 -- [-505.064] (-502.527) (-503.710) (-501.631) * (-501.434) (-503.240) (-501.260) [-502.810] -- 0:01:08
      105000 -- [-501.419] (-503.885) (-501.730) (-504.518) * (-503.147) (-507.007) (-503.066) [-502.321] -- 0:01:08

      Average standard deviation of split frequencies: 0.021768

      105500 -- (-500.617) [-503.020] (-502.770) (-503.399) * [-508.718] (-503.746) (-502.452) (-500.989) -- 0:01:07
      106000 -- (-500.567) [-503.718] (-505.105) (-505.080) * (-501.526) [-501.292] (-504.936) (-504.221) -- 0:01:07
      106500 -- (-502.181) [-504.407] (-503.166) (-505.678) * (-502.440) (-500.911) [-504.634] (-502.693) -- 0:01:07
      107000 -- (-502.983) (-504.112) (-505.016) [-504.150] * (-501.781) (-501.010) [-506.071] (-500.516) -- 0:01:06
      107500 -- (-501.193) (-501.589) [-503.532] (-502.812) * [-502.498] (-502.055) (-501.753) (-501.596) -- 0:01:14
      108000 -- (-502.928) (-503.530) [-502.434] (-504.013) * (-501.722) (-502.707) [-506.690] (-504.584) -- 0:01:14
      108500 -- (-502.415) (-502.555) [-503.247] (-502.293) * (-501.751) (-502.885) (-505.904) [-502.037] -- 0:01:13
      109000 -- (-502.417) (-503.659) [-502.098] (-503.307) * [-502.041] (-503.691) (-504.684) (-502.622) -- 0:01:13
      109500 -- (-502.185) [-502.715] (-509.151) (-504.189) * (-502.923) [-501.628] (-506.007) (-501.749) -- 0:01:13
      110000 -- (-503.841) (-501.335) [-505.232] (-504.025) * (-503.188) [-503.942] (-502.185) (-502.851) -- 0:01:12

      Average standard deviation of split frequencies: 0.018832

      110500 -- (-504.085) (-500.854) (-504.869) [-502.242] * (-500.686) (-502.309) (-503.099) [-505.000] -- 0:01:12
      111000 -- (-505.187) (-502.340) [-507.188] (-502.031) * [-504.607] (-502.865) (-503.381) (-506.541) -- 0:01:12
      111500 -- [-500.736] (-502.430) (-502.583) (-503.126) * (-502.208) [-501.952] (-502.879) (-502.413) -- 0:01:11
      112000 -- (-501.584) (-507.975) [-503.958] (-502.133) * (-506.283) [-501.995] (-502.143) (-505.115) -- 0:01:11
      112500 -- (-501.210) (-502.062) [-501.769] (-505.615) * (-503.851) (-504.705) (-503.133) [-503.404] -- 0:01:11
      113000 -- (-501.576) (-502.013) [-502.073] (-503.508) * (-500.678) (-500.782) (-504.580) [-502.221] -- 0:01:10
      113500 -- (-501.242) (-502.366) (-501.418) [-501.938] * (-503.066) (-500.813) [-504.184] (-500.836) -- 0:01:10
      114000 -- [-502.421] (-505.914) (-502.344) (-501.512) * [-501.648] (-501.757) (-505.663) (-502.761) -- 0:01:09
      114500 -- (-501.415) (-502.128) [-500.875] (-503.992) * (-504.210) [-502.239] (-505.444) (-504.225) -- 0:01:09
      115000 -- (-502.766) (-502.340) [-501.593] (-501.300) * (-502.498) (-501.246) (-502.775) [-503.836] -- 0:01:09

      Average standard deviation of split frequencies: 0.018608

      115500 -- [-504.321] (-501.437) (-501.889) (-502.086) * (-501.745) [-502.157] (-503.534) (-505.010) -- 0:01:08
      116000 -- (-504.643) (-504.745) [-502.411] (-502.242) * (-502.249) (-504.963) [-502.344] (-505.660) -- 0:01:08
      116500 -- (-503.030) [-502.571] (-505.380) (-506.069) * (-504.290) (-503.470) [-502.190] (-502.898) -- 0:01:08
      117000 -- [-504.922] (-506.353) (-503.213) (-503.313) * [-501.617] (-502.390) (-503.530) (-506.327) -- 0:01:07
      117500 -- (-502.339) (-502.575) [-501.738] (-505.444) * [-503.665] (-501.539) (-502.900) (-504.372) -- 0:01:07
      118000 -- (-502.390) (-503.003) [-503.026] (-502.003) * (-501.762) (-501.545) (-501.102) [-501.741] -- 0:01:07
      118500 -- (-501.894) [-500.895] (-503.697) (-502.614) * [-501.793] (-502.690) (-501.126) (-501.477) -- 0:01:06
      119000 -- (-504.382) (-501.925) [-502.008] (-506.396) * (-505.993) (-502.505) [-501.066] (-502.985) -- 0:01:06
      119500 -- (-502.054) (-503.372) (-500.842) [-503.063] * (-501.315) (-503.921) [-501.789] (-502.433) -- 0:01:06
      120000 -- (-503.077) (-503.345) [-502.718] (-503.452) * (-502.653) (-502.756) (-502.175) [-501.897] -- 0:01:06

      Average standard deviation of split frequencies: 0.016449

      120500 -- (-502.533) (-502.617) (-503.176) [-505.252] * [-500.498] (-506.247) (-502.370) (-503.358) -- 0:01:12
      121000 -- (-503.689) (-508.640) [-502.022] (-503.936) * (-502.189) [-501.173] (-502.131) (-501.106) -- 0:01:12
      121500 -- (-502.213) [-503.020] (-505.313) (-506.502) * (-502.628) (-502.052) [-501.802] (-504.992) -- 0:01:12
      122000 -- (-502.085) (-503.812) [-502.745] (-510.037) * (-504.007) [-502.920] (-501.561) (-502.751) -- 0:01:11
      122500 -- (-503.984) (-506.190) (-505.787) [-502.551] * (-501.789) (-501.805) [-505.105] (-501.524) -- 0:01:11
      123000 -- (-502.968) [-501.108] (-509.736) (-504.043) * (-502.384) (-500.416) (-503.696) [-502.070] -- 0:01:11
      123500 -- (-507.979) [-502.607] (-505.277) (-502.353) * (-505.746) (-502.446) (-503.671) [-501.912] -- 0:01:10
      124000 -- [-502.144] (-502.771) (-503.698) (-501.002) * (-508.281) [-503.978] (-502.739) (-509.479) -- 0:01:10
      124500 -- (-501.737) (-502.230) (-502.554) [-501.222] * (-504.291) (-503.728) (-503.480) [-504.041] -- 0:01:10
      125000 -- (-502.995) (-503.041) [-504.589] (-504.136) * (-502.059) (-500.360) (-505.992) [-502.384] -- 0:01:10

      Average standard deviation of split frequencies: 0.013390

      125500 -- (-500.838) (-501.580) (-503.251) [-503.069] * (-503.437) [-503.953] (-505.520) (-501.256) -- 0:01:09
      126000 -- [-502.287] (-504.013) (-503.841) (-501.332) * [-503.346] (-506.473) (-504.485) (-503.049) -- 0:01:09
      126500 -- (-501.163) [-502.742] (-503.144) (-500.594) * (-502.001) [-505.224] (-506.780) (-501.857) -- 0:01:09
      127000 -- (-503.510) (-504.789) (-503.667) [-501.111] * (-504.126) (-504.492) (-503.076) [-500.719] -- 0:01:08
      127500 -- (-504.153) [-502.967] (-502.882) (-502.046) * [-501.830] (-504.076) (-504.308) (-501.076) -- 0:01:08
      128000 -- [-502.386] (-500.999) (-501.029) (-501.431) * (-502.041) (-506.416) [-502.189] (-503.687) -- 0:01:08
      128500 -- (-502.913) (-501.971) (-502.530) [-502.050] * (-501.159) (-501.895) (-502.324) [-502.232] -- 0:01:07
      129000 -- (-501.581) [-502.413] (-503.438) (-502.489) * [-503.718] (-500.444) (-501.200) (-500.988) -- 0:01:07
      129500 -- (-501.860) (-503.403) [-502.591] (-503.094) * (-503.733) (-501.492) [-501.984] (-502.193) -- 0:01:07
      130000 -- [-501.796] (-504.279) (-506.964) (-506.151) * (-502.561) (-502.039) [-502.359] (-500.573) -- 0:01:06

      Average standard deviation of split frequencies: 0.017437

      130500 -- (-505.732) [-510.940] (-506.737) (-504.759) * (-503.035) [-501.700] (-505.196) (-506.459) -- 0:01:06
      131000 -- (-505.105) [-502.300] (-508.558) (-501.150) * (-503.867) (-501.346) [-502.561] (-508.651) -- 0:01:06
      131500 -- (-501.807) (-502.197) (-506.624) [-502.402] * (-504.224) [-503.283] (-501.487) (-508.839) -- 0:01:06
      132000 -- (-503.776) (-501.792) [-503.091] (-502.248) * (-501.029) (-505.067) (-504.097) [-506.672] -- 0:01:05
      132500 -- (-507.178) (-503.144) (-506.752) [-500.803] * (-500.921) [-503.013] (-502.869) (-503.161) -- 0:01:05
      133000 -- (-509.200) [-503.631] (-504.010) (-507.704) * [-501.817] (-501.406) (-503.799) (-507.374) -- 0:01:11
      133500 -- [-505.461] (-504.050) (-501.141) (-504.861) * [-503.554] (-504.168) (-509.259) (-507.352) -- 0:01:11
      134000 -- (-504.100) [-501.333] (-505.396) (-501.486) * [-504.856] (-501.630) (-505.954) (-504.744) -- 0:01:11
      134500 -- (-504.980) (-503.682) (-504.253) [-501.716] * (-501.981) (-501.176) (-502.953) [-505.798] -- 0:01:10
      135000 -- (-501.437) [-502.032] (-502.343) (-503.221) * (-505.029) [-504.507] (-501.184) (-502.837) -- 0:01:10

      Average standard deviation of split frequencies: 0.015791

      135500 -- [-502.225] (-511.517) (-505.324) (-504.004) * (-503.111) [-502.931] (-502.204) (-502.329) -- 0:01:10
      136000 -- (-502.774) (-506.718) [-506.089] (-500.902) * [-500.969] (-501.442) (-501.581) (-501.206) -- 0:01:09
      136500 -- [-506.201] (-502.353) (-502.155) (-502.895) * [-504.862] (-504.941) (-500.458) (-502.019) -- 0:01:09
      137000 -- (-503.701) (-507.517) (-504.886) [-500.758] * (-500.625) (-504.067) (-501.713) [-502.304] -- 0:01:09
      137500 -- [-503.125] (-502.284) (-503.139) (-501.350) * (-503.553) (-504.670) [-500.835] (-502.623) -- 0:01:09
      138000 -- (-504.091) (-503.588) (-503.419) [-501.978] * [-502.572] (-501.893) (-500.560) (-505.406) -- 0:01:08
      138500 -- (-502.426) [-502.446] (-504.080) (-503.347) * (-500.449) [-501.097] (-507.229) (-505.288) -- 0:01:08
      139000 -- (-502.151) [-504.419] (-503.996) (-504.475) * (-501.745) [-501.788] (-502.408) (-503.330) -- 0:01:08
      139500 -- (-501.102) (-501.745) [-502.831] (-504.754) * (-504.457) [-501.250] (-502.817) (-503.862) -- 0:01:07
      140000 -- (-502.812) (-502.522) [-501.938] (-503.336) * (-502.845) (-504.697) [-501.478] (-504.492) -- 0:01:07

      Average standard deviation of split frequencies: 0.019176

      140500 -- (-502.412) [-502.479] (-501.874) (-502.632) * (-504.729) (-509.856) (-507.569) [-502.232] -- 0:01:07
      141000 -- (-501.743) (-502.620) [-503.450] (-503.480) * (-503.827) [-505.829] (-502.133) (-502.952) -- 0:01:07
      141500 -- (-500.724) (-506.106) [-503.522] (-503.302) * (-501.656) (-501.597) [-501.018] (-501.209) -- 0:01:06
      142000 -- [-502.897] (-504.749) (-504.823) (-502.257) * (-502.697) (-501.350) [-500.856] (-501.681) -- 0:01:06
      142500 -- (-503.024) (-502.966) (-508.999) [-502.999] * (-502.189) (-501.891) (-502.094) [-501.818] -- 0:01:06
      143000 -- (-504.409) [-501.872] (-504.809) (-502.021) * (-505.128) (-503.149) [-504.961] (-505.148) -- 0:01:05
      143500 -- (-505.288) (-504.096) (-502.969) [-502.129] * (-501.713) (-502.519) (-510.088) [-503.172] -- 0:01:05
      144000 -- (-506.883) (-503.815) (-503.605) [-501.609] * (-500.604) (-501.562) (-502.290) [-505.382] -- 0:01:05
      144500 -- (-503.970) (-501.198) [-504.401] (-502.641) * [-500.919] (-501.904) (-505.168) (-503.100) -- 0:01:05
      145000 -- (-505.787) (-502.631) [-504.923] (-504.056) * (-504.403) (-501.308) (-504.350) [-502.858] -- 0:01:04

      Average standard deviation of split frequencies: 0.019373

      145500 -- (-503.238) [-502.032] (-505.945) (-502.181) * [-504.556] (-502.408) (-505.339) (-503.251) -- 0:01:04
      146000 -- [-501.960] (-502.881) (-505.033) (-502.302) * (-505.887) [-500.304] (-504.235) (-502.517) -- 0:01:10
      146500 -- (-502.342) [-501.906] (-500.989) (-502.216) * (-502.003) [-500.875] (-502.014) (-501.171) -- 0:01:09
      147000 -- [-500.542] (-502.958) (-502.824) (-501.899) * [-500.271] (-501.209) (-502.380) (-501.869) -- 0:01:09
      147500 -- (-505.723) (-501.761) [-502.932] (-503.308) * (-502.424) (-503.363) (-500.981) [-502.684] -- 0:01:09
      148000 -- (-504.298) (-503.533) (-501.035) [-501.947] * (-501.904) (-505.846) [-504.518] (-502.924) -- 0:01:09
      148500 -- (-504.582) (-505.146) [-502.308] (-502.932) * [-502.828] (-503.493) (-505.695) (-507.874) -- 0:01:08
      149000 -- (-502.723) (-503.583) (-503.256) [-503.056] * (-501.420) (-502.835) (-504.410) [-503.844] -- 0:01:08
      149500 -- (-505.263) (-510.263) [-500.382] (-502.319) * (-501.502) (-504.793) [-501.555] (-502.767) -- 0:01:08
      150000 -- (-504.596) (-504.915) (-504.799) [-501.797] * [-500.342] (-502.695) (-502.572) (-505.199) -- 0:01:08

      Average standard deviation of split frequencies: 0.019468

      150500 -- [-505.102] (-502.107) (-503.224) (-502.468) * (-501.133) (-502.581) [-505.607] (-506.470) -- 0:01:07
      151000 -- [-501.490] (-501.923) (-500.751) (-508.101) * (-500.702) (-505.248) (-501.995) [-500.802] -- 0:01:07
      151500 -- (-504.095) (-502.965) [-501.438] (-503.602) * (-501.229) (-503.106) (-507.193) [-502.448] -- 0:01:07
      152000 -- (-503.282) (-503.646) [-501.412] (-502.913) * (-501.712) (-501.612) [-503.696] (-504.961) -- 0:01:06
      152500 -- (-501.029) [-502.355] (-503.324) (-502.231) * (-502.012) (-501.543) [-503.267] (-503.985) -- 0:01:06
      153000 -- [-501.954] (-501.243) (-502.671) (-500.832) * (-507.216) [-502.858] (-503.252) (-502.892) -- 0:01:06
      153500 -- (-500.782) (-502.288) (-501.718) [-503.502] * (-503.967) (-505.043) [-503.928] (-506.507) -- 0:01:06
      154000 -- (-502.973) [-501.994] (-501.062) (-503.694) * (-503.963) (-507.347) (-503.245) [-501.330] -- 0:01:05
      154500 -- (-506.546) (-501.197) (-501.778) [-503.653] * (-501.446) [-502.819] (-501.567) (-504.008) -- 0:01:05
      155000 -- (-505.070) (-502.776) [-504.794] (-502.176) * (-502.369) (-502.442) [-502.360] (-502.172) -- 0:01:05

      Average standard deviation of split frequencies: 0.020481

      155500 -- (-506.753) (-503.466) (-502.719) [-503.105] * (-505.828) [-507.239] (-502.425) (-504.042) -- 0:01:05
      156000 -- [-500.851] (-502.937) (-502.087) (-507.310) * [-501.449] (-502.337) (-501.434) (-503.890) -- 0:01:04
      156500 -- (-505.618) [-503.638] (-503.139) (-501.363) * (-501.477) [-500.771] (-501.491) (-501.445) -- 0:01:04
      157000 -- (-501.242) (-504.221) [-500.969] (-502.192) * (-503.482) [-504.748] (-505.025) (-501.986) -- 0:01:04
      157500 -- (-501.841) (-501.325) [-502.449] (-502.028) * (-503.045) (-503.908) [-501.141] (-502.411) -- 0:01:04
      158000 -- (-500.574) (-505.223) [-504.952] (-503.870) * (-506.959) (-502.673) (-505.161) [-502.532] -- 0:01:03
      158500 -- (-501.716) (-502.801) (-503.950) [-502.303] * (-508.874) (-507.136) [-500.701] (-503.050) -- 0:01:09
      159000 -- (-502.879) (-501.141) [-501.429] (-504.633) * (-500.853) (-502.746) (-503.244) [-501.566] -- 0:01:08
      159500 -- (-501.435) [-500.568] (-503.580) (-507.747) * (-500.685) (-501.903) [-501.956] (-502.735) -- 0:01:08
      160000 -- [-504.536] (-507.455) (-504.413) (-506.359) * (-501.974) [-503.012] (-505.935) (-501.398) -- 0:01:08

      Average standard deviation of split frequencies: 0.018745

      160500 -- (-502.113) (-502.518) (-504.204) [-502.160] * [-501.515] (-504.204) (-503.728) (-501.785) -- 0:01:07
      161000 -- (-500.938) [-501.654] (-501.615) (-501.131) * (-502.279) (-503.703) [-501.351] (-502.215) -- 0:01:07
      161500 -- (-505.217) (-503.566) [-500.333] (-503.351) * (-506.303) (-501.880) [-501.805] (-504.563) -- 0:01:07
      162000 -- [-501.094] (-502.499) (-501.799) (-501.195) * (-503.724) [-501.592] (-503.704) (-503.201) -- 0:01:07
      162500 -- (-501.008) (-504.250) (-506.511) [-502.516] * (-505.069) (-501.202) (-506.965) [-502.585] -- 0:01:07
      163000 -- (-500.454) (-504.282) (-503.456) [-502.349] * [-500.735] (-503.907) (-501.904) (-502.967) -- 0:01:06
      163500 -- (-501.914) (-505.684) [-502.705] (-502.606) * [-502.925] (-507.725) (-501.137) (-503.723) -- 0:01:06
      164000 -- [-502.353] (-501.268) (-502.964) (-503.032) * [-502.730] (-502.009) (-502.936) (-505.324) -- 0:01:06
      164500 -- (-501.783) (-501.296) (-501.902) [-501.705] * (-505.944) [-500.626] (-503.535) (-502.024) -- 0:01:06
      165000 -- (-502.163) (-502.944) (-504.661) [-502.097] * (-501.059) (-504.072) (-503.842) [-504.665] -- 0:01:05

      Average standard deviation of split frequencies: 0.019247

      165500 -- [-506.569] (-502.436) (-502.368) (-501.566) * (-500.322) (-503.878) (-504.057) [-503.163] -- 0:01:05
      166000 -- [-503.130] (-501.754) (-502.075) (-505.209) * [-500.404] (-506.492) (-505.483) (-502.161) -- 0:01:05
      166500 -- (-508.220) (-502.476) (-503.775) [-505.904] * [-501.640] (-502.257) (-504.370) (-504.066) -- 0:01:05
      167000 -- [-502.678] (-506.462) (-505.727) (-501.433) * [-501.533] (-502.927) (-502.962) (-503.928) -- 0:01:04
      167500 -- (-500.789) (-502.474) (-502.959) [-500.538] * (-503.480) (-506.127) [-507.671] (-505.280) -- 0:01:04
      168000 -- (-502.878) (-505.115) (-502.713) [-502.131] * (-503.026) (-504.451) [-502.182] (-501.637) -- 0:01:04
      168500 -- (-505.830) (-502.705) [-503.561] (-501.066) * [-503.402] (-500.967) (-503.829) (-504.348) -- 0:01:04
      169000 -- (-502.678) (-502.074) (-503.243) [-501.769] * (-501.609) (-504.228) (-501.999) [-501.215] -- 0:01:03
      169500 -- (-501.757) (-501.214) [-501.347] (-502.185) * (-501.669) [-503.128] (-502.330) (-502.577) -- 0:01:03
      170000 -- (-506.422) (-500.624) (-503.650) [-501.476] * [-500.606] (-502.233) (-501.689) (-500.919) -- 0:01:03

      Average standard deviation of split frequencies: 0.017954

      170500 -- (-506.841) (-504.052) (-505.750) [-502.330] * (-503.169) (-500.842) (-506.609) [-501.054] -- 0:01:03
      171000 -- (-503.692) (-503.615) [-503.293] (-501.488) * (-504.439) [-500.957] (-503.233) (-503.010) -- 0:01:07
      171500 -- (-503.950) [-502.140] (-505.296) (-502.037) * (-503.477) (-504.975) (-508.412) [-504.278] -- 0:01:07
      172000 -- (-503.544) [-504.593] (-508.115) (-500.944) * (-501.847) (-505.064) (-502.362) [-507.225] -- 0:01:07
      172500 -- (-501.462) (-503.945) (-501.829) [-500.542] * (-500.990) (-501.510) (-501.425) [-506.582] -- 0:01:07
      173000 -- (-502.963) (-501.582) [-507.824] (-503.286) * (-501.932) (-505.523) (-501.968) [-501.284] -- 0:01:06
      173500 -- (-505.145) (-502.874) (-502.104) [-502.476] * [-505.292] (-504.224) (-503.203) (-504.407) -- 0:01:06
      174000 -- (-503.336) (-506.290) (-507.567) [-502.140] * [-506.884] (-506.279) (-504.931) (-500.689) -- 0:01:06
      174500 -- (-506.962) (-501.977) [-501.532] (-502.693) * (-503.299) [-504.874] (-501.458) (-501.366) -- 0:01:06
      175000 -- (-506.879) (-502.593) [-501.219] (-503.093) * (-501.797) (-501.835) (-503.353) [-501.159] -- 0:01:06

      Average standard deviation of split frequencies: 0.017559

      175500 -- (-501.449) (-501.569) [-503.396] (-506.166) * (-507.571) (-501.854) [-501.159] (-501.260) -- 0:01:05
      176000 -- (-507.716) [-501.833] (-501.749) (-505.175) * [-501.841] (-501.397) (-504.711) (-502.985) -- 0:01:05
      176500 -- (-503.705) (-502.689) [-502.259] (-502.435) * (-504.968) (-503.392) (-503.547) [-501.231] -- 0:01:05
      177000 -- (-507.223) (-501.603) [-504.169] (-503.703) * [-501.690] (-502.627) (-502.234) (-501.175) -- 0:01:05
      177500 -- (-502.937) (-505.183) (-504.186) [-503.714] * (-501.465) (-507.040) (-501.405) [-501.480] -- 0:01:04
      178000 -- [-501.660] (-504.218) (-503.076) (-501.357) * (-504.825) (-501.329) [-504.965] (-508.137) -- 0:01:04
      178500 -- [-502.499] (-503.622) (-503.097) (-504.149) * (-503.875) (-503.100) [-501.564] (-501.858) -- 0:01:04
      179000 -- (-505.952) (-509.050) [-502.692] (-502.160) * [-503.977] (-504.572) (-502.274) (-502.917) -- 0:01:04
      179500 -- (-508.886) (-508.714) [-501.860] (-501.219) * (-506.727) [-505.112] (-501.703) (-503.161) -- 0:01:03
      180000 -- [-505.907] (-508.448) (-502.083) (-501.475) * (-503.634) (-500.861) [-502.907] (-502.602) -- 0:01:03

      Average standard deviation of split frequencies: 0.018265

      180500 -- (-502.543) (-501.877) (-503.330) [-504.236] * (-506.785) (-501.040) [-500.746] (-502.511) -- 0:01:03
      181000 -- (-504.181) [-502.380] (-501.844) (-500.984) * [-505.800] (-502.642) (-500.632) (-500.883) -- 0:01:03
      181500 -- (-501.404) [-504.281] (-501.992) (-502.027) * (-501.521) (-503.498) [-502.529] (-500.964) -- 0:01:03
      182000 -- (-503.618) (-501.259) [-502.534] (-500.921) * [-505.133] (-500.879) (-501.351) (-501.762) -- 0:01:02
      182500 -- (-505.777) (-501.276) (-502.320) [-500.997] * (-500.524) (-501.384) (-500.487) [-501.648] -- 0:01:02
      183000 -- (-504.265) [-501.075] (-502.230) (-500.572) * (-500.660) (-501.734) [-500.292] (-501.715) -- 0:01:02
      183500 -- [-503.931] (-502.275) (-504.726) (-501.357) * (-503.649) (-502.608) [-503.227] (-500.907) -- 0:01:02
      184000 -- (-501.748) (-502.062) [-507.718] (-503.342) * (-508.627) (-502.414) [-501.056] (-503.511) -- 0:01:06
      184500 -- (-502.792) (-504.821) [-503.548] (-504.964) * (-503.151) [-500.872] (-504.072) (-501.605) -- 0:01:06
      185000 -- (-500.998) [-504.315] (-502.200) (-503.663) * (-502.419) (-501.505) (-504.635) [-504.715] -- 0:01:06

      Average standard deviation of split frequencies: 0.016333

      185500 -- (-500.543) (-502.769) [-502.646] (-502.946) * (-506.125) (-503.087) (-504.415) [-500.948] -- 0:01:05
      186000 -- (-504.659) (-503.935) (-503.165) [-504.851] * (-510.054) (-506.094) [-505.119] (-504.262) -- 0:01:05
      186500 -- [-504.134] (-504.300) (-502.794) (-501.132) * (-506.187) (-503.259) (-503.123) [-503.105] -- 0:01:05
      187000 -- (-506.054) (-501.944) (-504.656) [-502.901] * (-503.109) [-503.836] (-505.272) (-504.379) -- 0:01:05
      187500 -- (-501.412) [-502.221] (-502.503) (-502.653) * (-502.203) (-502.374) (-503.950) [-502.732] -- 0:01:05
      188000 -- (-504.062) (-501.218) (-504.579) [-504.200] * (-503.982) (-500.653) [-503.151] (-501.200) -- 0:01:04
      188500 -- (-506.424) [-501.620] (-504.295) (-503.423) * (-501.691) (-501.382) [-504.299] (-504.420) -- 0:01:04
      189000 -- (-508.640) [-505.866] (-500.736) (-503.292) * (-501.671) (-503.070) [-502.166] (-507.117) -- 0:01:04
      189500 -- (-507.355) (-500.382) (-502.247) [-500.722] * (-501.950) [-501.014] (-500.751) (-501.795) -- 0:01:04
      190000 -- (-506.091) (-501.819) (-504.167) [-503.299] * (-503.365) (-500.888) (-503.961) [-503.231] -- 0:01:03

      Average standard deviation of split frequencies: 0.014253

      190500 -- (-503.526) (-502.617) (-501.842) [-503.551] * (-502.444) (-506.428) [-501.749] (-507.015) -- 0:01:03
      191000 -- [-501.949] (-500.435) (-501.234) (-503.785) * (-503.321) [-500.717] (-500.936) (-502.988) -- 0:01:03
      191500 -- (-502.711) [-502.886] (-501.089) (-501.344) * [-502.844] (-502.586) (-504.747) (-502.283) -- 0:01:03
      192000 -- (-503.096) [-501.398] (-502.734) (-503.066) * (-503.209) (-502.398) [-502.327] (-505.585) -- 0:01:03
      192500 -- (-502.838) [-501.274] (-504.505) (-501.474) * [-504.963] (-500.703) (-504.588) (-503.335) -- 0:01:02
      193000 -- (-503.374) (-503.396) [-502.400] (-502.740) * [-500.354] (-504.596) (-505.102) (-501.840) -- 0:01:02
      193500 -- (-502.872) [-503.057] (-503.074) (-502.243) * [-501.360] (-503.458) (-503.424) (-500.827) -- 0:01:02
      194000 -- (-502.398) [-500.907] (-504.371) (-501.664) * (-502.425) (-502.972) (-503.398) [-501.562] -- 0:01:02
      194500 -- [-504.917] (-502.749) (-502.715) (-502.097) * (-501.157) (-504.903) [-503.463] (-500.896) -- 0:01:02
      195000 -- (-504.745) [-501.413] (-508.071) (-504.016) * [-503.553] (-502.255) (-501.096) (-506.687) -- 0:01:01

      Average standard deviation of split frequencies: 0.015099

      195500 -- (-506.525) [-501.880] (-504.103) (-502.164) * [-502.143] (-501.206) (-500.607) (-501.594) -- 0:01:01
      196000 -- (-504.055) (-506.069) (-502.247) [-501.467] * [-502.953] (-500.968) (-502.668) (-500.602) -- 0:01:01
      196500 -- (-501.618) (-510.504) [-505.140] (-505.389) * (-509.527) [-504.202] (-501.909) (-500.895) -- 0:01:01
      197000 -- (-501.179) [-504.964] (-505.086) (-502.128) * (-503.459) (-507.727) [-503.689] (-502.057) -- 0:01:05
      197500 -- [-501.234] (-502.318) (-500.714) (-503.669) * (-503.466) [-501.567] (-503.050) (-502.922) -- 0:01:05
      198000 -- (-504.790) (-503.835) [-502.241] (-504.494) * [-501.711] (-507.195) (-504.802) (-502.010) -- 0:01:04
      198500 -- (-503.244) [-502.354] (-501.498) (-503.063) * (-501.648) (-502.007) (-505.320) [-501.451] -- 0:01:04
      199000 -- (-504.226) [-500.959] (-501.636) (-501.965) * [-510.598] (-502.908) (-502.050) (-502.321) -- 0:01:04
      199500 -- (-504.689) [-501.047] (-500.713) (-501.088) * (-507.936) [-500.879] (-501.762) (-502.979) -- 0:01:04
      200000 -- (-501.019) (-500.599) (-501.737) [-501.833] * [-502.722] (-500.661) (-503.068) (-501.490) -- 0:01:04

      Average standard deviation of split frequencies: 0.014924

      200500 -- (-502.444) (-509.213) (-503.418) [-502.424] * [-502.162] (-503.752) (-502.076) (-501.947) -- 0:01:03
      201000 -- [-502.987] (-501.428) (-504.699) (-502.118) * (-501.712) [-501.264] (-502.984) (-503.811) -- 0:01:03
      201500 -- (-503.120) [-501.161] (-502.260) (-501.828) * (-500.701) [-501.079] (-502.008) (-502.270) -- 0:01:03
      202000 -- (-511.622) [-501.165] (-504.612) (-503.279) * (-501.678) (-504.799) [-505.772] (-500.811) -- 0:01:03
      202500 -- (-507.675) (-501.972) (-501.818) [-505.632] * (-502.309) (-500.414) (-503.087) [-502.312] -- 0:01:03
      203000 -- (-505.262) (-501.633) (-502.365) [-502.128] * [-503.295] (-503.899) (-502.251) (-505.537) -- 0:01:02
      203500 -- (-504.629) (-502.162) (-504.740) [-503.078] * (-505.822) (-503.354) [-502.891] (-500.452) -- 0:01:02
      204000 -- (-502.094) [-503.635] (-502.637) (-502.407) * (-507.269) [-501.750] (-501.589) (-501.418) -- 0:01:02
      204500 -- (-502.883) (-504.588) [-502.676] (-508.981) * (-502.504) [-502.200] (-501.030) (-503.743) -- 0:01:02
      205000 -- (-500.549) [-501.679] (-504.948) (-506.190) * (-502.029) (-503.134) [-500.900] (-507.589) -- 0:01:02

      Average standard deviation of split frequencies: 0.015346

      205500 -- [-500.759] (-504.647) (-503.032) (-503.179) * [-501.197] (-503.614) (-507.466) (-501.936) -- 0:01:01
      206000 -- (-501.279) (-501.585) [-501.654] (-502.153) * (-504.298) [-501.632] (-504.522) (-502.531) -- 0:01:01
      206500 -- (-501.165) (-500.920) (-501.335) [-505.455] * (-503.652) (-501.784) (-503.665) [-502.778] -- 0:01:01
      207000 -- (-503.335) [-501.213] (-502.527) (-502.655) * (-502.761) (-502.909) (-502.372) [-502.914] -- 0:01:01
      207500 -- (-503.595) [-504.212] (-503.384) (-503.139) * (-502.664) (-503.240) [-504.071] (-502.563) -- 0:01:01
      208000 -- [-500.605] (-501.877) (-501.381) (-501.692) * [-506.099] (-502.556) (-500.975) (-505.430) -- 0:01:00
      208500 -- (-503.352) (-502.621) [-505.594] (-501.453) * [-501.953] (-507.660) (-500.303) (-506.285) -- 0:01:00
      209000 -- (-500.743) [-502.202] (-503.237) (-501.774) * (-502.534) (-510.465) (-502.212) [-505.201] -- 0:01:00
      209500 -- (-501.745) [-504.495] (-503.359) (-504.120) * (-501.590) (-505.669) (-504.430) [-503.478] -- 0:01:04
      210000 -- (-501.750) (-501.296) (-503.568) [-500.832] * (-502.649) [-502.098] (-506.132) (-505.690) -- 0:01:03

      Average standard deviation of split frequencies: 0.015927

      210500 -- [-500.586] (-501.462) (-501.538) (-500.947) * (-503.577) (-503.411) (-502.207) [-506.247] -- 0:01:03
      211000 -- (-504.246) (-503.147) [-502.035] (-500.668) * (-504.217) (-502.620) (-502.107) [-501.898] -- 0:01:03
      211500 -- [-502.839] (-502.544) (-502.579) (-502.244) * [-501.811] (-502.852) (-501.844) (-502.283) -- 0:01:03
      212000 -- (-503.294) (-503.406) [-502.281] (-500.343) * (-500.914) [-503.134] (-504.184) (-502.546) -- 0:01:03
      212500 -- (-504.287) (-502.806) (-501.491) [-501.308] * (-501.162) (-502.104) (-502.860) [-503.136] -- 0:01:03
      213000 -- (-504.285) [-501.096] (-503.249) (-505.924) * (-506.182) [-503.464] (-503.549) (-504.685) -- 0:01:02
      213500 -- (-502.750) [-500.458] (-502.210) (-504.370) * (-503.062) [-503.703] (-504.258) (-502.792) -- 0:01:02
      214000 -- [-501.462] (-505.176) (-501.391) (-504.001) * (-503.525) [-504.635] (-502.484) (-503.755) -- 0:01:02
      214500 -- (-501.583) (-503.393) (-501.465) [-501.634] * (-507.843) (-504.956) (-502.584) [-503.123] -- 0:01:02
      215000 -- (-504.443) (-501.174) [-506.500] (-501.298) * (-504.171) (-505.107) (-502.233) [-501.216] -- 0:01:02

      Average standard deviation of split frequencies: 0.017331

      215500 -- (-506.801) [-501.051] (-503.729) (-500.897) * [-505.023] (-501.122) (-502.643) (-501.012) -- 0:01:01
      216000 -- (-506.978) (-501.030) (-501.537) [-503.326] * [-501.625] (-506.589) (-505.981) (-502.170) -- 0:01:01
      216500 -- (-503.138) [-503.756] (-501.233) (-505.429) * (-502.683) (-502.064) [-504.254] (-502.662) -- 0:01:01
      217000 -- (-502.110) (-510.926) (-501.443) [-502.143] * (-506.680) [-502.107] (-502.846) (-500.808) -- 0:01:01
      217500 -- (-502.565) (-506.677) [-501.724] (-503.827) * [-502.561] (-501.109) (-501.190) (-506.012) -- 0:01:01
      218000 -- [-501.335] (-509.326) (-504.383) (-504.052) * (-508.274) (-501.285) [-502.564] (-502.648) -- 0:01:00
      218500 -- (-502.743) [-501.671] (-503.376) (-503.775) * (-507.089) (-502.076) (-503.471) [-502.098] -- 0:01:00
      219000 -- (-501.315) (-502.236) [-500.842] (-504.542) * [-502.056] (-501.071) (-504.101) (-501.401) -- 0:01:00
      219500 -- (-501.474) (-502.832) (-500.494) [-502.306] * (-504.239) (-503.354) [-505.862] (-502.383) -- 0:01:00
      220000 -- (-504.247) (-502.104) (-500.906) [-502.426] * [-505.749] (-501.580) (-503.053) (-501.166) -- 0:01:00

      Average standard deviation of split frequencies: 0.017467

      220500 -- (-502.061) (-502.162) [-503.612] (-502.649) * [-502.725] (-500.853) (-502.133) (-503.150) -- 0:01:00
      221000 -- (-503.331) [-501.975] (-503.437) (-501.885) * (-502.846) (-501.220) [-503.597] (-504.037) -- 0:00:59
      221500 -- [-503.863] (-502.362) (-507.228) (-504.223) * [-503.948] (-501.874) (-504.494) (-503.139) -- 0:00:59
      222000 -- (-507.067) [-503.914] (-507.297) (-506.222) * (-506.426) (-501.338) [-504.456] (-503.596) -- 0:00:59
      222500 -- (-501.417) [-503.727] (-504.763) (-501.028) * (-502.499) (-506.136) (-503.989) [-503.714] -- 0:01:02
      223000 -- (-501.268) [-503.267] (-504.947) (-501.672) * (-505.047) (-504.845) (-504.790) [-505.511] -- 0:01:02
      223500 -- [-508.322] (-504.398) (-500.710) (-501.454) * (-502.473) (-502.582) [-501.849] (-502.768) -- 0:01:02
      224000 -- (-503.230) (-502.556) [-502.583] (-501.644) * (-502.175) (-503.425) [-503.426] (-501.366) -- 0:01:02
      224500 -- (-509.630) (-504.241) [-503.982] (-503.562) * [-505.973] (-503.174) (-503.364) (-504.196) -- 0:01:02
      225000 -- (-503.327) (-505.014) [-506.453] (-505.531) * (-505.943) (-505.418) [-502.996] (-505.251) -- 0:01:02

      Average standard deviation of split frequencies: 0.017382

      225500 -- (-504.380) (-503.988) [-506.583] (-503.330) * (-504.459) (-505.807) (-503.329) [-503.245] -- 0:01:01
      226000 -- (-502.785) (-505.573) (-502.810) [-501.384] * (-502.535) (-501.693) [-504.401] (-503.023) -- 0:01:01
      226500 -- (-504.305) (-509.796) (-502.604) [-500.649] * [-503.706] (-503.460) (-504.616) (-505.386) -- 0:01:01
      227000 -- (-503.383) (-501.102) (-501.379) [-502.881] * [-503.773] (-501.276) (-501.341) (-501.983) -- 0:01:01
      227500 -- (-501.558) (-504.927) (-504.452) [-502.758] * (-506.069) (-501.406) [-501.284] (-505.138) -- 0:01:01
      228000 -- [-501.568] (-502.974) (-505.270) (-501.043) * (-504.436) [-501.021] (-503.045) (-501.420) -- 0:01:00
      228500 -- (-501.714) (-501.335) (-501.386) [-503.728] * (-503.086) (-504.484) (-506.977) [-503.165] -- 0:01:00
      229000 -- [-505.134] (-506.351) (-502.396) (-503.903) * [-503.040] (-511.214) (-501.441) (-502.444) -- 0:01:00
      229500 -- (-503.855) [-502.770] (-501.556) (-507.638) * (-501.504) [-502.930] (-503.142) (-504.685) -- 0:01:00
      230000 -- (-501.465) (-505.007) [-501.355] (-501.327) * (-501.564) (-501.680) (-501.752) [-503.461] -- 0:01:00

      Average standard deviation of split frequencies: 0.018716

      230500 -- (-501.685) [-501.489] (-507.380) (-501.296) * (-503.381) (-508.629) [-503.230] (-501.760) -- 0:01:00
      231000 -- (-504.028) (-504.750) (-508.491) [-500.832] * (-504.414) (-503.919) [-502.040] (-501.571) -- 0:00:59
      231500 -- (-503.610) (-508.520) [-509.542] (-504.102) * [-501.552] (-501.475) (-501.958) (-502.982) -- 0:00:59
      232000 -- (-501.388) (-502.727) (-506.080) [-501.273] * (-503.061) [-502.400] (-503.649) (-503.205) -- 0:00:59
      232500 -- (-503.165) [-502.067] (-503.204) (-501.039) * (-503.409) [-502.155] (-505.333) (-501.023) -- 0:00:59
      233000 -- (-501.145) [-500.692] (-504.388) (-501.378) * (-506.889) (-503.352) (-501.860) [-501.234] -- 0:00:59
      233500 -- (-502.053) (-505.277) [-502.361] (-504.120) * (-504.990) [-501.644] (-502.080) (-502.446) -- 0:00:59
      234000 -- (-502.855) (-502.983) [-504.063] (-503.447) * (-511.997) (-501.230) [-501.536] (-501.755) -- 0:00:58
      234500 -- (-502.143) [-504.926] (-504.374) (-502.262) * (-502.953) [-500.562] (-501.204) (-502.933) -- 0:00:58
      235000 -- [-504.030] (-504.504) (-503.368) (-504.573) * (-501.335) (-502.068) (-506.249) [-503.784] -- 0:01:01

      Average standard deviation of split frequencies: 0.018643

      235500 -- (-504.305) [-502.843] (-507.741) (-504.561) * (-501.302) (-502.651) (-507.812) [-502.246] -- 0:01:01
      236000 -- [-503.738] (-505.544) (-502.849) (-505.041) * (-502.171) (-501.958) [-503.342] (-502.186) -- 0:01:01
      236500 -- (-502.962) (-510.494) [-501.895] (-503.891) * (-501.801) (-502.143) (-501.892) [-500.964] -- 0:01:01
      237000 -- (-503.180) [-504.639] (-501.360) (-503.412) * (-502.826) [-501.935] (-505.670) (-502.002) -- 0:01:01
      237500 -- (-502.949) (-501.825) (-500.906) [-501.313] * (-503.045) [-501.847] (-501.652) (-505.524) -- 0:01:01
      238000 -- (-503.589) (-504.300) (-502.210) [-504.980] * [-502.071] (-501.444) (-501.195) (-502.145) -- 0:01:00
      238500 -- (-504.739) (-504.226) (-502.510) [-504.026] * (-501.235) (-504.254) [-504.720] (-502.746) -- 0:01:00
      239000 -- (-503.216) (-503.256) (-504.276) [-504.863] * (-502.700) [-501.313] (-502.709) (-502.825) -- 0:01:00
      239500 -- (-505.002) [-502.282] (-505.836) (-504.238) * (-503.261) (-500.618) [-502.651] (-504.207) -- 0:01:00
      240000 -- (-502.051) (-503.500) (-505.950) [-505.451] * (-503.907) [-503.104] (-503.328) (-504.527) -- 0:01:00

      Average standard deviation of split frequencies: 0.019152

      240500 -- (-502.427) (-501.788) (-505.708) [-501.699] * [-503.521] (-503.149) (-504.861) (-504.498) -- 0:01:00
      241000 -- (-505.376) [-501.017] (-506.105) (-500.963) * (-501.768) (-500.912) [-502.267] (-504.904) -- 0:00:59
      241500 -- (-501.021) (-502.091) [-500.526] (-503.045) * (-503.323) (-500.518) [-504.750] (-504.368) -- 0:00:59
      242000 -- (-503.730) [-502.399] (-503.816) (-504.177) * [-503.186] (-503.559) (-501.509) (-502.827) -- 0:00:59
      242500 -- [-506.928] (-501.912) (-503.709) (-502.072) * (-502.107) (-507.953) [-501.962] (-503.002) -- 0:00:59
      243000 -- (-502.609) (-504.570) (-502.693) [-500.526] * (-504.299) (-501.786) [-504.545] (-503.030) -- 0:00:59
      243500 -- [-501.997] (-503.293) (-506.696) (-500.822) * [-503.890] (-503.016) (-502.063) (-500.661) -- 0:00:59
      244000 -- [-507.224] (-503.071) (-506.735) (-501.956) * [-501.207] (-502.567) (-500.962) (-502.134) -- 0:00:58
      244500 -- (-503.476) [-502.579] (-501.781) (-501.648) * [-502.928] (-504.728) (-503.345) (-502.782) -- 0:00:58
      245000 -- (-502.128) [-503.211] (-504.782) (-503.074) * (-503.802) (-502.494) [-502.844] (-507.824) -- 0:00:58

      Average standard deviation of split frequencies: 0.017726

      245500 -- (-502.266) (-502.362) [-502.338] (-502.594) * (-501.360) (-503.034) [-502.191] (-506.672) -- 0:00:58
      246000 -- (-503.634) (-502.226) (-501.770) [-501.679] * (-500.777) (-501.469) [-504.943] (-502.194) -- 0:00:58
      246500 -- [-501.748] (-503.562) (-509.395) (-501.938) * [-500.932] (-501.077) (-501.704) (-502.508) -- 0:00:58
      247000 -- [-502.745] (-504.044) (-500.960) (-502.904) * (-503.181) (-503.894) [-501.420] (-505.349) -- 0:00:57
      247500 -- [-502.006] (-502.786) (-504.654) (-505.863) * (-502.851) [-503.358] (-502.773) (-500.450) -- 0:01:00
      248000 -- (-504.632) [-501.242] (-501.789) (-502.082) * (-502.104) [-501.679] (-501.494) (-501.138) -- 0:01:00
      248500 -- (-502.396) (-502.109) (-505.027) [-504.170] * (-508.184) (-502.222) (-504.150) [-501.324] -- 0:01:00
      249000 -- [-501.050] (-503.183) (-502.518) (-502.547) * (-506.125) (-501.259) [-502.358] (-500.898) -- 0:01:00
      249500 -- (-502.363) (-504.844) (-502.580) [-503.363] * (-505.038) (-501.382) [-501.916] (-501.401) -- 0:01:00
      250000 -- (-503.800) (-508.477) (-502.668) [-505.472] * (-502.420) [-501.800] (-501.515) (-502.036) -- 0:01:00

      Average standard deviation of split frequencies: 0.017970

      250500 -- (-502.611) (-503.375) (-503.893) [-505.613] * (-501.683) [-502.608] (-501.124) (-500.805) -- 0:00:59
      251000 -- (-502.367) (-502.104) (-504.337) [-501.519] * (-501.188) [-501.778] (-503.439) (-501.208) -- 0:00:59
      251500 -- (-503.619) (-502.528) [-504.358] (-502.375) * (-503.593) (-501.542) [-502.239] (-501.547) -- 0:00:59
      252000 -- (-503.653) (-501.688) [-501.221] (-501.253) * (-501.698) (-504.861) [-504.448] (-502.354) -- 0:00:59
      252500 -- (-502.121) (-503.521) (-500.462) [-501.400] * (-501.524) [-502.091] (-501.014) (-503.248) -- 0:00:59
      253000 -- (-501.847) (-502.293) (-501.475) [-501.681] * (-501.725) [-502.919] (-500.474) (-502.956) -- 0:00:59
      253500 -- [-501.041] (-505.361) (-502.767) (-504.658) * (-504.063) [-502.325] (-500.763) (-503.063) -- 0:00:58
      254000 -- [-502.486] (-504.158) (-503.193) (-503.760) * (-500.570) (-504.650) (-501.837) [-503.212] -- 0:00:58
      254500 -- (-501.005) [-500.978] (-505.517) (-508.712) * (-504.083) (-501.068) (-502.898) [-501.201] -- 0:00:58
      255000 -- (-503.193) (-501.376) (-506.273) [-501.865] * [-504.284] (-503.133) (-506.747) (-500.774) -- 0:00:58

      Average standard deviation of split frequencies: 0.015991

      255500 -- (-502.686) (-500.838) [-502.072] (-504.448) * (-502.328) [-502.422] (-505.198) (-502.746) -- 0:00:58
      256000 -- (-503.346) [-503.392] (-501.055) (-506.667) * (-503.516) (-502.079) (-501.591) [-502.900] -- 0:00:58
      256500 -- (-503.670) (-505.203) [-500.775] (-506.668) * (-510.188) (-504.857) [-504.999] (-503.649) -- 0:00:57
      257000 -- (-502.053) (-503.357) [-505.190] (-501.849) * (-503.775) [-502.920] (-505.605) (-505.858) -- 0:00:57
      257500 -- (-502.142) (-503.418) [-503.146] (-501.570) * [-502.795] (-501.261) (-507.197) (-501.882) -- 0:00:57
      258000 -- (-503.877) [-503.579] (-500.927) (-501.482) * (-503.193) [-503.082] (-504.526) (-500.733) -- 0:00:57
      258500 -- (-500.698) (-503.523) [-501.841] (-501.617) * (-505.798) [-501.830] (-501.725) (-507.486) -- 0:00:57
      259000 -- (-501.976) (-504.830) (-501.137) [-502.059] * (-500.593) (-503.294) [-502.687] (-501.592) -- 0:00:57
      259500 -- (-501.029) (-501.953) (-502.086) [-503.941] * (-502.098) (-508.591) [-504.154] (-503.234) -- 0:00:57
      260000 -- (-501.061) (-501.892) [-502.544] (-505.148) * [-501.580] (-506.734) (-503.268) (-505.030) -- 0:00:59

      Average standard deviation of split frequencies: 0.016595

      260500 -- (-502.172) (-500.514) [-503.085] (-501.675) * (-503.237) [-509.289] (-507.522) (-502.038) -- 0:00:59
      261000 -- (-503.915) (-502.316) [-502.663] (-501.694) * (-504.088) [-502.301] (-504.759) (-503.091) -- 0:00:59
      261500 -- (-504.087) (-501.221) [-503.718] (-502.651) * [-502.740] (-502.268) (-503.987) (-509.494) -- 0:00:59
      262000 -- [-502.577] (-500.601) (-501.211) (-501.903) * (-503.826) (-502.894) (-503.288) [-504.627] -- 0:00:59
      262500 -- (-502.688) [-503.021] (-503.666) (-506.130) * (-503.205) (-503.882) (-501.911) [-500.488] -- 0:00:59
      263000 -- (-500.747) (-504.333) [-502.023] (-514.505) * (-500.635) [-507.310] (-502.437) (-504.371) -- 0:00:58
      263500 -- (-500.838) [-503.366] (-502.492) (-503.951) * [-500.941] (-503.678) (-501.232) (-504.190) -- 0:00:58
      264000 -- (-504.738) (-507.414) (-502.269) [-503.518] * (-505.932) (-502.615) (-503.937) [-503.991] -- 0:00:58
      264500 -- (-503.492) (-507.333) (-508.897) [-502.691] * (-501.229) (-504.107) [-506.647] (-504.153) -- 0:00:58
      265000 -- [-502.489] (-504.064) (-508.275) (-503.022) * (-502.585) (-500.536) [-502.594] (-503.574) -- 0:00:58

      Average standard deviation of split frequencies: 0.015261

      265500 -- (-501.880) [-501.539] (-509.586) (-504.244) * (-503.848) [-501.136] (-503.557) (-502.199) -- 0:00:58
      266000 -- [-505.965] (-502.510) (-502.518) (-503.083) * (-503.765) (-501.113) [-505.389] (-507.414) -- 0:00:57
      266500 -- (-502.039) (-504.424) [-501.965] (-503.594) * (-503.676) [-501.545] (-504.451) (-501.064) -- 0:00:57
      267000 -- [-504.226] (-503.652) (-500.413) (-504.879) * (-503.010) [-502.091] (-501.827) (-501.121) -- 0:00:57
      267500 -- (-502.552) (-503.759) [-500.585] (-503.124) * [-500.628] (-508.755) (-504.147) (-503.605) -- 0:00:57
      268000 -- (-503.097) (-503.031) [-503.951] (-501.175) * (-503.608) [-502.799] (-507.564) (-504.393) -- 0:00:57
      268500 -- [-503.020] (-506.007) (-506.306) (-501.803) * (-503.704) (-502.520) (-507.589) [-505.286] -- 0:00:57
      269000 -- (-500.870) (-501.337) [-503.129] (-502.175) * (-503.716) (-503.429) (-501.444) [-501.314] -- 0:00:57
      269500 -- (-501.942) (-500.786) [-500.837] (-503.401) * [-502.367] (-503.197) (-501.047) (-501.874) -- 0:00:56
      270000 -- (-500.862) (-502.030) (-502.773) [-506.055] * (-503.156) (-501.439) [-501.843] (-502.713) -- 0:00:56

      Average standard deviation of split frequencies: 0.014997

      270500 -- (-504.540) [-502.173] (-501.693) (-502.358) * (-502.158) (-503.547) (-504.057) [-502.632] -- 0:00:56
      271000 -- [-502.569] (-505.826) (-503.703) (-503.256) * (-505.078) (-506.631) (-501.837) [-502.351] -- 0:00:56
      271500 -- (-501.294) [-503.694] (-502.324) (-504.860) * [-502.882] (-506.761) (-505.143) (-501.611) -- 0:00:56
      272000 -- (-501.697) (-504.256) [-502.338] (-508.700) * (-509.567) (-505.757) (-505.175) [-504.236] -- 0:00:56
      272500 -- [-503.964] (-502.671) (-500.958) (-504.556) * [-502.026] (-504.169) (-504.571) (-500.560) -- 0:00:58
      273000 -- (-501.570) (-501.600) (-500.627) [-501.162] * [-501.867] (-501.820) (-506.871) (-506.344) -- 0:00:58
      273500 -- (-502.818) [-502.748] (-506.337) (-501.426) * (-501.770) (-500.949) [-501.630] (-502.992) -- 0:00:58
      274000 -- [-501.575] (-503.103) (-502.235) (-501.774) * (-501.132) (-504.872) [-503.871] (-502.731) -- 0:00:58
      274500 -- (-507.613) [-502.174] (-500.732) (-501.594) * (-501.991) (-502.116) [-502.766] (-502.613) -- 0:00:58
      275000 -- (-503.929) [-501.291] (-502.053) (-501.575) * (-503.542) (-501.269) (-502.489) [-501.617] -- 0:00:58

      Average standard deviation of split frequencies: 0.016131

      275500 -- [-502.720] (-503.254) (-504.793) (-508.506) * (-501.478) [-504.413] (-501.312) (-502.069) -- 0:00:57
      276000 -- (-502.676) (-502.540) (-502.316) [-502.902] * [-500.795] (-504.873) (-501.861) (-503.474) -- 0:00:57
      276500 -- [-501.397] (-502.015) (-501.590) (-501.626) * (-500.255) (-505.958) [-503.003] (-504.209) -- 0:00:57
      277000 -- (-502.827) (-503.535) (-501.805) [-502.308] * (-501.074) (-505.802) (-504.690) [-502.657] -- 0:00:57
      277500 -- [-503.340] (-502.405) (-502.583) (-501.825) * (-504.441) (-502.253) (-506.829) [-502.575] -- 0:00:57
      278000 -- (-501.204) (-503.939) [-501.715] (-500.661) * [-506.102] (-504.227) (-507.050) (-504.836) -- 0:00:57
      278500 -- (-502.866) (-507.814) (-500.969) [-501.628] * [-504.012] (-503.464) (-505.153) (-502.512) -- 0:00:56
      279000 -- (-501.924) (-503.130) (-500.987) [-503.017] * (-501.417) (-508.244) (-502.127) [-502.366] -- 0:00:56
      279500 -- (-505.124) (-507.445) (-505.711) [-500.818] * [-502.333] (-504.730) (-500.909) (-502.714) -- 0:00:56
      280000 -- (-502.521) (-501.467) (-501.149) [-501.971] * (-504.413) (-503.459) [-501.839] (-502.744) -- 0:00:56

      Average standard deviation of split frequencies: 0.016703

      280500 -- [-503.091] (-504.049) (-503.098) (-501.145) * [-502.615] (-502.006) (-503.613) (-501.322) -- 0:00:56
      281000 -- (-502.514) [-504.684] (-502.624) (-502.097) * (-503.621) [-501.228] (-501.827) (-500.430) -- 0:00:56
      281500 -- (-503.486) [-503.008] (-502.212) (-503.683) * (-500.727) (-501.477) [-501.338] (-504.416) -- 0:00:56
      282000 -- (-502.927) (-501.841) (-502.455) [-502.176] * (-504.536) [-503.473] (-508.049) (-501.913) -- 0:00:56
      282500 -- [-501.727] (-502.154) (-501.672) (-504.311) * (-502.726) (-502.837) [-504.176] (-503.389) -- 0:00:55
      283000 -- [-501.041] (-503.525) (-506.017) (-506.360) * (-502.888) [-504.511] (-501.312) (-502.973) -- 0:00:55
      283500 -- [-501.038] (-503.486) (-502.068) (-502.704) * (-502.373) [-501.066] (-504.169) (-509.074) -- 0:00:55
      284000 -- [-503.324] (-501.952) (-501.329) (-501.713) * (-504.303) (-505.509) [-504.017] (-502.636) -- 0:00:55
      284500 -- (-502.035) (-502.291) [-504.202] (-504.122) * (-506.853) (-507.358) (-509.034) [-503.102] -- 0:00:55
      285000 -- (-503.197) [-501.590] (-504.701) (-506.621) * [-500.919] (-504.807) (-500.941) (-502.331) -- 0:00:57

      Average standard deviation of split frequencies: 0.017142

      285500 -- (-506.508) [-508.397] (-505.220) (-503.787) * (-501.323) (-507.404) [-501.076] (-503.316) -- 0:00:57
      286000 -- (-504.613) (-503.156) [-503.061] (-501.707) * (-504.897) (-504.155) [-501.692] (-504.398) -- 0:00:57
      286500 -- (-504.378) (-502.393) [-501.086] (-501.510) * (-501.557) (-505.233) (-505.210) [-503.274] -- 0:00:57
      287000 -- [-502.164] (-504.595) (-502.749) (-502.076) * (-501.469) (-501.769) (-503.793) [-506.103] -- 0:00:57
      287500 -- [-502.993] (-501.546) (-504.231) (-504.767) * [-503.544] (-503.279) (-503.154) (-511.253) -- 0:00:57
      288000 -- (-502.877) (-501.799) (-501.577) [-501.389] * [-504.935] (-501.769) (-505.106) (-503.618) -- 0:00:56
      288500 -- (-502.115) (-501.834) (-503.544) [-504.406] * (-504.328) [-502.795] (-501.707) (-502.706) -- 0:00:56
      289000 -- (-504.819) (-502.306) (-503.235) [-502.493] * (-502.881) (-501.862) [-501.812] (-503.411) -- 0:00:56
      289500 -- (-503.395) (-503.274) [-501.181] (-506.847) * [-504.208] (-501.380) (-502.285) (-502.729) -- 0:00:56
      290000 -- (-503.120) [-501.425] (-501.475) (-507.868) * (-503.422) (-501.118) [-504.614] (-505.673) -- 0:00:56

      Average standard deviation of split frequencies: 0.016488

      290500 -- (-502.125) (-503.056) [-504.360] (-508.083) * [-501.983] (-503.838) (-503.264) (-504.178) -- 0:00:56
      291000 -- (-502.250) [-501.225] (-503.818) (-502.657) * (-504.903) (-506.224) (-502.269) [-501.268] -- 0:00:56
      291500 -- (-505.353) [-501.792] (-504.328) (-502.890) * (-501.885) (-505.258) [-506.491] (-501.940) -- 0:00:55
      292000 -- (-505.783) (-501.292) [-501.925] (-502.407) * [-500.705] (-500.723) (-503.106) (-503.179) -- 0:00:55
      292500 -- (-504.115) (-503.487) (-502.823) [-502.901] * [-502.806] (-501.214) (-505.350) (-506.478) -- 0:00:55
      293000 -- (-504.320) [-505.288] (-502.207) (-501.133) * [-501.026] (-501.247) (-501.512) (-506.797) -- 0:00:55
      293500 -- (-501.806) [-503.549] (-501.020) (-501.133) * [-501.576] (-505.783) (-501.626) (-503.251) -- 0:00:55
      294000 -- [-502.556] (-504.104) (-504.169) (-501.237) * (-501.740) (-505.501) (-502.057) [-504.644] -- 0:00:55
      294500 -- (-502.602) (-504.751) (-505.859) [-500.367] * [-502.629] (-504.858) (-503.069) (-507.642) -- 0:00:55
      295000 -- [-502.521] (-501.762) (-502.289) (-503.746) * (-503.608) (-500.965) (-501.596) [-504.676] -- 0:00:54

      Average standard deviation of split frequencies: 0.017253

      295500 -- (-501.704) (-501.153) [-501.251] (-502.446) * (-500.583) (-502.411) (-502.535) [-501.887] -- 0:00:54
      296000 -- (-501.725) (-502.962) [-501.351] (-505.017) * [-503.805] (-504.353) (-501.857) (-501.569) -- 0:00:54
      296500 -- (-501.531) [-500.706] (-504.699) (-509.860) * (-503.139) [-504.249] (-502.688) (-505.044) -- 0:00:54
      297000 -- (-501.138) [-503.241] (-503.994) (-505.680) * [-503.022] (-503.039) (-504.708) (-502.071) -- 0:00:56
      297500 -- (-507.167) (-503.909) (-502.547) [-503.848] * [-503.780] (-502.737) (-504.818) (-504.477) -- 0:00:56
      298000 -- (-503.256) (-501.868) [-501.020] (-503.219) * (-502.917) [-503.380] (-506.883) (-501.705) -- 0:00:56
      298500 -- (-502.916) (-504.668) [-502.318] (-500.838) * (-504.682) [-500.623] (-506.714) (-502.597) -- 0:00:56
      299000 -- (-501.741) (-503.080) (-503.136) [-503.044] * (-502.993) (-500.885) [-503.355] (-507.208) -- 0:00:56
      299500 -- (-504.184) [-502.485] (-506.640) (-503.922) * [-501.646] (-502.568) (-505.568) (-505.495) -- 0:00:56
      300000 -- (-502.706) [-501.358] (-503.524) (-506.036) * (-505.267) (-500.611) (-507.781) [-501.805] -- 0:00:56

      Average standard deviation of split frequencies: 0.016227

      300500 -- (-501.636) [-500.892] (-504.049) (-504.162) * [-505.645] (-503.090) (-503.178) (-500.942) -- 0:00:55
      301000 -- (-503.333) (-500.402) [-501.502] (-501.120) * [-502.111] (-501.775) (-503.964) (-507.281) -- 0:00:55
      301500 -- (-502.003) (-504.003) [-502.902] (-503.134) * (-502.623) (-502.913) [-502.928] (-506.368) -- 0:00:55
      302000 -- (-501.748) (-506.776) [-505.252] (-505.120) * [-504.546] (-500.851) (-502.070) (-503.601) -- 0:00:55
      302500 -- [-501.485] (-501.355) (-501.228) (-504.341) * (-501.634) (-501.577) (-501.559) [-502.089] -- 0:00:55
      303000 -- (-501.610) (-501.280) (-501.259) [-501.617] * (-504.355) (-501.135) (-504.716) [-500.900] -- 0:00:55
      303500 -- (-500.947) (-504.484) (-507.572) [-503.489] * (-501.770) [-501.895] (-502.616) (-504.501) -- 0:00:55
      304000 -- [-500.884] (-501.329) (-505.846) (-501.588) * (-501.170) [-501.706] (-506.135) (-505.625) -- 0:00:54
      304500 -- (-502.698) (-501.466) [-501.762] (-504.457) * (-501.677) [-500.464] (-504.209) (-501.933) -- 0:00:54
      305000 -- (-501.406) [-502.331] (-505.462) (-504.938) * (-508.355) (-502.330) [-502.938] (-501.276) -- 0:00:54

      Average standard deviation of split frequencies: 0.014525

      305500 -- (-507.068) (-502.305) (-503.989) [-503.058] * (-500.968) [-502.044] (-505.771) (-502.687) -- 0:00:54
      306000 -- (-500.871) [-502.712] (-506.115) (-502.585) * [-506.306] (-509.760) (-504.085) (-505.046) -- 0:00:54
      306500 -- (-503.909) (-505.183) (-502.279) [-501.763] * [-503.175] (-502.494) (-503.600) (-506.847) -- 0:00:54
      307000 -- (-503.116) (-503.437) [-503.111] (-505.160) * [-501.324] (-502.619) (-503.472) (-502.394) -- 0:00:54
      307500 -- [-503.777] (-505.185) (-503.238) (-500.895) * (-505.615) [-501.544] (-504.630) (-504.746) -- 0:00:54
      308000 -- (-500.849) (-506.548) (-502.408) [-501.559] * (-504.177) (-502.527) [-502.979] (-503.910) -- 0:00:53
      308500 -- (-505.249) (-502.060) [-502.448] (-502.754) * (-502.112) (-504.480) (-502.290) [-503.602] -- 0:00:53
      309000 -- (-501.970) (-503.600) [-501.204] (-505.476) * (-502.333) (-500.636) [-501.597] (-501.006) -- 0:00:53
      309500 -- (-503.840) [-502.480] (-509.041) (-503.667) * (-502.194) (-502.517) (-501.103) [-503.228] -- 0:00:55
      310000 -- (-502.903) (-505.483) (-502.339) [-501.085] * (-500.629) (-502.018) [-505.274] (-503.730) -- 0:00:55

      Average standard deviation of split frequencies: 0.013657

      310500 -- [-501.317] (-500.866) (-501.782) (-502.003) * (-501.938) (-510.828) (-504.962) [-504.112] -- 0:00:55
      311000 -- [-501.038] (-505.013) (-502.840) (-503.019) * (-503.934) (-502.547) (-504.458) [-502.214] -- 0:00:55
      311500 -- (-501.930) (-501.353) [-501.054] (-508.156) * [-501.428] (-502.664) (-501.976) (-504.857) -- 0:00:55
      312000 -- (-501.142) [-502.553] (-502.196) (-508.861) * [-502.505] (-502.777) (-501.776) (-501.624) -- 0:00:55
      312500 -- [-501.398] (-503.019) (-502.423) (-503.577) * [-500.824] (-503.149) (-502.713) (-502.417) -- 0:00:55
      313000 -- [-505.125] (-503.315) (-503.952) (-503.320) * (-502.842) [-501.286] (-502.553) (-502.883) -- 0:00:54
      313500 -- (-502.632) (-503.700) [-507.135] (-504.455) * [-502.929] (-502.957) (-504.963) (-501.598) -- 0:00:54
      314000 -- [-502.596] (-502.103) (-505.351) (-501.854) * (-503.124) (-502.183) (-504.323) [-504.368] -- 0:00:54
      314500 -- [-502.430] (-505.395) (-505.286) (-501.448) * (-502.670) (-502.087) (-502.155) [-504.214] -- 0:00:54
      315000 -- (-503.718) (-504.713) [-502.346] (-501.842) * (-501.733) (-500.717) (-503.788) [-502.516] -- 0:00:54

      Average standard deviation of split frequencies: 0.013852

      315500 -- (-502.869) (-505.206) [-501.003] (-503.389) * (-506.006) (-501.621) (-502.605) [-501.815] -- 0:00:54
      316000 -- (-503.451) [-502.950] (-503.964) (-503.637) * (-504.872) (-505.312) [-503.788] (-502.081) -- 0:00:54
      316500 -- (-505.774) (-502.679) [-502.830] (-501.252) * (-503.191) (-503.133) [-501.480] (-504.852) -- 0:00:53
      317000 -- (-501.695) (-503.865) (-505.294) [-503.312] * [-502.166] (-503.244) (-503.780) (-503.083) -- 0:00:53
      317500 -- [-502.489] (-501.924) (-501.741) (-502.269) * [-503.744] (-502.973) (-500.808) (-503.402) -- 0:00:53
      318000 -- [-501.270] (-502.825) (-503.759) (-503.745) * (-502.790) (-501.570) [-500.929] (-502.109) -- 0:00:53
      318500 -- [-501.409] (-502.860) (-503.346) (-501.650) * (-500.510) (-500.593) [-505.464] (-503.018) -- 0:00:53
      319000 -- [-504.606] (-502.741) (-504.147) (-502.161) * (-503.691) [-502.924] (-503.317) (-500.584) -- 0:00:53
      319500 -- (-504.702) (-505.372) (-503.370) [-502.435] * (-507.804) (-500.615) [-502.248] (-502.345) -- 0:00:53
      320000 -- (-501.793) (-506.843) (-502.487) [-504.794] * (-506.641) (-503.572) (-502.554) [-502.003] -- 0:00:53

      Average standard deviation of split frequencies: 0.013819

      320500 -- (-503.224) (-502.728) (-502.576) [-500.818] * (-502.265) (-504.850) (-502.485) [-505.111] -- 0:00:53
      321000 -- [-503.058] (-504.421) (-503.205) (-503.676) * [-501.585] (-504.464) (-501.909) (-500.563) -- 0:00:54
      321500 -- (-503.355) [-502.461] (-503.922) (-503.564) * [-501.821] (-506.361) (-507.609) (-503.885) -- 0:00:54
      322000 -- (-509.978) (-502.575) [-502.097] (-503.731) * (-505.553) (-506.240) (-503.061) [-500.544] -- 0:00:54
      322500 -- (-506.244) (-502.562) [-503.095] (-503.061) * (-501.499) [-504.517] (-502.823) (-502.178) -- 0:00:54
      323000 -- (-501.764) [-501.088] (-502.367) (-502.872) * (-504.155) (-505.109) (-501.646) [-500.747] -- 0:00:54
      323500 -- (-502.916) [-504.462] (-503.107) (-501.370) * [-504.734] (-500.792) (-507.079) (-506.096) -- 0:00:54
      324000 -- (-501.302) [-502.458] (-501.906) (-504.085) * (-502.194) (-505.428) (-500.989) [-503.539] -- 0:00:54
      324500 -- (-501.451) (-507.386) [-503.930] (-503.949) * (-504.059) (-503.674) (-505.300) [-503.969] -- 0:00:54
      325000 -- (-501.663) [-502.593] (-503.490) (-501.647) * (-500.569) (-502.269) (-500.756) [-501.571] -- 0:00:54

      Average standard deviation of split frequencies: 0.014460

      325500 -- (-501.538) [-500.795] (-505.105) (-501.200) * (-502.638) (-501.897) (-502.144) [-503.361] -- 0:00:53
      326000 -- (-504.372) [-501.129] (-502.201) (-508.100) * (-501.741) [-501.201] (-502.475) (-500.264) -- 0:00:53
      326500 -- (-503.954) (-504.101) (-502.341) [-500.805] * (-502.591) [-501.532] (-501.651) (-501.127) -- 0:00:53
      327000 -- (-501.558) (-503.702) [-501.815] (-503.457) * (-502.912) (-501.567) [-501.987] (-500.981) -- 0:00:53
      327500 -- (-502.646) (-501.922) [-501.924] (-503.761) * [-502.853] (-503.733) (-501.202) (-503.215) -- 0:00:53
      328000 -- (-502.456) (-501.552) (-502.029) [-506.235] * [-502.336] (-501.574) (-501.831) (-504.571) -- 0:00:53
      328500 -- (-502.768) (-503.453) [-501.636] (-502.111) * [-502.700] (-501.981) (-502.061) (-502.877) -- 0:00:53
      329000 -- (-500.821) (-505.252) (-501.629) [-503.416] * (-503.381) (-503.930) [-502.249] (-500.897) -- 0:00:53
      329500 -- [-501.593] (-502.169) (-505.119) (-502.669) * (-501.350) (-501.981) [-502.610] (-502.096) -- 0:00:52
      330000 -- (-505.386) (-509.420) (-506.225) [-501.815] * (-506.155) (-501.404) (-501.734) [-501.919] -- 0:00:52

      Average standard deviation of split frequencies: 0.013985

      330500 -- (-506.302) (-506.708) [-503.323] (-503.123) * (-508.380) (-505.112) [-501.598] (-505.081) -- 0:00:52
      331000 -- (-503.367) (-504.532) [-501.218] (-502.507) * [-503.910] (-506.639) (-505.226) (-501.699) -- 0:00:52
      331500 -- (-503.222) (-503.104) (-501.300) [-502.532] * (-503.318) [-501.614] (-506.690) (-502.236) -- 0:00:52
      332000 -- [-503.145] (-502.686) (-501.494) (-501.106) * [-501.092] (-502.170) (-502.620) (-502.261) -- 0:00:52
      332500 -- (-503.920) [-501.685] (-504.139) (-504.037) * (-502.843) [-500.680] (-501.472) (-503.245) -- 0:00:54
      333000 -- [-503.925] (-506.221) (-501.985) (-506.073) * (-505.813) [-501.840] (-502.950) (-501.664) -- 0:00:54
      333500 -- (-501.343) (-503.322) [-503.034] (-503.278) * [-502.857] (-502.970) (-502.361) (-501.353) -- 0:00:53
      334000 -- [-502.336] (-501.680) (-503.101) (-502.309) * [-500.799] (-502.172) (-502.071) (-506.069) -- 0:00:53
      334500 -- [-501.326] (-503.020) (-504.215) (-502.088) * (-505.336) [-504.009] (-501.792) (-505.409) -- 0:00:53
      335000 -- (-502.194) [-503.437] (-505.414) (-507.120) * (-503.127) [-502.009] (-502.320) (-503.069) -- 0:00:53

      Average standard deviation of split frequencies: 0.015363

      335500 -- [-501.162] (-504.595) (-500.775) (-503.696) * [-501.841] (-502.040) (-502.788) (-503.144) -- 0:00:53
      336000 -- (-502.186) (-502.466) [-504.688] (-502.602) * (-502.412) [-500.961] (-504.306) (-502.257) -- 0:00:53
      336500 -- (-501.967) (-505.559) (-501.660) [-502.996] * (-503.478) (-503.545) [-505.157] (-503.331) -- 0:00:53
      337000 -- [-500.711] (-507.244) (-505.680) (-501.481) * [-501.301] (-506.127) (-505.907) (-504.756) -- 0:00:53
      337500 -- (-502.938) (-503.711) [-505.768] (-502.432) * (-501.835) (-503.981) (-500.940) [-502.560] -- 0:00:53
      338000 -- [-503.859] (-501.856) (-502.648) (-504.729) * [-501.818] (-503.886) (-502.898) (-502.631) -- 0:00:52
      338500 -- [-500.689] (-504.883) (-509.117) (-503.324) * (-500.526) [-504.663] (-502.643) (-503.328) -- 0:00:52
      339000 -- (-500.915) (-501.855) [-505.345] (-503.294) * (-504.124) [-500.600] (-503.275) (-502.783) -- 0:00:52
      339500 -- (-507.166) (-501.032) (-503.957) [-503.738] * (-506.175) (-502.663) (-502.828) [-501.461] -- 0:00:52
      340000 -- (-501.768) (-501.518) [-501.313] (-503.718) * [-503.610] (-505.275) (-504.475) (-502.444) -- 0:00:52

      Average standard deviation of split frequencies: 0.016190

      340500 -- (-505.640) [-501.567] (-504.564) (-501.836) * (-504.409) (-504.393) [-502.089] (-502.545) -- 0:00:52
      341000 -- (-505.131) (-503.451) (-501.571) [-503.228] * (-503.579) (-502.092) (-503.107) [-502.636] -- 0:00:52
      341500 -- (-503.347) [-501.550] (-502.621) (-503.136) * (-502.237) (-502.177) (-503.241) [-500.460] -- 0:00:52
      342000 -- [-504.614] (-505.075) (-503.619) (-506.724) * [-504.945] (-500.745) (-505.248) (-501.311) -- 0:00:51
      342500 -- (-505.263) (-503.265) (-500.995) [-502.933] * [-500.757] (-502.890) (-501.986) (-500.587) -- 0:00:51
      343000 -- (-504.365) [-503.156] (-508.980) (-501.471) * (-501.312) (-501.560) (-502.669) [-500.854] -- 0:00:51
      343500 -- [-504.828] (-500.806) (-504.479) (-501.183) * (-504.074) (-502.167) (-504.343) [-501.316] -- 0:00:51
      344000 -- (-502.620) [-506.111] (-505.109) (-501.515) * (-505.218) (-504.063) [-501.738] (-501.729) -- 0:00:51
      344500 -- (-501.725) (-505.160) [-505.285] (-503.747) * [-505.236] (-504.730) (-501.045) (-504.652) -- 0:00:53
      345000 -- (-502.140) [-504.290] (-502.285) (-506.126) * (-502.550) (-502.026) [-502.433] (-506.734) -- 0:00:53

      Average standard deviation of split frequencies: 0.015532

      345500 -- (-504.691) (-502.467) (-501.115) [-502.989] * [-501.767] (-501.036) (-500.817) (-504.404) -- 0:00:53
      346000 -- (-510.229) [-500.502] (-502.328) (-502.533) * (-502.544) [-501.656] (-506.355) (-502.103) -- 0:00:52
      346500 -- (-502.055) [-504.507] (-502.538) (-503.767) * [-504.264] (-503.677) (-502.978) (-500.602) -- 0:00:52
      347000 -- (-500.654) (-501.006) (-500.901) [-503.019] * (-504.361) (-503.650) [-502.925] (-500.518) -- 0:00:52
      347500 -- (-505.068) [-503.014] (-502.985) (-500.978) * (-506.167) (-502.308) (-504.889) [-500.501] -- 0:00:52
      348000 -- (-502.093) [-501.786] (-505.070) (-506.841) * (-504.614) (-502.308) [-501.774] (-501.608) -- 0:00:52
      348500 -- (-504.203) [-501.163] (-504.475) (-507.289) * (-501.595) (-503.281) (-503.233) [-502.984] -- 0:00:52
      349000 -- (-500.649) [-503.380] (-501.535) (-502.565) * [-504.449] (-505.755) (-501.352) (-503.142) -- 0:00:52
      349500 -- (-500.770) (-505.652) (-502.814) [-504.581] * (-502.201) [-500.889] (-502.898) (-500.999) -- 0:00:52
      350000 -- (-502.722) [-501.573] (-501.952) (-504.077) * (-504.375) (-500.944) [-501.302] (-504.564) -- 0:00:52

      Average standard deviation of split frequencies: 0.016627

      350500 -- (-501.910) [-505.178] (-502.039) (-504.432) * [-504.718] (-501.066) (-504.077) (-505.102) -- 0:00:51
      351000 -- (-502.429) [-504.435] (-504.049) (-500.982) * (-502.354) [-501.218] (-502.432) (-503.292) -- 0:00:51
      351500 -- (-502.592) [-504.836] (-508.365) (-501.448) * [-501.485] (-500.728) (-500.835) (-504.996) -- 0:00:51
      352000 -- (-500.572) (-502.862) [-501.947] (-506.190) * (-503.212) (-503.888) [-504.305] (-500.815) -- 0:00:51
      352500 -- [-502.172] (-501.312) (-503.946) (-505.651) * (-504.906) (-501.273) [-500.742] (-503.276) -- 0:00:51
      353000 -- [-501.257] (-503.904) (-503.353) (-502.716) * (-500.999) (-502.120) (-502.192) [-501.431] -- 0:00:51
      353500 -- [-501.673] (-503.669) (-501.403) (-503.006) * [-502.890] (-503.405) (-503.736) (-506.850) -- 0:00:51
      354000 -- (-504.678) [-502.267] (-504.276) (-501.906) * [-501.703] (-504.195) (-503.711) (-503.389) -- 0:00:51
      354500 -- (-503.577) (-501.387) [-502.804] (-501.578) * [-501.226] (-502.755) (-504.504) (-501.958) -- 0:00:50
      355000 -- (-502.712) [-501.831] (-502.332) (-503.324) * [-501.236] (-505.693) (-502.621) (-502.707) -- 0:00:50

      Average standard deviation of split frequencies: 0.016448

      355500 -- (-512.420) (-501.135) [-501.346] (-502.472) * (-502.590) (-501.635) (-502.712) [-502.703] -- 0:00:50
      356000 -- (-500.595) (-501.747) [-501.241] (-504.470) * (-502.712) [-506.345] (-503.204) (-501.104) -- 0:00:52
      356500 -- (-500.475) (-508.179) [-503.833] (-502.267) * [-502.500] (-501.171) (-506.836) (-501.691) -- 0:00:52
      357000 -- (-503.332) (-503.365) (-501.095) [-503.156] * (-501.801) [-501.499] (-504.838) (-502.047) -- 0:00:52
      357500 -- (-503.763) (-506.800) (-502.134) [-504.089] * (-500.966) (-503.317) (-502.834) [-501.324] -- 0:00:52
      358000 -- (-504.655) (-505.107) (-504.128) [-506.570] * [-500.410] (-503.143) (-502.851) (-500.447) -- 0:00:52
      358500 -- (-506.044) (-502.310) [-503.507] (-506.002) * (-502.996) [-502.469] (-504.281) (-501.435) -- 0:00:51
      359000 -- [-504.859] (-502.700) (-503.922) (-501.010) * (-502.410) [-503.596] (-502.203) (-501.156) -- 0:00:51
      359500 -- (-506.800) (-502.756) [-501.696] (-502.446) * (-502.571) (-502.518) (-508.735) [-500.598] -- 0:00:51
      360000 -- [-502.829] (-502.678) (-505.161) (-502.622) * [-502.152] (-505.648) (-501.166) (-509.181) -- 0:00:51

      Average standard deviation of split frequencies: 0.016097

      360500 -- [-503.551] (-502.499) (-505.340) (-503.623) * [-501.878] (-502.409) (-502.466) (-504.126) -- 0:00:51
      361000 -- [-502.431] (-505.723) (-505.888) (-504.293) * [-502.248] (-503.068) (-502.078) (-503.477) -- 0:00:51
      361500 -- (-502.998) (-503.932) [-503.797] (-503.686) * (-503.260) (-502.563) (-502.670) [-507.208] -- 0:00:51
      362000 -- [-503.094] (-503.167) (-504.748) (-501.993) * (-502.565) (-508.343) [-502.507] (-504.071) -- 0:00:51
      362500 -- (-504.808) [-502.215] (-504.107) (-506.376) * (-502.407) (-505.235) [-501.623] (-504.362) -- 0:00:51
      363000 -- [-503.415] (-501.829) (-500.982) (-501.290) * [-502.466] (-501.151) (-503.400) (-504.630) -- 0:00:50
      363500 -- (-505.505) (-505.477) [-501.400] (-506.452) * (-504.774) (-506.478) [-503.782] (-507.286) -- 0:00:50
      364000 -- (-501.016) (-508.274) [-503.167] (-503.329) * [-501.334] (-503.959) (-507.538) (-502.113) -- 0:00:50
      364500 -- (-504.592) (-502.559) [-503.193] (-501.464) * (-506.201) (-513.409) (-501.946) [-501.155] -- 0:00:50
      365000 -- (-501.608) (-504.196) [-501.678] (-503.078) * (-501.934) (-503.635) (-501.734) [-504.199] -- 0:00:50

      Average standard deviation of split frequencies: 0.015395

      365500 -- (-502.718) [-503.279] (-503.177) (-502.496) * (-501.532) [-503.083] (-502.369) (-506.837) -- 0:00:50
      366000 -- [-503.808] (-504.779) (-502.910) (-504.808) * [-502.059] (-504.719) (-501.106) (-503.355) -- 0:00:50
      366500 -- (-504.055) [-500.874] (-500.711) (-503.568) * (-502.614) [-502.723] (-504.765) (-506.707) -- 0:00:50
      367000 -- [-505.578] (-502.786) (-501.663) (-504.160) * (-506.473) (-503.345) (-515.814) [-504.444] -- 0:00:50
      367500 -- (-500.891) (-501.892) [-502.840] (-505.064) * (-506.314) [-500.661] (-504.371) (-501.202) -- 0:00:49
      368000 -- (-502.121) (-501.224) (-503.766) [-501.696] * [-502.836] (-505.567) (-502.231) (-501.591) -- 0:00:51
      368500 -- [-502.740] (-504.651) (-503.582) (-503.615) * (-501.651) [-502.096] (-504.018) (-504.257) -- 0:00:51
      369000 -- (-502.888) (-502.835) [-503.869] (-503.128) * [-501.346] (-503.768) (-502.556) (-509.249) -- 0:00:51
      369500 -- (-504.351) (-504.106) (-504.876) [-502.489] * (-501.911) [-502.914] (-502.805) (-505.673) -- 0:00:51
      370000 -- (-502.435) (-504.927) [-503.108] (-502.797) * [-501.636] (-501.233) (-502.034) (-501.362) -- 0:00:51

      Average standard deviation of split frequencies: 0.014391

      370500 -- (-502.670) [-502.683] (-504.019) (-514.454) * [-505.567] (-503.730) (-504.356) (-504.975) -- 0:00:50
      371000 -- [-500.826] (-500.869) (-502.396) (-505.098) * (-505.528) [-502.970] (-501.896) (-504.124) -- 0:00:50
      371500 -- (-500.856) [-502.496] (-504.100) (-504.049) * (-500.989) (-501.585) [-500.729] (-501.479) -- 0:00:50
      372000 -- (-500.660) [-503.089] (-504.945) (-505.795) * (-504.877) [-501.876] (-501.503) (-503.811) -- 0:00:50
      372500 -- (-500.892) (-507.121) (-501.744) [-506.457] * (-507.025) (-502.560) (-506.879) [-502.345] -- 0:00:50
      373000 -- [-501.349] (-503.803) (-502.810) (-504.734) * (-501.288) (-503.713) [-500.635] (-502.054) -- 0:00:50
      373500 -- [-505.227] (-503.670) (-504.114) (-502.021) * (-501.449) (-503.072) [-502.116] (-502.848) -- 0:00:50
      374000 -- (-506.111) (-503.986) [-501.364] (-501.343) * (-501.274) [-503.780] (-500.680) (-509.458) -- 0:00:50
      374500 -- (-506.140) (-508.261) (-503.346) [-504.138] * (-501.018) (-506.265) [-501.622] (-506.403) -- 0:00:50
      375000 -- [-502.023] (-501.882) (-502.790) (-503.325) * (-502.479) (-501.815) (-501.681) [-504.154] -- 0:00:50

      Average standard deviation of split frequencies: 0.013861

      375500 -- (-506.972) [-501.615] (-502.162) (-502.060) * [-502.372] (-505.409) (-503.835) (-506.730) -- 0:00:49
      376000 -- (-502.247) (-503.605) [-504.425] (-502.933) * (-504.070) (-503.782) (-503.308) [-503.893] -- 0:00:49
      376500 -- (-501.219) (-503.101) [-501.852] (-508.181) * (-502.207) (-501.281) [-506.147] (-502.981) -- 0:00:49
      377000 -- [-502.589] (-506.089) (-501.387) (-501.249) * (-504.188) [-500.815] (-501.837) (-504.158) -- 0:00:49
      377500 -- (-504.046) (-503.981) (-505.194) [-502.016] * (-501.205) (-502.441) [-501.228] (-501.870) -- 0:00:49
      378000 -- [-502.641] (-505.128) (-500.597) (-501.752) * [-501.061] (-501.079) (-503.972) (-503.102) -- 0:00:49
      378500 -- [-503.557] (-504.596) (-500.611) (-501.942) * (-505.350) (-502.967) [-500.737] (-500.852) -- 0:00:49
      379000 -- (-501.764) (-504.133) [-502.433] (-503.315) * (-509.044) [-501.205] (-505.320) (-501.059) -- 0:00:49
      379500 -- (-503.304) (-504.811) [-501.744] (-507.120) * (-502.777) [-501.351] (-507.952) (-501.246) -- 0:00:49
      380000 -- (-505.999) (-500.659) [-505.503] (-505.743) * (-500.836) (-502.418) [-502.932] (-501.760) -- 0:00:48

      Average standard deviation of split frequencies: 0.013484

      380500 -- (-503.189) (-501.427) [-502.939] (-502.664) * (-504.509) [-503.937] (-504.948) (-505.572) -- 0:00:50
      381000 -- (-507.052) [-502.320] (-503.016) (-503.034) * [-503.629] (-503.866) (-503.870) (-503.700) -- 0:00:50
      381500 -- [-501.341] (-510.763) (-505.417) (-506.408) * [-504.727] (-504.527) (-503.413) (-507.476) -- 0:00:50
      382000 -- [-501.244] (-507.388) (-504.926) (-504.004) * (-501.494) [-500.708] (-502.630) (-500.998) -- 0:00:50
      382500 -- (-500.735) [-504.719] (-501.565) (-505.532) * [-501.798] (-502.876) (-506.743) (-501.058) -- 0:00:50
      383000 -- [-500.774] (-501.235) (-503.630) (-508.285) * [-501.422] (-501.909) (-504.459) (-502.051) -- 0:00:49
      383500 -- (-501.696) [-500.650] (-502.225) (-505.576) * (-505.505) [-500.960] (-502.315) (-502.206) -- 0:00:49
      384000 -- (-500.869) (-500.729) [-501.978] (-505.052) * (-503.328) (-504.565) (-502.985) [-503.148] -- 0:00:49
      384500 -- (-503.010) (-501.572) [-503.136] (-502.014) * [-500.959] (-505.857) (-502.593) (-501.326) -- 0:00:49
      385000 -- (-505.586) (-501.410) (-500.960) [-502.439] * (-501.213) (-504.916) [-501.716] (-501.481) -- 0:00:49

      Average standard deviation of split frequencies: 0.013230

      385500 -- (-506.382) [-501.764] (-502.242) (-502.193) * (-504.637) (-501.813) [-501.831] (-501.925) -- 0:00:49
      386000 -- (-506.010) (-504.299) (-503.104) [-502.193] * [-503.053] (-502.074) (-503.588) (-501.170) -- 0:00:49
      386500 -- (-507.760) (-500.783) (-502.452) [-502.332] * (-504.251) (-506.163) [-502.477] (-502.603) -- 0:00:49
      387000 -- (-503.821) (-502.449) (-505.791) [-500.673] * (-502.595) (-502.446) (-504.231) [-501.968] -- 0:00:49
      387500 -- (-506.337) (-500.473) (-501.160) [-502.456] * (-503.308) [-503.916] (-504.176) (-503.942) -- 0:00:49
      388000 -- (-506.952) [-501.366] (-502.873) (-502.043) * (-506.289) (-503.152) [-502.361] (-506.098) -- 0:00:48
      388500 -- [-501.505] (-501.633) (-508.781) (-500.987) * (-506.162) [-503.565] (-502.840) (-501.365) -- 0:00:48
      389000 -- (-501.897) (-500.807) (-501.338) [-501.948] * (-502.718) [-500.792] (-501.623) (-505.855) -- 0:00:48
      389500 -- (-503.024) (-504.447) (-503.351) [-501.672] * (-502.239) (-501.486) [-504.820] (-505.211) -- 0:00:48
      390000 -- (-501.931) (-502.863) [-500.515] (-504.112) * [-502.547] (-503.726) (-502.981) (-507.556) -- 0:00:48

      Average standard deviation of split frequencies: 0.013557

      390500 -- (-502.103) (-504.129) [-502.067] (-500.924) * [-504.596] (-502.006) (-502.396) (-505.275) -- 0:00:48
      391000 -- (-503.580) (-505.287) [-502.252] (-502.552) * [-502.381] (-506.748) (-513.481) (-501.652) -- 0:00:48
      391500 -- (-504.582) (-503.440) (-501.404) [-506.374] * [-501.876] (-506.106) (-502.416) (-501.475) -- 0:00:48
      392000 -- (-502.123) [-502.059] (-500.711) (-501.651) * (-502.415) [-501.360] (-501.268) (-502.102) -- 0:00:48
      392500 -- (-504.290) (-501.868) [-502.376] (-501.177) * [-501.209] (-502.349) (-501.618) (-501.552) -- 0:00:47
      393000 -- (-503.699) (-502.625) (-501.983) [-507.258] * (-503.491) [-500.524] (-501.891) (-502.459) -- 0:00:47
      393500 -- (-504.971) [-500.871] (-502.257) (-502.705) * (-503.754) (-502.202) [-502.793] (-503.042) -- 0:00:49
      394000 -- (-502.577) (-503.778) (-501.991) [-504.293] * (-503.446) (-501.648) (-501.756) [-502.426] -- 0:00:49
      394500 -- (-502.426) (-504.342) (-502.130) [-503.832] * (-504.688) [-504.010] (-500.992) (-501.316) -- 0:00:49
      395000 -- (-501.466) (-501.903) (-504.996) [-502.524] * [-501.634] (-503.317) (-501.380) (-503.306) -- 0:00:49

      Average standard deviation of split frequencies: 0.012367

      395500 -- [-501.356] (-502.793) (-502.208) (-503.397) * [-503.180] (-501.726) (-504.333) (-503.977) -- 0:00:48
      396000 -- (-500.539) (-501.263) [-501.615] (-509.722) * (-503.103) [-501.196] (-504.466) (-504.955) -- 0:00:48
      396500 -- (-500.891) (-502.204) [-501.491] (-506.013) * (-500.892) (-500.963) [-501.108] (-503.525) -- 0:00:48
      397000 -- (-501.058) (-502.022) [-503.595] (-506.802) * (-505.531) [-501.718] (-501.896) (-503.571) -- 0:00:48
      397500 -- [-501.729] (-502.334) (-504.867) (-507.948) * (-503.078) (-501.590) (-504.653) [-501.150] -- 0:00:48
      398000 -- [-502.023] (-502.086) (-503.467) (-502.119) * (-501.979) (-501.101) (-502.274) [-504.279] -- 0:00:48
      398500 -- (-502.479) (-501.484) [-504.980] (-502.081) * (-501.396) (-505.187) [-503.741] (-504.655) -- 0:00:48
      399000 -- (-503.607) [-501.755] (-500.942) (-500.694) * [-501.301] (-504.252) (-506.414) (-506.069) -- 0:00:48
      399500 -- (-502.741) (-502.660) (-501.004) [-500.603] * (-504.709) (-501.135) [-504.622] (-506.454) -- 0:00:48
      400000 -- (-506.506) [-501.087] (-502.769) (-501.354) * [-502.683] (-501.927) (-501.306) (-500.870) -- 0:00:48

      Average standard deviation of split frequencies: 0.013634

      400500 -- [-502.910] (-505.886) (-506.150) (-505.124) * [-501.317] (-503.143) (-500.922) (-505.011) -- 0:00:47
      401000 -- (-501.234) (-502.653) [-502.872] (-501.381) * (-503.860) [-501.273] (-503.290) (-500.833) -- 0:00:47
      401500 -- [-505.089] (-502.399) (-505.492) (-502.917) * (-501.795) (-504.057) [-502.992] (-501.064) -- 0:00:47
      402000 -- (-504.861) [-502.123] (-502.561) (-504.305) * (-502.524) (-502.488) [-502.827] (-502.016) -- 0:00:47
      402500 -- (-502.739) (-502.868) (-502.317) [-503.580] * (-504.811) (-501.700) (-503.315) [-501.005] -- 0:00:47
      403000 -- [-500.628] (-504.195) (-502.404) (-501.733) * [-503.052] (-501.579) (-502.893) (-507.284) -- 0:00:47
      403500 -- (-500.649) (-502.323) (-504.261) [-501.858] * [-502.178] (-501.315) (-501.516) (-501.705) -- 0:00:47
      404000 -- (-501.348) (-504.971) [-503.443] (-500.982) * (-503.134) [-501.133] (-503.358) (-502.349) -- 0:00:47
      404500 -- (-501.843) [-502.063] (-501.294) (-504.153) * (-504.676) (-503.229) [-501.134] (-502.431) -- 0:00:47
      405000 -- (-501.378) (-503.668) [-502.521] (-502.127) * (-502.042) (-504.703) (-501.526) [-501.575] -- 0:00:47

      Average standard deviation of split frequencies: 0.013114

      405500 -- (-500.764) (-500.851) (-505.561) [-502.716] * (-502.484) (-502.092) (-501.901) [-502.242] -- 0:00:46
      406000 -- (-504.083) [-502.692] (-503.430) (-507.617) * (-502.053) [-501.416] (-503.432) (-505.246) -- 0:00:48
      406500 -- (-504.055) (-501.554) [-502.361] (-502.788) * [-502.283] (-501.186) (-501.297) (-502.869) -- 0:00:48
      407000 -- (-503.660) [-503.256] (-500.818) (-502.956) * [-501.588] (-501.036) (-501.343) (-502.244) -- 0:00:48
      407500 -- (-502.471) (-509.451) [-502.928] (-500.752) * (-504.241) (-505.781) (-501.070) [-500.553] -- 0:00:47
      408000 -- (-501.609) (-504.870) (-506.955) [-501.450] * (-502.716) (-500.647) (-501.010) [-501.317] -- 0:00:47
      408500 -- (-501.525) [-502.438] (-502.749) (-500.795) * [-502.761] (-501.796) (-501.150) (-501.694) -- 0:00:47
      409000 -- [-504.463] (-503.379) (-506.075) (-500.879) * (-501.412) (-503.166) [-502.738] (-505.205) -- 0:00:47
      409500 -- (-504.937) (-503.734) [-505.635] (-506.865) * (-501.216) [-504.025] (-505.078) (-505.747) -- 0:00:47
      410000 -- (-503.342) (-507.988) [-505.458] (-504.304) * (-503.937) (-503.905) [-502.313] (-503.341) -- 0:00:47

      Average standard deviation of split frequencies: 0.013167

      410500 -- (-501.558) (-504.936) [-503.879] (-501.794) * (-506.438) (-504.148) (-501.454) [-504.314] -- 0:00:47
      411000 -- (-502.261) [-502.320] (-503.094) (-500.911) * (-502.506) (-504.904) [-501.699] (-503.308) -- 0:00:47
      411500 -- (-501.082) (-501.195) [-500.948] (-504.186) * (-501.299) (-501.909) (-501.696) [-502.398] -- 0:00:47
      412000 -- (-504.282) [-503.060] (-505.673) (-510.880) * (-500.778) (-502.256) (-503.780) [-502.649] -- 0:00:47
      412500 -- [-506.110] (-504.432) (-502.847) (-501.386) * (-505.665) (-501.404) [-507.272] (-507.732) -- 0:00:47
      413000 -- [-501.455] (-501.144) (-503.895) (-503.031) * (-502.200) (-501.595) [-502.477] (-501.106) -- 0:00:46
      413500 -- (-502.299) (-503.583) [-504.991] (-503.272) * (-502.339) (-503.261) (-505.397) [-503.416] -- 0:00:46
      414000 -- (-503.074) (-502.210) [-501.258] (-501.743) * (-502.540) (-504.367) (-502.234) [-502.661] -- 0:00:46
      414500 -- (-506.885) (-501.557) [-502.942] (-502.904) * (-502.057) [-505.956] (-501.651) (-503.695) -- 0:00:46
      415000 -- (-503.024) (-503.598) (-502.693) [-502.713] * [-500.712] (-502.293) (-503.557) (-506.066) -- 0:00:46

      Average standard deviation of split frequencies: 0.012865

      415500 -- (-501.156) (-503.830) (-503.087) [-501.275] * (-501.347) [-502.109] (-502.290) (-505.701) -- 0:00:46
      416000 -- (-502.589) (-502.940) [-502.644] (-503.975) * (-500.899) (-504.097) [-500.690] (-500.735) -- 0:00:46
      416500 -- [-501.752] (-502.091) (-501.751) (-505.590) * (-502.277) (-505.321) (-504.989) [-502.172] -- 0:00:46
      417000 -- (-500.709) (-502.434) [-502.100] (-504.959) * (-501.919) (-503.871) [-501.863] (-502.922) -- 0:00:46
      417500 -- (-501.965) [-501.783] (-503.664) (-501.711) * (-502.567) (-505.571) (-501.543) [-503.233] -- 0:00:46
      418000 -- (-505.428) (-501.242) [-501.077] (-506.699) * (-501.196) [-501.256] (-503.521) (-501.285) -- 0:00:47
      418500 -- [-503.134] (-507.220) (-500.508) (-506.128) * (-505.276) [-502.552] (-505.939) (-504.223) -- 0:00:47
      419000 -- (-504.981) (-501.415) [-500.644] (-503.266) * (-502.590) [-504.750] (-505.038) (-505.462) -- 0:00:47
      419500 -- (-502.929) (-506.367) (-503.340) [-501.832] * (-501.343) [-500.370] (-501.554) (-505.203) -- 0:00:47
      420000 -- [-502.887] (-504.251) (-505.733) (-501.017) * (-502.969) [-500.468] (-503.691) (-505.929) -- 0:00:46

      Average standard deviation of split frequencies: 0.012920

      420500 -- (-508.139) (-504.218) (-505.138) [-501.544] * [-502.616] (-502.932) (-503.029) (-505.573) -- 0:00:46
      421000 -- [-502.910] (-501.174) (-506.674) (-501.659) * (-503.918) [-502.788] (-503.216) (-506.417) -- 0:00:46
      421500 -- (-501.030) (-500.817) (-501.263) [-502.079] * (-503.071) (-506.097) (-503.551) [-501.671] -- 0:00:46
      422000 -- [-501.600] (-502.213) (-505.151) (-505.309) * [-503.698] (-501.480) (-500.635) (-505.296) -- 0:00:46
      422500 -- (-502.590) [-502.062] (-505.957) (-502.015) * (-502.476) (-508.002) [-504.898] (-505.633) -- 0:00:46
      423000 -- (-503.424) [-503.011] (-502.331) (-503.412) * [-502.843] (-501.222) (-501.495) (-508.220) -- 0:00:46
      423500 -- (-502.989) (-506.761) [-501.176] (-502.112) * (-502.549) (-500.702) [-500.761] (-507.388) -- 0:00:46
      424000 -- [-506.342] (-502.055) (-500.527) (-502.112) * [-501.301] (-502.268) (-503.235) (-506.261) -- 0:00:46
      424500 -- (-507.014) (-501.258) (-500.396) [-501.624] * (-504.671) (-504.553) (-503.068) [-503.011] -- 0:00:46
      425000 -- (-502.344) [-502.873] (-502.633) (-502.836) * (-503.767) (-504.194) (-501.406) [-503.311] -- 0:00:46

      Average standard deviation of split frequencies: 0.012910

      425500 -- (-502.472) (-501.611) [-502.201] (-501.673) * [-501.925] (-501.807) (-503.999) (-503.114) -- 0:00:45
      426000 -- (-502.654) [-503.335] (-503.437) (-503.735) * (-502.013) (-501.290) [-501.342] (-503.698) -- 0:00:45
      426500 -- (-500.886) (-500.479) (-502.348) [-503.384] * (-502.636) [-500.414] (-501.988) (-501.575) -- 0:00:45
      427000 -- (-503.037) (-501.232) (-502.821) [-503.595] * [-502.500] (-503.003) (-502.104) (-502.385) -- 0:00:45
      427500 -- (-504.947) (-505.124) [-504.107] (-504.014) * (-502.793) [-502.197] (-501.373) (-501.607) -- 0:00:45
      428000 -- (-501.997) (-506.176) (-504.179) [-502.505] * (-501.337) (-501.273) (-501.389) [-501.054] -- 0:00:45
      428500 -- [-500.887] (-510.181) (-501.271) (-508.711) * (-503.905) (-501.273) (-502.362) [-501.575] -- 0:00:45
      429000 -- (-500.974) [-501.706] (-502.827) (-502.465) * (-504.533) (-500.483) (-501.787) [-502.694] -- 0:00:46
      429500 -- (-503.302) (-503.077) [-504.386] (-504.326) * (-504.665) [-500.895] (-502.521) (-501.380) -- 0:00:46
      430000 -- (-503.602) (-508.131) [-501.789] (-502.162) * (-504.365) (-500.831) [-501.261] (-503.216) -- 0:00:46

      Average standard deviation of split frequencies: 0.014165

      430500 -- (-500.837) (-504.101) (-502.925) [-503.232] * [-503.842] (-505.049) (-506.065) (-504.263) -- 0:00:46
      431000 -- (-502.358) (-504.361) [-507.484] (-505.585) * (-501.468) [-501.960] (-502.772) (-502.210) -- 0:00:46
      431500 -- (-501.355) (-501.222) (-503.169) [-502.984] * (-504.672) [-502.427] (-503.317) (-501.867) -- 0:00:46
      432000 -- (-507.008) (-506.339) [-503.133] (-504.721) * [-501.944] (-501.898) (-500.949) (-502.504) -- 0:00:46
      432500 -- [-500.905] (-503.794) (-501.856) (-506.027) * (-504.451) [-500.876] (-502.153) (-501.563) -- 0:00:45
      433000 -- (-501.487) (-504.021) [-501.952] (-502.982) * [-502.568] (-501.960) (-501.810) (-501.930) -- 0:00:45
      433500 -- [-501.793] (-501.278) (-502.275) (-510.609) * [-504.295] (-503.565) (-502.697) (-501.543) -- 0:00:45
      434000 -- [-501.914] (-504.885) (-501.867) (-503.396) * (-502.139) [-502.838] (-501.280) (-501.420) -- 0:00:45
      434500 -- [-502.677] (-505.471) (-507.344) (-502.190) * [-501.007] (-501.076) (-501.630) (-502.969) -- 0:00:45
      435000 -- (-503.405) [-503.526] (-504.578) (-506.036) * (-502.274) (-501.067) (-506.733) [-501.255] -- 0:00:45

      Average standard deviation of split frequencies: 0.013996

      435500 -- (-501.741) [-503.409] (-505.166) (-503.231) * (-504.403) (-503.866) (-501.057) [-502.539] -- 0:00:45
      436000 -- (-504.881) (-504.648) [-501.330] (-502.278) * [-500.884] (-503.373) (-504.448) (-501.624) -- 0:00:45
      436500 -- (-506.918) (-502.450) [-501.665] (-502.810) * (-503.020) (-502.380) [-503.563] (-506.317) -- 0:00:45
      437000 -- (-504.261) (-502.844) (-500.603) [-504.116] * [-506.197] (-501.840) (-506.043) (-502.455) -- 0:00:45
      437500 -- (-502.797) [-501.249] (-502.141) (-508.301) * (-502.371) [-502.415] (-507.102) (-503.459) -- 0:00:45
      438000 -- (-502.641) (-503.973) (-502.399) [-503.434] * (-504.662) (-508.276) (-505.043) [-501.820] -- 0:00:44
      438500 -- (-503.031) (-502.235) (-500.784) [-502.395] * (-503.990) (-503.497) (-505.132) [-501.552] -- 0:00:44
      439000 -- (-502.083) (-502.129) [-502.477] (-503.142) * (-502.340) (-500.611) (-507.897) [-502.035] -- 0:00:44
      439500 -- (-502.506) [-501.646] (-501.767) (-501.113) * [-501.035] (-502.028) (-504.401) (-501.114) -- 0:00:44
      440000 -- (-503.780) (-505.764) [-501.535] (-501.713) * [-502.679] (-504.205) (-502.658) (-500.521) -- 0:00:44

      Average standard deviation of split frequencies: 0.013966

      440500 -- (-502.564) (-504.031) (-501.878) [-503.709] * (-500.986) (-504.007) [-504.926] (-503.180) -- 0:00:44
      441000 -- [-508.787] (-500.887) (-500.893) (-505.513) * [-502.474] (-502.682) (-504.177) (-503.707) -- 0:00:44
      441500 -- (-503.613) (-502.251) [-501.486] (-507.352) * (-508.279) [-503.808] (-504.030) (-506.673) -- 0:00:44
      442000 -- (-509.982) [-503.559] (-502.860) (-504.531) * (-506.432) [-505.003] (-504.928) (-512.826) -- 0:00:45
      442500 -- (-501.185) [-502.961] (-502.739) (-504.263) * (-504.534) (-503.906) (-503.251) [-502.658] -- 0:00:45
      443000 -- (-501.827) (-502.995) (-504.668) [-500.542] * (-504.268) [-505.003] (-501.148) (-502.780) -- 0:00:45
      443500 -- (-501.196) (-503.247) [-506.469] (-504.348) * (-507.378) (-506.675) (-501.517) [-502.151] -- 0:00:45
      444000 -- [-502.469] (-503.509) (-503.280) (-503.830) * [-503.107] (-503.427) (-504.087) (-501.119) -- 0:00:45
      444500 -- (-503.798) (-506.656) [-501.813] (-502.537) * (-504.365) (-504.545) [-504.058] (-501.641) -- 0:00:44
      445000 -- (-503.283) (-501.686) (-502.689) [-501.276] * [-502.331] (-502.377) (-507.693) (-501.586) -- 0:00:44

      Average standard deviation of split frequencies: 0.014152

      445500 -- (-501.937) [-502.526] (-503.610) (-502.075) * [-502.377] (-501.357) (-502.847) (-502.976) -- 0:00:44
      446000 -- [-501.919] (-503.184) (-504.553) (-503.868) * (-501.643) [-503.499] (-505.026) (-504.614) -- 0:00:44
      446500 -- (-504.292) (-500.626) (-506.875) [-511.315] * (-504.605) [-502.483] (-503.291) (-504.275) -- 0:00:44
      447000 -- (-507.022) [-501.726] (-501.027) (-508.285) * [-504.011] (-503.606) (-504.568) (-501.532) -- 0:00:44
      447500 -- (-506.794) (-502.179) [-503.620] (-501.052) * (-505.312) [-502.908] (-503.108) (-503.166) -- 0:00:44
      448000 -- (-507.226) [-502.375] (-501.030) (-502.868) * (-503.437) (-502.412) [-500.953] (-502.020) -- 0:00:44
      448500 -- (-501.915) [-507.300] (-503.495) (-506.510) * [-501.369] (-503.764) (-502.620) (-503.890) -- 0:00:44
      449000 -- (-501.752) [-503.480] (-502.382) (-510.723) * [-501.052] (-501.480) (-504.536) (-501.739) -- 0:00:44
      449500 -- (-501.250) (-502.529) (-501.745) [-502.185] * (-502.498) (-502.946) [-503.017] (-500.977) -- 0:00:44
      450000 -- (-501.542) [-502.145] (-500.755) (-502.136) * (-504.280) (-504.689) [-502.783] (-503.997) -- 0:00:44

      Average standard deviation of split frequencies: 0.014152

      450500 -- (-501.479) [-500.708] (-504.461) (-500.800) * (-505.039) (-505.434) [-505.220] (-503.143) -- 0:00:43
      451000 -- (-502.189) [-500.808] (-505.890) (-504.405) * (-501.680) (-501.324) (-506.479) [-502.329] -- 0:00:43
      451500 -- [-501.748] (-503.635) (-503.894) (-504.239) * (-502.462) [-500.768] (-502.656) (-502.315) -- 0:00:43
      452000 -- [-500.680] (-501.847) (-501.709) (-501.179) * (-503.913) [-504.071] (-501.039) (-503.869) -- 0:00:43
      452500 -- (-503.016) (-504.423) [-507.247] (-502.046) * (-508.214) [-501.368] (-501.800) (-502.174) -- 0:00:43
      453000 -- [-501.159] (-500.886) (-502.385) (-502.191) * (-503.023) (-501.564) (-509.561) [-500.962] -- 0:00:43
      453500 -- (-501.092) [-501.296] (-502.526) (-504.972) * [-506.058] (-505.658) (-508.410) (-507.752) -- 0:00:43
      454000 -- (-501.746) (-503.430) [-505.636] (-505.590) * (-510.824) (-502.874) (-502.175) [-502.136] -- 0:00:43
      454500 -- (-503.886) [-501.612] (-504.398) (-508.192) * (-501.731) [-501.397] (-501.818) (-501.817) -- 0:00:44
      455000 -- [-502.766] (-503.824) (-504.491) (-502.062) * (-501.107) (-508.892) (-501.431) [-501.447] -- 0:00:44

      Average standard deviation of split frequencies: 0.014291

      455500 -- [-503.453] (-501.776) (-502.919) (-502.330) * (-504.300) (-507.544) (-502.617) [-505.044] -- 0:00:44
      456000 -- (-502.952) [-501.613] (-503.664) (-501.154) * (-505.137) (-502.571) (-501.423) [-504.052] -- 0:00:44
      456500 -- (-506.448) [-502.264] (-505.557) (-502.800) * (-503.464) [-503.911] (-505.892) (-502.053) -- 0:00:44
      457000 -- (-506.983) (-505.044) (-501.214) [-500.899] * (-502.334) [-504.541] (-505.208) (-504.020) -- 0:00:43
      457500 -- [-503.169] (-502.290) (-501.793) (-500.681) * (-505.023) (-503.551) (-502.935) [-502.937] -- 0:00:43
      458000 -- (-501.353) (-502.570) [-502.255] (-503.651) * (-502.283) (-502.647) (-506.125) [-501.291] -- 0:00:43
      458500 -- (-502.876) [-503.418] (-505.516) (-501.373) * [-502.100] (-503.222) (-503.337) (-500.579) -- 0:00:43
      459000 -- (-501.302) [-505.273] (-502.850) (-501.870) * [-505.882] (-503.466) (-503.132) (-502.682) -- 0:00:43
      459500 -- (-500.621) (-505.618) [-504.700] (-503.836) * (-501.816) (-503.983) [-503.048] (-506.240) -- 0:00:43
      460000 -- [-501.718] (-504.093) (-503.363) (-500.417) * (-501.369) [-501.943] (-503.061) (-504.131) -- 0:00:43

      Average standard deviation of split frequencies: 0.013076

      460500 -- [-502.357] (-504.662) (-501.591) (-509.048) * (-502.855) (-501.310) [-502.226] (-503.194) -- 0:00:43
      461000 -- [-501.595] (-504.971) (-501.295) (-505.509) * (-500.687) [-502.584] (-500.944) (-504.979) -- 0:00:43
      461500 -- (-503.184) (-502.040) [-503.439] (-507.270) * [-500.896] (-501.326) (-502.708) (-505.241) -- 0:00:43
      462000 -- (-502.687) (-502.720) (-503.815) [-503.516] * (-501.269) [-503.774] (-506.373) (-504.018) -- 0:00:43
      462500 -- [-502.014] (-503.072) (-501.716) (-502.622) * (-504.586) [-502.393] (-505.851) (-500.851) -- 0:00:43
      463000 -- (-501.447) (-502.351) [-502.535] (-505.221) * (-502.164) [-501.341] (-505.543) (-503.555) -- 0:00:42
      463500 -- (-502.603) (-501.056) [-502.447] (-504.156) * [-501.984] (-504.694) (-504.366) (-503.248) -- 0:00:42
      464000 -- [-502.200] (-503.312) (-502.453) (-505.105) * (-502.319) [-502.632] (-506.170) (-500.558) -- 0:00:42
      464500 -- [-501.594] (-501.806) (-503.350) (-502.035) * (-500.880) (-501.417) (-504.279) [-505.734] -- 0:00:42
      465000 -- (-501.740) (-501.329) (-506.655) [-502.030] * (-500.892) (-501.957) (-502.930) [-503.420] -- 0:00:42

      Average standard deviation of split frequencies: 0.013376

      465500 -- (-506.648) [-501.542] (-501.198) (-501.314) * (-501.081) [-501.229] (-501.142) (-505.518) -- 0:00:42
      466000 -- (-502.746) (-504.246) [-504.866] (-502.254) * [-503.476] (-501.450) (-502.502) (-501.997) -- 0:00:42
      466500 -- [-502.289] (-501.365) (-500.756) (-505.125) * (-502.925) [-501.834] (-501.375) (-502.832) -- 0:00:42
      467000 -- (-503.507) [-502.601] (-503.037) (-500.654) * (-501.776) [-503.093] (-501.809) (-505.792) -- 0:00:42
      467500 -- [-501.023] (-503.141) (-505.128) (-501.884) * [-502.101] (-502.349) (-503.818) (-504.481) -- 0:00:43
      468000 -- (-501.452) (-505.648) (-505.558) [-504.284] * (-506.058) (-502.995) (-501.618) [-502.896] -- 0:00:43
      468500 -- (-502.114) (-505.260) (-504.992) [-504.177] * (-506.467) [-502.217] (-501.287) (-506.879) -- 0:00:43
      469000 -- [-500.826] (-502.294) (-509.492) (-504.513) * [-503.066] (-503.729) (-501.409) (-500.884) -- 0:00:43
      469500 -- [-502.284] (-501.567) (-502.162) (-502.657) * [-502.322] (-503.173) (-500.957) (-501.802) -- 0:00:42
      470000 -- (-501.335) (-502.908) (-500.595) [-502.883] * (-502.760) [-506.118] (-501.112) (-502.405) -- 0:00:42

      Average standard deviation of split frequencies: 0.014189

      470500 -- [-502.097] (-505.633) (-502.884) (-501.741) * (-503.957) [-501.789] (-507.312) (-505.225) -- 0:00:42
      471000 -- (-502.231) (-505.522) [-501.721] (-502.244) * (-502.878) (-501.526) (-502.403) [-503.959] -- 0:00:42
      471500 -- [-505.424] (-503.696) (-501.827) (-503.015) * (-503.793) [-500.652] (-502.024) (-503.738) -- 0:00:42
      472000 -- (-502.175) [-504.076] (-500.437) (-501.973) * (-504.548) (-504.570) [-506.201] (-502.773) -- 0:00:42
      472500 -- (-502.515) [-501.223] (-504.472) (-503.274) * (-505.751) (-501.963) [-502.352] (-503.868) -- 0:00:42
      473000 -- (-501.771) (-502.783) (-501.637) [-502.177] * [-505.461] (-507.132) (-506.109) (-504.235) -- 0:00:42
      473500 -- [-503.231] (-507.034) (-501.867) (-502.443) * (-502.034) (-504.489) [-506.417] (-502.235) -- 0:00:42
      474000 -- (-504.114) (-503.527) (-504.914) [-504.981] * [-501.759] (-507.517) (-503.142) (-503.755) -- 0:00:42
      474500 -- [-502.011] (-505.871) (-509.342) (-502.066) * (-502.755) (-504.940) (-503.705) [-504.030] -- 0:00:42
      475000 -- (-500.627) (-503.479) [-505.206] (-501.236) * (-504.829) [-503.058] (-502.501) (-502.398) -- 0:00:42

      Average standard deviation of split frequencies: 0.013865

      475500 -- (-503.393) [-501.436] (-501.802) (-501.363) * (-503.266) (-500.584) (-501.282) [-501.963] -- 0:00:41
      476000 -- [-502.192] (-501.814) (-505.099) (-505.120) * (-502.632) (-501.380) (-504.677) [-507.429] -- 0:00:41
      476500 -- (-501.845) [-501.360] (-501.697) (-502.833) * [-504.419] (-502.149) (-508.655) (-500.905) -- 0:00:41
      477000 -- [-501.492] (-504.783) (-502.642) (-505.274) * (-504.204) (-502.812) (-508.057) [-505.710] -- 0:00:41
      477500 -- (-503.116) (-502.614) [-502.501] (-508.315) * (-500.794) (-503.417) [-501.412] (-501.299) -- 0:00:41
      478000 -- [-502.635] (-503.694) (-502.984) (-502.482) * (-501.915) (-501.706) [-503.101] (-503.878) -- 0:00:41
      478500 -- [-505.696] (-502.624) (-503.647) (-502.054) * (-503.724) [-502.229] (-505.735) (-501.440) -- 0:00:41
      479000 -- (-506.391) [-504.225] (-503.042) (-502.244) * (-503.265) (-502.845) [-503.492] (-500.737) -- 0:00:41
      479500 -- [-502.162] (-502.115) (-500.491) (-501.355) * (-502.019) (-502.652) [-500.697] (-502.516) -- 0:00:41
      480000 -- (-501.296) (-501.442) (-500.922) [-501.463] * (-501.510) (-501.983) [-501.169] (-502.479) -- 0:00:41

      Average standard deviation of split frequencies: 0.013076

      480500 -- (-501.445) (-503.984) [-501.270] (-502.611) * (-500.657) (-503.424) [-501.462] (-503.752) -- 0:00:42
      481000 -- [-502.022] (-503.632) (-501.497) (-502.875) * [-501.182] (-502.862) (-502.052) (-501.034) -- 0:00:42
      481500 -- (-501.783) (-505.780) [-502.047] (-502.597) * (-501.374) (-503.192) [-501.773] (-505.323) -- 0:00:41
      482000 -- (-501.832) (-502.258) (-502.916) [-504.129] * [-505.455] (-501.002) (-502.167) (-506.722) -- 0:00:41
      482500 -- (-500.780) (-503.364) (-503.560) [-505.443] * (-501.154) (-501.113) [-500.635] (-508.436) -- 0:00:41
      483000 -- [-505.101] (-503.817) (-500.737) (-501.754) * (-506.275) (-502.615) [-503.980] (-501.685) -- 0:00:41
      483500 -- (-503.112) [-503.144] (-502.231) (-502.385) * [-502.218] (-502.110) (-501.039) (-503.607) -- 0:00:41
      484000 -- (-502.884) [-502.857] (-502.864) (-504.692) * (-501.561) (-504.458) [-502.926] (-504.017) -- 0:00:41
      484500 -- [-503.332] (-501.917) (-504.299) (-507.243) * (-502.983) [-504.691] (-502.386) (-501.518) -- 0:00:41
      485000 -- (-506.255) (-501.181) (-502.233) [-502.242] * (-502.604) (-500.593) [-502.365] (-501.321) -- 0:00:41

      Average standard deviation of split frequencies: 0.012394

      485500 -- (-504.381) [-501.084] (-500.685) (-501.059) * (-502.877) [-500.351] (-502.311) (-506.865) -- 0:00:41
      486000 -- [-500.936] (-503.087) (-503.179) (-501.151) * [-504.477] (-501.209) (-503.878) (-501.703) -- 0:00:41
      486500 -- [-503.712] (-503.111) (-503.927) (-500.921) * (-503.072) [-501.721] (-502.349) (-507.434) -- 0:00:41
      487000 -- (-503.805) (-502.888) [-502.103] (-502.130) * [-510.280] (-502.106) (-503.914) (-503.756) -- 0:00:41
      487500 -- [-503.060] (-502.707) (-501.341) (-502.429) * (-510.656) (-501.972) [-503.301] (-505.945) -- 0:00:41
      488000 -- (-502.445) (-501.838) [-503.294] (-504.361) * [-504.666] (-503.507) (-500.911) (-503.654) -- 0:00:40
      488500 -- (-502.158) (-501.362) [-502.107] (-503.127) * (-501.841) (-505.153) (-502.904) [-503.802] -- 0:00:40
      489000 -- (-505.451) [-502.427] (-501.399) (-504.917) * (-501.454) [-505.970] (-509.918) (-503.490) -- 0:00:40
      489500 -- [-501.890] (-502.841) (-503.229) (-504.405) * [-501.455] (-501.569) (-504.156) (-504.977) -- 0:00:40
      490000 -- (-501.649) (-504.109) [-502.080] (-503.577) * (-505.670) (-500.683) [-503.408] (-500.871) -- 0:00:40

      Average standard deviation of split frequencies: 0.012433

      490500 -- [-501.188] (-506.173) (-502.419) (-507.527) * [-503.655] (-504.631) (-500.454) (-501.912) -- 0:00:40
      491000 -- (-501.525) (-501.360) (-501.872) [-501.860] * (-502.221) (-507.171) [-502.218] (-503.404) -- 0:00:40
      491500 -- (-500.966) (-501.977) (-503.963) [-502.021] * (-502.017) (-506.862) (-507.348) [-504.611] -- 0:00:40
      492000 -- [-501.728] (-502.800) (-504.251) (-503.882) * (-500.582) [-500.840] (-506.279) (-500.915) -- 0:00:40
      492500 -- (-501.347) (-502.653) [-500.948] (-503.368) * (-501.410) [-506.232] (-504.149) (-502.492) -- 0:00:40
      493000 -- [-501.464] (-501.400) (-501.683) (-503.118) * (-501.532) (-501.759) (-502.536) [-502.107] -- 0:00:41
      493500 -- [-502.523] (-508.832) (-502.717) (-502.675) * (-502.017) [-501.468] (-503.276) (-507.157) -- 0:00:41
      494000 -- (-500.436) [-501.254] (-506.281) (-509.393) * (-501.947) (-501.880) (-503.698) [-505.194] -- 0:00:40
      494500 -- [-506.321] (-509.662) (-501.914) (-502.056) * [-503.043] (-502.727) (-504.467) (-504.939) -- 0:00:40
      495000 -- (-503.874) [-501.805] (-502.124) (-500.750) * (-501.048) [-503.886] (-500.592) (-502.919) -- 0:00:40

      Average standard deviation of split frequencies: 0.012523

      495500 -- (-504.492) [-503.659] (-502.626) (-501.038) * (-502.262) (-501.083) (-501.724) [-502.406] -- 0:00:40
      496000 -- (-504.564) (-501.899) [-500.974] (-500.882) * (-500.605) (-501.612) (-500.925) [-502.385] -- 0:00:40
      496500 -- (-501.721) (-500.858) (-501.577) [-505.077] * (-501.226) (-504.456) [-500.824] (-507.309) -- 0:00:40
      497000 -- (-503.027) (-501.647) (-500.775) [-504.398] * [-502.136] (-506.529) (-503.285) (-505.726) -- 0:00:40
      497500 -- (-503.436) [-501.164] (-503.040) (-502.381) * (-503.337) (-501.938) (-504.342) [-500.781] -- 0:00:40
      498000 -- (-507.886) (-501.488) [-503.592] (-502.121) * (-500.658) (-501.760) (-503.857) [-502.164] -- 0:00:40
      498500 -- (-506.203) (-501.954) (-501.446) [-501.252] * [-502.001] (-500.932) (-503.539) (-502.153) -- 0:00:40
      499000 -- [-502.785] (-502.872) (-506.498) (-505.401) * (-503.646) (-501.197) (-501.635) [-500.425] -- 0:00:40
      499500 -- [-501.982] (-504.476) (-502.168) (-506.801) * [-501.559] (-502.457) (-506.959) (-503.107) -- 0:00:40
      500000 -- (-505.958) (-504.049) [-502.035] (-501.576) * (-501.765) (-500.954) [-501.268] (-505.535) -- 0:00:40

      Average standard deviation of split frequencies: 0.012019

      500500 -- (-501.535) (-502.079) (-502.851) [-501.306] * (-504.343) (-502.297) (-501.832) [-502.698] -- 0:00:39
      501000 -- [-501.747] (-502.070) (-504.987) (-503.668) * (-501.895) [-500.429] (-503.100) (-503.368) -- 0:00:39
      501500 -- [-501.217] (-502.436) (-502.238) (-502.934) * (-502.521) (-501.939) (-502.673) [-501.142] -- 0:00:39
      502000 -- (-502.293) (-502.017) (-502.108) [-502.456] * (-504.275) [-501.768] (-504.170) (-503.122) -- 0:00:39
      502500 -- (-504.381) (-503.488) (-501.186) [-501.257] * [-503.390] (-500.788) (-503.490) (-503.750) -- 0:00:39
      503000 -- (-503.826) (-502.943) [-501.219] (-501.466) * (-501.497) (-500.688) [-504.146] (-503.419) -- 0:00:39
      503500 -- (-505.013) (-502.958) (-501.402) [-507.021] * [-502.261] (-504.008) (-501.004) (-501.375) -- 0:00:39
      504000 -- [-503.122] (-504.510) (-502.044) (-504.396) * (-501.161) [-502.817] (-504.064) (-501.484) -- 0:00:39
      504500 -- (-501.227) (-502.662) [-501.287] (-502.403) * (-504.689) (-503.290) [-501.002] (-503.387) -- 0:00:39
      505000 -- (-502.391) (-502.078) [-500.662] (-501.296) * (-502.046) (-506.397) [-501.306] (-504.163) -- 0:00:39

      Average standard deviation of split frequencies: 0.012056

      505500 -- [-502.923] (-504.195) (-503.092) (-501.584) * (-504.119) (-509.471) (-500.683) [-502.341] -- 0:00:39
      506000 -- (-503.971) (-501.092) (-501.962) [-508.032] * (-502.027) (-505.903) (-503.224) [-500.976] -- 0:00:40
      506500 -- [-500.786] (-503.377) (-502.479) (-500.930) * [-501.744] (-503.380) (-501.953) (-501.031) -- 0:00:39
      507000 -- [-501.295] (-504.829) (-504.975) (-504.634) * (-503.567) (-504.473) (-500.869) [-502.081] -- 0:00:39
      507500 -- (-501.902) (-506.473) [-501.059] (-504.171) * (-505.182) [-505.366] (-502.298) (-501.530) -- 0:00:39
      508000 -- [-505.628] (-502.719) (-501.449) (-501.723) * [-503.964] (-505.484) (-504.747) (-504.111) -- 0:00:39
      508500 -- [-502.870] (-504.181) (-500.945) (-503.556) * (-501.716) (-502.331) [-502.098] (-503.788) -- 0:00:39
      509000 -- (-503.421) (-507.518) (-504.067) [-500.534] * (-502.568) (-503.884) (-501.417) [-502.675] -- 0:00:39
      509500 -- (-502.196) (-504.467) [-501.391] (-500.534) * (-501.941) (-509.591) [-502.817] (-501.378) -- 0:00:39
      510000 -- (-506.143) (-503.379) (-501.504) [-500.481] * (-501.862) (-502.250) (-500.910) [-501.378] -- 0:00:39

      Average standard deviation of split frequencies: 0.011620

      510500 -- (-501.291) (-505.576) (-501.145) [-500.610] * (-506.505) [-502.302] (-504.935) (-500.986) -- 0:00:39
      511000 -- [-501.370] (-502.671) (-501.984) (-504.906) * (-505.052) (-506.785) (-503.899) [-502.074] -- 0:00:39
      511500 -- (-502.022) (-500.830) (-502.449) [-502.805] * (-500.802) (-503.815) [-502.230] (-503.645) -- 0:00:39
      512000 -- (-502.173) (-502.590) [-503.860] (-501.268) * (-503.267) [-504.273] (-501.097) (-502.025) -- 0:00:39
      512500 -- (-509.104) (-501.929) (-501.238) [-503.904] * (-509.440) (-501.995) [-501.623] (-501.477) -- 0:00:39
      513000 -- [-505.556] (-502.418) (-504.393) (-501.889) * (-504.398) (-502.528) (-505.206) [-502.132] -- 0:00:38
      513500 -- [-501.838] (-504.932) (-504.197) (-502.369) * [-501.612] (-504.787) (-503.388) (-502.367) -- 0:00:38
      514000 -- (-502.349) (-503.799) (-501.827) [-502.396] * (-505.771) (-503.780) (-502.702) [-500.982] -- 0:00:38
      514500 -- [-500.707] (-504.121) (-503.330) (-501.653) * (-506.336) (-505.049) [-502.057] (-507.351) -- 0:00:38
      515000 -- (-501.900) [-504.743] (-504.963) (-509.708) * (-508.582) (-505.202) (-505.320) [-501.381] -- 0:00:38

      Average standard deviation of split frequencies: 0.010963

      515500 -- (-505.358) (-503.303) [-503.077] (-502.363) * (-503.278) (-503.823) [-502.604] (-511.581) -- 0:00:38
      516000 -- [-502.626] (-505.853) (-503.596) (-502.719) * (-506.899) (-505.145) (-503.450) [-500.473] -- 0:00:38
      516500 -- (-501.851) (-508.152) (-502.411) [-503.619] * (-501.870) (-501.656) [-501.693] (-502.329) -- 0:00:38
      517000 -- (-507.913) (-504.051) (-502.253) [-501.695] * [-501.538] (-504.173) (-501.503) (-501.154) -- 0:00:38
      517500 -- [-505.189] (-504.147) (-504.913) (-501.179) * (-502.690) [-510.695] (-504.698) (-503.119) -- 0:00:38
      518000 -- [-507.116] (-501.691) (-502.947) (-505.692) * (-503.242) (-507.319) (-501.194) [-503.293] -- 0:00:38
      518500 -- (-500.781) (-503.122) (-503.317) [-505.574] * (-502.026) (-509.266) [-501.005] (-502.505) -- 0:00:38
      519000 -- (-506.562) [-500.682] (-501.566) (-501.258) * (-500.810) (-504.075) (-500.844) [-502.205] -- 0:00:38
      519500 -- [-502.337] (-508.300) (-500.731) (-503.341) * (-501.329) [-502.813] (-505.515) (-503.689) -- 0:00:38
      520000 -- (-507.036) [-501.907] (-502.710) (-501.805) * (-504.736) (-502.497) [-504.849] (-503.249) -- 0:00:38

      Average standard deviation of split frequencies: 0.010971

      520500 -- (-500.833) (-501.225) [-503.843] (-502.791) * (-503.628) [-503.198] (-501.656) (-501.148) -- 0:00:38
      521000 -- (-502.161) (-501.699) (-504.744) [-503.138] * [-501.121] (-502.888) (-503.108) (-503.636) -- 0:00:38
      521500 -- (-505.072) [-502.972] (-504.271) (-503.716) * [-502.781] (-501.074) (-502.252) (-503.089) -- 0:00:38
      522000 -- (-504.708) (-501.154) (-502.827) [-505.588] * (-500.913) (-502.990) (-502.822) [-501.104] -- 0:00:38
      522500 -- (-501.029) (-500.796) (-503.092) [-503.109] * [-502.111] (-505.110) (-502.452) (-503.951) -- 0:00:38
      523000 -- (-502.177) (-502.292) [-504.140] (-503.507) * (-503.404) (-500.981) (-508.847) [-500.852] -- 0:00:38
      523500 -- [-502.403] (-503.924) (-501.650) (-501.762) * [-503.000] (-501.815) (-504.229) (-502.413) -- 0:00:38
      524000 -- (-502.588) (-503.075) [-504.869] (-502.760) * (-502.637) (-502.639) (-503.743) [-500.502] -- 0:00:38
      524500 -- (-503.528) [-502.194] (-502.396) (-501.766) * (-503.492) (-501.039) [-500.865] (-503.284) -- 0:00:38
      525000 -- (-507.374) [-502.808] (-502.363) (-504.461) * (-504.875) [-502.639] (-503.224) (-505.688) -- 0:00:38

      Average standard deviation of split frequencies: 0.010605

      525500 -- (-500.902) (-501.067) [-502.298] (-502.236) * (-503.511) (-501.749) (-502.361) [-502.447] -- 0:00:37
      526000 -- (-501.456) [-501.113] (-503.102) (-502.117) * [-502.052] (-500.842) (-502.234) (-502.849) -- 0:00:37
      526500 -- (-506.666) (-502.555) [-503.794] (-504.502) * (-504.553) [-504.319] (-500.711) (-502.847) -- 0:00:37
      527000 -- (-505.944) (-506.092) [-500.514] (-504.406) * (-502.432) (-502.184) [-500.771] (-501.246) -- 0:00:37
      527500 -- (-505.348) [-506.481] (-500.578) (-504.972) * (-501.838) [-500.981] (-502.155) (-500.831) -- 0:00:37
      528000 -- (-501.992) [-501.073] (-502.199) (-503.404) * (-503.987) (-501.800) (-501.317) [-501.602] -- 0:00:37
      528500 -- [-502.332] (-500.802) (-502.741) (-501.189) * (-500.780) (-501.263) (-500.631) [-501.723] -- 0:00:37
      529000 -- (-503.694) [-501.690] (-502.793) (-500.836) * (-502.588) (-500.882) [-505.476] (-506.417) -- 0:00:37
      529500 -- [-501.090] (-503.158) (-504.307) (-502.360) * (-503.035) (-503.667) [-503.319] (-502.345) -- 0:00:37
      530000 -- (-502.029) (-501.961) (-504.827) [-502.294] * (-502.316) (-501.192) (-501.173) [-504.400] -- 0:00:37

      Average standard deviation of split frequencies: 0.010117

      530500 -- (-503.972) (-504.243) [-506.815] (-501.433) * (-503.029) (-501.736) (-500.766) [-503.584] -- 0:00:37
      531000 -- (-502.953) (-501.355) [-503.908] (-505.391) * [-501.381] (-502.804) (-500.356) (-500.787) -- 0:00:37
      531500 -- (-502.388) (-504.248) [-504.386] (-504.630) * (-503.232) [-501.707] (-502.075) (-508.166) -- 0:00:37
      532000 -- (-502.220) (-506.091) [-504.162] (-502.160) * (-502.838) (-501.213) [-502.640] (-502.200) -- 0:00:37
      532500 -- (-502.511) (-503.307) (-501.607) [-503.893] * (-504.097) (-503.036) [-501.779] (-505.145) -- 0:00:37
      533000 -- (-502.313) (-502.348) (-502.714) [-502.534] * [-501.840] (-502.644) (-508.137) (-501.054) -- 0:00:37
      533500 -- (-506.026) (-502.356) (-506.443) [-503.042] * (-505.960) (-501.214) (-504.631) [-500.712] -- 0:00:37
      534000 -- [-501.807] (-502.586) (-501.124) (-504.591) * [-505.645] (-502.104) (-502.533) (-500.833) -- 0:00:37
      534500 -- (-501.056) (-502.033) [-502.409] (-504.548) * (-501.204) (-505.699) [-504.652] (-501.290) -- 0:00:37
      535000 -- (-501.946) (-500.587) (-501.118) [-502.125] * [-502.326] (-504.470) (-501.440) (-500.315) -- 0:00:37

      Average standard deviation of split frequencies: 0.010456

      535500 -- [-502.482] (-500.604) (-504.878) (-501.782) * [-502.805] (-503.074) (-502.938) (-502.588) -- 0:00:37
      536000 -- (-503.608) (-501.524) [-501.798] (-501.821) * [-501.893] (-502.594) (-502.060) (-500.963) -- 0:00:37
      536500 -- (-505.074) (-502.207) (-505.336) [-505.014] * (-502.588) [-501.816] (-500.759) (-504.185) -- 0:00:37
      537000 -- (-503.677) [-501.700] (-502.274) (-505.226) * (-501.680) (-504.390) [-500.945] (-505.119) -- 0:00:37
      537500 -- (-502.147) (-504.666) [-500.960] (-503.240) * (-502.740) (-509.157) (-502.140) [-501.541] -- 0:00:37
      538000 -- (-502.493) (-500.801) (-502.261) [-501.530] * [-501.498] (-503.130) (-502.621) (-503.182) -- 0:00:36
      538500 -- [-503.118] (-502.418) (-503.837) (-501.108) * (-504.073) (-500.659) (-502.689) [-503.212] -- 0:00:36
      539000 -- (-500.992) (-502.638) [-503.597] (-503.455) * [-501.916] (-502.512) (-502.420) (-503.593) -- 0:00:36
      539500 -- (-502.133) (-504.219) (-507.137) [-505.718] * [-502.160] (-506.424) (-503.083) (-504.621) -- 0:00:36
      540000 -- (-502.488) (-505.180) [-507.389] (-505.702) * [-500.306] (-500.557) (-508.336) (-503.763) -- 0:00:36

      Average standard deviation of split frequencies: 0.010221

      540500 -- (-503.662) (-500.825) (-505.759) [-501.925] * (-503.790) [-502.570] (-503.710) (-505.305) -- 0:00:36
      541000 -- [-504.505] (-500.466) (-502.775) (-506.649) * (-501.768) [-501.829] (-502.804) (-501.290) -- 0:00:36
      541500 -- [-502.384] (-501.340) (-507.726) (-501.502) * (-507.974) [-501.819] (-503.913) (-507.409) -- 0:00:36
      542000 -- (-503.130) (-503.172) (-508.908) [-503.231] * (-504.491) [-502.970] (-502.902) (-500.642) -- 0:00:36
      542500 -- [-503.415] (-501.444) (-502.514) (-503.002) * [-503.808] (-502.722) (-503.665) (-506.064) -- 0:00:36
      543000 -- [-503.064] (-501.317) (-504.020) (-502.299) * [-501.890] (-503.144) (-501.067) (-504.452) -- 0:00:36
      543500 -- (-502.005) (-504.188) (-503.832) [-501.546] * (-505.714) (-505.667) [-501.589] (-502.124) -- 0:00:36
      544000 -- (-504.314) [-504.539] (-501.337) (-500.414) * (-502.394) [-502.313] (-505.433) (-502.124) -- 0:00:36
      544500 -- (-501.939) (-506.669) (-501.539) [-502.537] * (-500.547) [-501.768] (-501.162) (-502.795) -- 0:00:36
      545000 -- (-504.640) [-501.071] (-501.601) (-500.589) * (-501.394) [-507.511] (-504.023) (-504.866) -- 0:00:36

      Average standard deviation of split frequencies: 0.009641

      545500 -- [-502.471] (-500.435) (-501.111) (-501.642) * (-503.129) (-502.701) (-500.989) [-502.820] -- 0:00:36
      546000 -- (-503.554) (-502.805) (-503.707) [-502.211] * [-503.474] (-502.985) (-502.348) (-503.579) -- 0:00:36
      546500 -- (-502.302) (-505.802) [-502.540] (-501.753) * (-504.503) (-502.793) [-504.133] (-505.643) -- 0:00:36
      547000 -- [-501.250] (-505.315) (-501.128) (-505.553) * (-503.180) (-503.151) [-505.740] (-505.076) -- 0:00:36
      547500 -- [-502.861] (-501.335) (-501.187) (-502.710) * [-501.124] (-501.833) (-501.495) (-504.994) -- 0:00:36
      548000 -- [-500.670] (-501.821) (-506.135) (-503.441) * (-502.606) (-502.608) (-506.367) [-501.236] -- 0:00:36
      548500 -- [-503.919] (-501.238) (-503.916) (-501.624) * [-502.949] (-502.124) (-504.503) (-502.678) -- 0:00:36
      549000 -- (-503.794) [-500.735] (-501.302) (-500.925) * [-504.127] (-502.095) (-503.195) (-502.865) -- 0:00:36
      549500 -- (-502.342) [-501.119] (-502.433) (-500.963) * (-503.391) [-503.772] (-503.032) (-503.571) -- 0:00:36
      550000 -- (-502.019) [-501.297] (-503.256) (-500.786) * (-503.192) (-503.317) (-502.746) [-502.360] -- 0:00:36

      Average standard deviation of split frequencies: 0.010122

      550500 -- (-500.503) (-504.904) (-503.087) [-501.482] * (-502.898) [-502.544] (-502.265) (-501.979) -- 0:00:35
      551000 -- (-501.144) (-505.613) (-502.071) [-502.313] * (-503.444) [-503.219] (-501.159) (-502.921) -- 0:00:35
      551500 -- (-503.448) (-503.317) (-502.629) [-501.326] * [-503.714] (-502.836) (-500.815) (-502.815) -- 0:00:35
      552000 -- (-501.297) [-502.214] (-501.644) (-501.292) * (-503.753) (-504.509) [-505.308] (-507.262) -- 0:00:35
      552500 -- (-503.274) (-501.690) [-504.890] (-502.649) * (-500.938) [-502.678] (-501.460) (-501.258) -- 0:00:35
      553000 -- (-504.578) (-508.114) (-502.183) [-501.344] * (-502.101) (-502.520) (-500.893) [-501.568] -- 0:00:35
      553500 -- [-504.976] (-501.657) (-502.270) (-501.185) * (-501.893) (-502.074) (-501.345) [-501.426] -- 0:00:35
      554000 -- (-501.870) [-505.294] (-500.961) (-503.824) * (-502.412) [-501.239] (-501.086) (-501.002) -- 0:00:35
      554500 -- (-505.077) (-503.313) (-502.586) [-501.493] * (-501.742) (-503.660) [-501.491] (-500.387) -- 0:00:35
      555000 -- (-506.382) (-505.530) (-502.216) [-500.718] * (-502.711) (-502.974) [-502.249] (-502.822) -- 0:00:35

      Average standard deviation of split frequencies: 0.010015

      555500 -- [-502.049] (-502.026) (-503.550) (-501.661) * (-501.173) (-501.990) [-502.719] (-504.163) -- 0:00:35
      556000 -- [-502.555] (-502.358) (-504.495) (-507.068) * (-501.081) (-503.590) (-501.557) [-503.261] -- 0:00:35
      556500 -- (-501.559) (-504.057) (-506.674) [-504.469] * (-501.834) (-502.565) [-502.251] (-503.170) -- 0:00:35
      557000 -- (-503.406) (-505.695) [-504.377] (-504.719) * [-501.705] (-501.932) (-504.632) (-502.759) -- 0:00:34
      557500 -- [-502.461] (-502.559) (-504.213) (-506.559) * (-501.090) (-504.698) [-501.785] (-500.281) -- 0:00:35
      558000 -- (-502.241) (-503.653) [-504.156] (-504.002) * (-501.456) (-503.572) (-501.448) [-501.710] -- 0:00:35
      558500 -- (-504.332) (-501.082) (-502.006) [-502.961] * (-502.979) (-502.729) [-501.177] (-507.845) -- 0:00:35
      559000 -- (-504.949) [-503.840] (-502.890) (-502.792) * (-501.961) (-502.371) [-501.137] (-507.352) -- 0:00:35
      559500 -- (-502.561) (-507.052) [-503.171] (-502.572) * (-503.332) [-504.971] (-502.982) (-507.345) -- 0:00:35
      560000 -- [-503.860] (-501.595) (-506.583) (-507.775) * (-504.404) [-503.265] (-500.714) (-504.679) -- 0:00:35

      Average standard deviation of split frequencies: 0.010090

      560500 -- (-506.800) (-502.636) (-502.142) [-502.811] * [-502.318] (-501.310) (-506.390) (-500.654) -- 0:00:35
      561000 -- [-502.188] (-501.577) (-502.965) (-502.550) * (-504.206) (-501.084) (-507.282) [-502.376] -- 0:00:35
      561500 -- (-500.907) (-503.913) [-504.575] (-504.083) * (-503.535) [-506.150] (-501.733) (-501.671) -- 0:00:35
      562000 -- (-503.100) [-501.563] (-502.514) (-508.306) * (-504.897) [-502.439] (-501.903) (-503.043) -- 0:00:35
      562500 -- [-503.587] (-504.952) (-503.867) (-505.288) * [-503.554] (-502.367) (-503.594) (-502.215) -- 0:00:35
      563000 -- (-508.268) (-503.534) [-501.252] (-507.360) * (-502.613) [-504.303] (-502.415) (-502.194) -- 0:00:34
      563500 -- [-504.420] (-504.166) (-502.917) (-503.416) * [-503.799] (-510.548) (-503.756) (-503.922) -- 0:00:34
      564000 -- (-503.846) (-502.829) [-501.146] (-501.363) * (-502.377) (-502.539) [-503.017] (-504.655) -- 0:00:34
      564500 -- (-503.862) (-504.983) (-501.443) [-501.180] * [-500.813] (-502.642) (-503.475) (-504.523) -- 0:00:34
      565000 -- (-504.064) [-503.095] (-502.718) (-503.555) * (-505.997) [-501.596] (-501.596) (-501.921) -- 0:00:34

      Average standard deviation of split frequencies: 0.010386

      565500 -- (-501.149) (-500.511) (-500.841) [-500.721] * (-501.331) [-502.526] (-501.693) (-500.703) -- 0:00:34
      566000 -- [-501.588] (-501.086) (-506.814) (-502.106) * (-501.172) (-503.780) (-502.557) [-503.078] -- 0:00:34
      566500 -- (-502.603) (-507.093) (-504.803) [-504.998] * (-505.932) (-506.292) (-504.134) [-501.004] -- 0:00:34
      567000 -- (-502.217) (-503.663) (-502.155) [-503.443] * (-503.839) (-505.021) (-503.199) [-500.750] -- 0:00:34
      567500 -- (-501.753) (-504.463) (-503.030) [-503.229] * (-504.692) [-501.742] (-504.174) (-504.658) -- 0:00:34
      568000 -- (-503.514) (-503.252) (-502.302) [-501.302] * (-501.899) [-500.658] (-505.280) (-507.419) -- 0:00:34
      568500 -- (-501.749) (-503.520) (-503.263) [-502.653] * (-503.061) [-500.668] (-504.830) (-501.783) -- 0:00:34
      569000 -- (-501.675) [-503.116] (-501.670) (-503.102) * (-501.062) [-501.125] (-502.232) (-501.154) -- 0:00:34
      569500 -- (-505.124) (-503.883) (-502.934) [-502.309] * (-500.759) (-501.812) [-503.108] (-503.321) -- 0:00:34
      570000 -- (-503.181) (-502.664) [-504.369] (-503.804) * [-500.773] (-507.183) (-505.925) (-508.267) -- 0:00:33

      Average standard deviation of split frequencies: 0.010399

      570500 -- (-503.289) [-502.121] (-504.512) (-503.393) * [-506.065] (-503.205) (-501.470) (-504.341) -- 0:00:34
      571000 -- [-501.472] (-504.353) (-508.036) (-500.868) * (-502.447) [-503.566] (-500.408) (-502.888) -- 0:00:34
      571500 -- (-501.736) [-501.816] (-503.929) (-503.326) * (-503.870) (-505.562) (-501.747) [-503.911] -- 0:00:34
      572000 -- [-503.915] (-501.738) (-504.571) (-504.457) * [-501.032] (-502.851) (-502.459) (-500.899) -- 0:00:34
      572500 -- [-503.801] (-502.284) (-504.216) (-502.723) * (-501.341) [-502.380] (-503.357) (-507.024) -- 0:00:34
      573000 -- (-502.326) [-502.382] (-503.669) (-507.818) * (-502.267) (-502.379) (-501.013) [-501.257] -- 0:00:34
      573500 -- (-503.424) (-500.856) [-502.618] (-504.738) * [-503.072] (-504.791) (-501.535) (-503.094) -- 0:00:34
      574000 -- (-502.565) (-502.213) (-502.643) [-503.285] * (-503.803) (-500.667) [-503.393] (-505.727) -- 0:00:34
      574500 -- (-502.908) (-501.230) [-502.950] (-501.755) * (-501.271) (-502.736) (-501.768) [-507.334] -- 0:00:34
      575000 -- (-501.531) [-506.184] (-502.720) (-504.990) * [-500.600] (-501.810) (-501.510) (-506.217) -- 0:00:34

      Average standard deviation of split frequencies: 0.010013

      575500 -- [-501.638] (-501.576) (-500.484) (-501.712) * (-502.052) [-501.465] (-506.741) (-506.850) -- 0:00:33
      576000 -- [-503.645] (-505.123) (-500.496) (-505.659) * (-504.585) (-505.553) (-503.894) [-505.293] -- 0:00:33
      576500 -- [-503.892] (-503.381) (-502.223) (-503.782) * [-503.681] (-506.560) (-502.372) (-503.079) -- 0:00:33
      577000 -- (-504.558) [-503.271] (-501.717) (-500.784) * (-506.341) [-502.464] (-503.713) (-501.457) -- 0:00:33
      577500 -- (-501.922) (-504.082) [-503.940] (-502.165) * [-503.830] (-501.953) (-507.763) (-504.501) -- 0:00:33
      578000 -- (-502.231) (-502.004) [-502.235] (-503.837) * [-504.160] (-502.141) (-509.023) (-503.102) -- 0:00:33
      578500 -- [-504.731] (-506.116) (-501.265) (-501.248) * (-503.771) (-502.533) [-503.174] (-501.561) -- 0:00:33
      579000 -- (-504.218) [-501.615] (-501.096) (-501.748) * (-502.197) (-503.363) (-502.776) [-501.027] -- 0:00:33
      579500 -- (-503.769) [-502.463] (-505.508) (-505.160) * (-503.533) [-504.416] (-502.765) (-501.789) -- 0:00:33
      580000 -- (-503.477) (-506.652) (-504.409) [-500.849] * (-501.364) (-501.727) [-500.933] (-502.511) -- 0:00:33

      Average standard deviation of split frequencies: 0.010220

      580500 -- (-501.810) (-503.392) (-501.919) [-500.467] * [-501.283] (-501.617) (-501.899) (-501.305) -- 0:00:33
      581000 -- [-503.710] (-502.173) (-503.140) (-501.956) * (-502.263) (-503.017) [-501.881] (-507.146) -- 0:00:33
      581500 -- (-504.412) [-500.803] (-503.954) (-508.567) * (-505.785) [-501.056] (-501.307) (-502.641) -- 0:00:33
      582000 -- [-504.481] (-502.065) (-503.679) (-503.639) * (-502.657) [-503.018] (-503.256) (-503.597) -- 0:00:33
      582500 -- [-502.044] (-504.314) (-510.261) (-502.199) * (-505.459) [-501.125] (-501.973) (-501.241) -- 0:00:32
      583000 -- [-501.691] (-501.639) (-501.341) (-501.656) * [-504.759] (-504.424) (-503.750) (-503.238) -- 0:00:33
      583500 -- (-501.802) (-501.391) (-505.181) [-503.997] * (-502.650) [-505.239] (-502.926) (-503.554) -- 0:00:33
      584000 -- (-503.629) (-505.639) (-501.776) [-503.582] * (-501.597) (-501.833) [-502.871] (-504.149) -- 0:00:33
      584500 -- (-508.663) (-501.443) [-504.059] (-502.562) * (-502.758) (-504.407) [-501.763] (-503.330) -- 0:00:33
      585000 -- (-503.059) [-502.264] (-505.599) (-502.455) * (-501.912) (-502.404) (-503.145) [-501.651] -- 0:00:33

      Average standard deviation of split frequencies: 0.010268

      585500 -- (-501.171) [-502.951] (-506.850) (-502.017) * (-501.685) (-502.094) [-501.220] (-502.386) -- 0:00:33
      586000 -- [-500.839] (-502.697) (-503.830) (-504.455) * [-501.100] (-504.197) (-503.936) (-501.864) -- 0:00:33
      586500 -- (-502.596) [-501.107] (-501.495) (-507.354) * [-501.212] (-502.914) (-502.832) (-500.594) -- 0:00:33
      587000 -- (-502.417) (-500.667) (-502.278) [-504.362] * [-503.935] (-502.079) (-506.492) (-502.830) -- 0:00:33
      587500 -- (-504.408) (-501.358) [-501.669] (-503.168) * (-503.082) (-501.465) (-504.439) [-501.740] -- 0:00:33
      588000 -- [-503.734] (-501.733) (-506.555) (-502.712) * (-502.341) [-502.768] (-501.158) (-501.786) -- 0:00:32
      588500 -- (-503.098) (-506.366) [-503.698] (-504.763) * (-502.637) (-504.869) [-502.332] (-502.602) -- 0:00:32
      589000 -- [-502.505] (-502.250) (-501.850) (-502.927) * [-503.397] (-501.817) (-504.492) (-505.151) -- 0:00:32
      589500 -- (-501.935) (-502.255) [-502.126] (-505.786) * (-502.511) (-501.174) [-505.696] (-503.061) -- 0:00:32
      590000 -- (-503.447) (-502.163) (-503.838) [-501.554] * (-501.018) [-500.951] (-513.181) (-501.314) -- 0:00:32

      Average standard deviation of split frequencies: 0.010234

      590500 -- (-502.047) (-501.491) (-503.114) [-501.799] * (-504.464) (-503.710) [-502.670] (-503.278) -- 0:00:32
      591000 -- (-503.630) [-501.965] (-501.709) (-501.678) * (-504.175) [-502.394] (-501.292) (-503.777) -- 0:00:32
      591500 -- (-503.083) (-500.746) [-501.172] (-502.494) * (-502.533) (-507.529) (-500.491) [-503.893] -- 0:00:32
      592000 -- (-506.107) [-501.536] (-501.469) (-501.268) * (-503.415) (-501.839) (-503.512) [-502.335] -- 0:00:32
      592500 -- (-508.974) [-502.234] (-500.964) (-503.182) * [-503.393] (-501.193) (-502.505) (-502.197) -- 0:00:32
      593000 -- (-501.009) (-502.374) [-504.311] (-504.529) * (-503.744) (-503.935) [-506.261] (-503.186) -- 0:00:32
      593500 -- (-505.838) (-502.582) (-505.249) [-504.333] * (-501.679) (-504.494) (-501.384) [-500.617] -- 0:00:32
      594000 -- (-501.930) [-502.477] (-501.392) (-502.744) * [-502.827] (-503.115) (-503.413) (-501.611) -- 0:00:32
      594500 -- (-500.909) (-503.815) (-502.235) [-502.017] * (-501.524) (-504.086) (-501.591) [-503.137] -- 0:00:32
      595000 -- [-502.569] (-506.754) (-501.996) (-501.748) * (-507.088) (-506.023) (-504.052) [-500.654] -- 0:00:31

      Average standard deviation of split frequencies: 0.010050

      595500 -- [-502.535] (-502.707) (-501.072) (-501.295) * (-503.375) [-501.294] (-500.979) (-500.467) -- 0:00:31
      596000 -- (-504.207) (-502.860) [-501.235] (-503.708) * [-502.447] (-501.453) (-503.310) (-504.908) -- 0:00:32
      596500 -- [-503.519] (-500.926) (-503.274) (-508.922) * (-504.063) (-503.287) (-501.818) [-502.325] -- 0:00:32
      597000 -- (-502.388) (-501.074) (-502.750) [-502.299] * [-501.776] (-500.947) (-504.040) (-501.788) -- 0:00:32
      597500 -- (-502.600) (-503.559) (-501.406) [-503.225] * (-503.120) [-504.276] (-505.025) (-503.438) -- 0:00:32
      598000 -- (-506.509) (-503.404) [-501.172] (-502.451) * (-501.441) (-504.199) [-502.134] (-506.355) -- 0:00:32
      598500 -- (-502.528) (-503.860) [-503.016] (-501.064) * (-502.669) (-501.787) [-500.420] (-500.843) -- 0:00:32
      599000 -- (-502.787) [-502.441] (-502.467) (-501.856) * [-501.536] (-502.252) (-503.713) (-501.590) -- 0:00:32
      599500 -- [-507.177] (-503.148) (-504.795) (-501.361) * (-501.849) (-501.035) [-502.803] (-502.364) -- 0:00:32
      600000 -- [-504.351] (-504.619) (-501.775) (-503.129) * (-506.409) (-505.028) [-502.312] (-502.466) -- 0:00:32

      Average standard deviation of split frequencies: 0.010387

      600500 -- [-503.962] (-505.792) (-506.562) (-506.981) * [-501.285] (-500.974) (-504.974) (-501.226) -- 0:00:31
      601000 -- [-502.162] (-506.333) (-502.359) (-504.427) * (-500.632) (-502.198) [-501.847] (-501.762) -- 0:00:31
      601500 -- (-501.180) [-503.627] (-502.129) (-502.772) * (-500.964) [-501.305] (-501.163) (-503.906) -- 0:00:31
      602000 -- (-501.580) (-506.928) (-500.752) [-502.383] * (-502.141) (-501.258) [-503.084] (-500.765) -- 0:00:31
      602500 -- (-503.438) (-501.672) (-501.158) [-508.115] * (-501.012) [-507.176] (-502.201) (-504.576) -- 0:00:31
      603000 -- (-504.520) [-503.532] (-500.533) (-506.805) * (-504.145) (-502.763) [-502.847] (-504.408) -- 0:00:31
      603500 -- (-506.223) [-501.806] (-502.377) (-501.275) * (-504.935) (-504.309) (-504.085) [-502.336] -- 0:00:31
      604000 -- [-502.623] (-503.090) (-500.875) (-505.106) * [-501.473] (-510.565) (-504.152) (-502.763) -- 0:00:31
      604500 -- (-506.297) [-503.836] (-501.199) (-501.527) * [-504.481] (-508.440) (-501.689) (-502.866) -- 0:00:31
      605000 -- [-503.408] (-501.557) (-503.531) (-504.059) * (-504.957) (-501.557) [-503.122] (-503.976) -- 0:00:31

      Average standard deviation of split frequencies: 0.010753

      605500 -- (-505.538) (-502.114) [-501.415] (-505.980) * (-502.909) [-504.838] (-503.123) (-504.269) -- 0:00:31
      606000 -- [-501.611] (-503.572) (-504.983) (-501.894) * (-503.345) [-503.447] (-503.254) (-503.268) -- 0:00:31
      606500 -- (-502.024) [-503.489] (-502.877) (-505.038) * (-506.188) (-502.306) (-503.281) [-504.040] -- 0:00:31
      607000 -- [-501.487] (-504.793) (-504.255) (-505.161) * [-502.188] (-501.307) (-503.603) (-501.040) -- 0:00:31
      607500 -- (-505.735) (-501.366) (-505.743) [-504.128] * (-502.657) [-504.720] (-505.993) (-506.139) -- 0:00:31
      608000 -- [-501.631] (-501.957) (-505.777) (-502.240) * (-503.735) (-503.589) (-506.066) [-503.048] -- 0:00:30
      608500 -- [-502.203] (-500.965) (-502.650) (-502.008) * (-500.982) (-507.791) (-504.594) [-501.445] -- 0:00:30
      609000 -- (-501.869) (-500.902) (-502.655) [-501.230] * (-502.695) (-505.588) [-503.633] (-500.920) -- 0:00:31
      609500 -- [-501.939] (-500.838) (-501.367) (-502.100) * (-501.641) (-504.475) [-503.004] (-503.077) -- 0:00:31
      610000 -- (-502.495) [-503.130] (-501.099) (-501.048) * (-501.405) (-502.490) (-506.014) [-505.868] -- 0:00:31

      Average standard deviation of split frequencies: 0.010081

      610500 -- [-503.999] (-503.814) (-505.296) (-501.261) * (-501.260) [-501.780] (-502.194) (-502.382) -- 0:00:31
      611000 -- (-502.435) [-503.097] (-506.929) (-502.508) * (-505.491) (-504.961) (-502.172) [-501.343] -- 0:00:31
      611500 -- (-503.677) (-501.624) [-501.812] (-503.386) * (-500.861) (-501.499) [-502.100] (-505.563) -- 0:00:31
      612000 -- [-505.219] (-501.691) (-502.749) (-503.185) * (-502.161) (-504.801) [-501.604] (-501.637) -- 0:00:31
      612500 -- (-502.936) [-501.944] (-501.900) (-503.591) * [-502.889] (-502.030) (-502.238) (-503.048) -- 0:00:31
      613000 -- (-505.480) [-505.338] (-504.131) (-503.109) * [-510.000] (-501.728) (-506.371) (-505.695) -- 0:00:30
      613500 -- (-505.953) (-502.663) (-500.378) [-504.312] * (-504.107) (-502.346) (-503.818) [-501.528] -- 0:00:30
      614000 -- (-504.878) [-501.127] (-501.638) (-502.068) * (-504.714) [-503.296] (-502.828) (-507.131) -- 0:00:30
      614500 -- (-503.547) (-503.147) [-503.227] (-502.461) * (-501.987) (-500.822) (-503.328) [-502.876] -- 0:00:30
      615000 -- (-501.135) [-503.900] (-503.360) (-501.720) * (-501.379) (-501.080) [-504.796] (-501.859) -- 0:00:30

      Average standard deviation of split frequencies: 0.009279

      615500 -- [-502.585] (-504.940) (-502.593) (-501.415) * (-501.016) (-505.716) (-504.579) [-501.658] -- 0:00:30
      616000 -- [-500.848] (-503.050) (-504.995) (-506.212) * (-502.476) (-511.002) (-505.548) [-502.770] -- 0:00:30
      616500 -- (-502.347) [-505.311] (-503.149) (-504.043) * [-502.712] (-501.839) (-503.082) (-502.571) -- 0:00:30
      617000 -- [-502.035] (-508.289) (-504.265) (-503.736) * (-502.243) (-501.402) [-503.371] (-503.416) -- 0:00:30
      617500 -- (-502.646) (-503.152) (-504.033) [-502.563] * (-501.746) (-507.059) (-501.106) [-502.172] -- 0:00:30
      618000 -- (-502.065) (-502.922) [-501.342] (-506.711) * (-503.563) (-503.107) (-500.485) [-501.031] -- 0:00:30
      618500 -- [-502.118] (-505.151) (-503.479) (-504.262) * (-503.270) (-502.945) [-501.846] (-504.033) -- 0:00:30
      619000 -- (-504.525) (-505.111) [-501.235] (-501.784) * (-500.992) (-503.781) [-501.301] (-505.959) -- 0:00:30
      619500 -- (-502.430) (-502.211) [-504.919] (-502.749) * (-505.613) (-503.147) (-501.998) [-504.091] -- 0:00:30
      620000 -- (-502.017) (-502.938) (-504.028) [-502.633] * [-503.132] (-503.786) (-500.987) (-501.483) -- 0:00:30

      Average standard deviation of split frequencies: 0.009874

      620500 -- [-505.908] (-500.969) (-502.249) (-502.966) * (-505.088) [-502.790] (-501.858) (-501.612) -- 0:00:29
      621000 -- [-503.743] (-501.371) (-501.336) (-503.218) * (-501.929) [-501.313] (-501.080) (-503.901) -- 0:00:29
      621500 -- (-502.925) [-503.893] (-505.048) (-504.928) * (-501.757) [-501.560] (-502.312) (-509.624) -- 0:00:30
      622000 -- (-502.364) [-502.722] (-504.636) (-501.820) * (-504.510) (-502.957) [-503.109] (-502.458) -- 0:00:30
      622500 -- (-501.511) (-505.517) [-503.566] (-502.852) * (-501.977) [-501.880] (-501.796) (-503.571) -- 0:00:30
      623000 -- (-502.520) (-502.510) [-501.197] (-503.967) * [-501.236] (-507.995) (-501.691) (-501.278) -- 0:00:30
      623500 -- [-501.545] (-501.622) (-502.066) (-501.737) * (-502.708) [-505.841] (-501.453) (-500.849) -- 0:00:30
      624000 -- (-507.372) [-504.278] (-505.730) (-502.158) * (-503.323) (-505.688) [-501.750] (-502.331) -- 0:00:30
      624500 -- (-502.886) (-504.826) (-509.503) [-501.842] * (-502.025) (-500.922) (-503.031) [-502.420] -- 0:00:30
      625000 -- (-502.208) (-504.041) [-502.090] (-500.994) * [-504.672] (-501.423) (-503.719) (-501.794) -- 0:00:30

      Average standard deviation of split frequencies: 0.009922

      625500 -- (-502.826) (-502.365) [-501.563] (-502.096) * (-501.964) (-502.068) (-503.994) [-502.156] -- 0:00:29
      626000 -- [-502.156] (-502.250) (-501.942) (-502.341) * (-505.517) [-506.727] (-509.940) (-502.839) -- 0:00:29
      626500 -- (-503.837) (-504.473) [-502.565] (-504.955) * (-507.675) (-503.085) [-503.233] (-502.595) -- 0:00:29
      627000 -- (-503.041) [-502.894] (-501.825) (-503.751) * (-504.517) [-503.966] (-500.907) (-503.199) -- 0:00:29
      627500 -- (-501.664) [-504.043] (-502.877) (-506.809) * (-501.576) (-508.278) [-501.057] (-504.461) -- 0:00:29
      628000 -- (-501.212) (-503.871) [-503.442] (-510.432) * (-501.893) [-504.217] (-503.430) (-501.301) -- 0:00:29
      628500 -- (-500.794) [-501.391] (-500.747) (-503.500) * [-505.185] (-502.677) (-504.075) (-503.569) -- 0:00:29
      629000 -- (-501.080) (-504.705) [-504.466] (-502.068) * [-503.670] (-504.118) (-502.491) (-504.093) -- 0:00:29
      629500 -- (-504.740) [-501.831] (-503.230) (-502.663) * (-500.850) (-504.291) [-502.255] (-504.376) -- 0:00:29
      630000 -- (-501.887) (-502.725) (-506.329) [-503.426] * (-501.944) (-501.854) [-501.699] (-504.875) -- 0:00:29

      Average standard deviation of split frequencies: 0.010245

      630500 -- (-503.058) (-505.428) [-502.264] (-502.386) * [-502.604] (-504.022) (-501.318) (-503.257) -- 0:00:29
      631000 -- (-501.711) (-503.626) [-502.575] (-503.040) * [-504.075] (-503.272) (-503.894) (-500.376) -- 0:00:29
      631500 -- [-503.095] (-503.252) (-504.051) (-503.318) * (-501.776) [-502.193] (-502.990) (-501.650) -- 0:00:29
      632000 -- (-502.570) (-508.547) [-504.207] (-504.180) * [-503.737] (-501.052) (-502.302) (-503.090) -- 0:00:29
      632500 -- (-501.472) [-502.687] (-503.026) (-504.847) * (-504.232) [-502.931] (-501.252) (-501.545) -- 0:00:29
      633000 -- [-501.497] (-501.602) (-500.963) (-502.834) * (-502.948) (-507.340) (-502.029) [-501.103] -- 0:00:28
      633500 -- [-503.280] (-501.477) (-502.874) (-502.691) * (-502.296) (-500.630) (-500.948) [-504.576] -- 0:00:28
      634000 -- (-507.293) (-502.489) (-501.183) [-505.630] * (-504.601) (-502.503) (-500.939) [-501.639] -- 0:00:28
      634500 -- (-505.381) (-503.351) [-506.418] (-501.795) * [-500.990] (-501.693) (-502.233) (-502.610) -- 0:00:29
      635000 -- [-505.316] (-503.676) (-502.158) (-501.191) * (-504.243) (-502.724) (-502.482) [-502.633] -- 0:00:29

      Average standard deviation of split frequencies: 0.009766

      635500 -- (-506.968) (-507.344) [-502.081] (-500.648) * (-504.645) (-501.472) (-504.826) [-503.239] -- 0:00:29
      636000 -- (-505.240) [-500.743] (-501.666) (-500.873) * (-503.202) (-501.686) (-502.928) [-503.768] -- 0:00:29
      636500 -- [-500.851] (-501.705) (-502.160) (-503.211) * (-501.374) (-501.537) (-501.919) [-502.970] -- 0:00:29
      637000 -- (-503.066) [-501.972] (-503.953) (-502.173) * (-503.053) (-502.855) (-504.465) [-504.421] -- 0:00:29
      637500 -- (-501.809) (-503.803) [-503.466] (-500.954) * (-510.490) [-503.130] (-502.337) (-504.835) -- 0:00:29
      638000 -- (-504.274) [-502.731] (-503.337) (-503.646) * [-505.546] (-502.139) (-501.734) (-503.108) -- 0:00:28
      638500 -- (-504.213) (-503.500) (-501.782) [-502.293] * [-503.158] (-503.018) (-502.443) (-501.018) -- 0:00:28
      639000 -- (-504.222) [-501.797] (-502.102) (-502.111) * (-501.035) (-501.608) [-503.709] (-501.403) -- 0:00:28
      639500 -- (-503.909) (-502.682) [-501.733] (-505.132) * (-503.840) (-501.539) [-501.313] (-501.378) -- 0:00:28
      640000 -- (-501.670) (-501.672) [-502.510] (-500.589) * (-501.208) (-503.441) [-503.014] (-504.074) -- 0:00:28

      Average standard deviation of split frequencies: 0.009912

      640500 -- (-504.571) (-502.091) [-501.772] (-502.743) * (-502.930) (-508.896) [-504.160] (-502.400) -- 0:00:28
      641000 -- (-504.411) [-508.581] (-501.259) (-506.373) * [-504.963] (-504.452) (-503.150) (-502.451) -- 0:00:28
      641500 -- (-503.811) (-504.280) (-503.146) [-504.275] * (-501.625) [-501.650] (-501.531) (-502.184) -- 0:00:28
      642000 -- [-502.720] (-508.754) (-500.561) (-503.663) * (-502.466) (-505.454) [-501.747] (-505.075) -- 0:00:28
      642500 -- [-502.936] (-502.344) (-500.573) (-503.625) * (-503.201) [-501.342] (-502.354) (-505.846) -- 0:00:28
      643000 -- (-502.324) (-504.284) (-502.112) [-501.560] * (-501.676) [-503.336] (-506.325) (-502.664) -- 0:00:28
      643500 -- (-503.422) [-502.104] (-500.754) (-504.080) * (-505.068) (-502.758) (-503.595) [-502.576] -- 0:00:28
      644000 -- (-504.971) (-501.386) [-501.397] (-503.399) * [-504.217] (-504.456) (-501.166) (-500.505) -- 0:00:28
      644500 -- (-502.619) (-502.555) (-500.865) [-503.639] * (-500.742) (-503.135) [-503.341] (-501.118) -- 0:00:28
      645000 -- (-503.207) (-506.947) [-501.308] (-502.952) * (-502.145) [-504.072] (-503.934) (-505.192) -- 0:00:28

      Average standard deviation of split frequencies: 0.009658

      645500 -- (-506.027) (-505.675) [-501.814] (-501.931) * [-503.734] (-507.885) (-504.436) (-503.901) -- 0:00:28
      646000 -- [-506.327] (-503.379) (-502.498) (-503.067) * (-503.261) [-502.571] (-502.156) (-504.149) -- 0:00:27
      646500 -- (-506.094) [-500.858] (-500.791) (-500.731) * (-503.904) (-503.448) (-502.658) [-502.679] -- 0:00:27
      647000 -- [-501.051] (-501.254) (-503.079) (-501.519) * (-502.620) (-505.663) [-502.178] (-505.253) -- 0:00:27
      647500 -- (-506.394) [-503.440] (-502.098) (-502.766) * (-504.887) (-502.111) (-504.158) [-502.075] -- 0:00:28
      648000 -- (-502.096) [-501.639] (-501.620) (-501.870) * (-505.745) [-503.806] (-503.818) (-502.773) -- 0:00:28
      648500 -- (-502.413) (-507.034) [-502.342] (-504.340) * (-505.550) (-510.507) (-500.685) [-504.073] -- 0:00:28
      649000 -- [-502.718] (-501.985) (-501.633) (-503.050) * (-502.373) (-504.160) [-501.988] (-506.644) -- 0:00:28
      649500 -- (-503.640) (-504.641) [-500.861] (-503.039) * [-501.726] (-501.490) (-502.104) (-501.190) -- 0:00:28
      650000 -- (-502.850) (-500.907) [-503.277] (-508.201) * (-502.289) (-502.707) [-500.565] (-501.829) -- 0:00:28

      Average standard deviation of split frequencies: 0.009333

      650500 -- (-502.255) (-500.994) [-501.581] (-501.407) * [-502.471] (-504.372) (-501.322) (-502.172) -- 0:00:27
      651000 -- (-504.912) (-502.339) (-503.074) [-502.166] * (-502.522) (-501.850) [-502.332] (-502.922) -- 0:00:27
      651500 -- (-503.884) (-501.911) (-501.211) [-502.932] * (-504.364) [-504.046] (-500.644) (-502.438) -- 0:00:27
      652000 -- (-504.255) [-501.138] (-501.146) (-505.416) * (-503.105) (-502.120) (-503.999) [-501.043] -- 0:00:27
      652500 -- (-501.425) [-502.251] (-501.065) (-503.318) * [-500.984] (-504.202) (-502.874) (-501.447) -- 0:00:27
      653000 -- (-501.857) (-503.254) [-501.187] (-502.725) * (-501.833) (-503.724) (-501.546) [-501.304] -- 0:00:27
      653500 -- [-501.709] (-501.990) (-503.168) (-503.227) * (-500.530) (-506.223) (-501.418) [-502.031] -- 0:00:27
      654000 -- (-501.137) (-504.585) [-502.068] (-502.008) * (-506.395) [-504.147] (-501.338) (-502.438) -- 0:00:27
      654500 -- [-507.273] (-501.019) (-501.528) (-501.986) * (-502.751) (-508.658) [-500.473] (-502.569) -- 0:00:27
      655000 -- (-505.320) (-504.950) [-503.051] (-504.514) * (-503.181) (-504.531) (-502.475) [-501.199] -- 0:00:27

      Average standard deviation of split frequencies: 0.009469

      655500 -- (-501.643) (-504.351) [-504.073] (-501.926) * (-504.017) [-505.219] (-502.297) (-502.094) -- 0:00:27
      656000 -- (-502.614) (-502.300) (-503.794) [-503.556] * (-502.965) [-500.926] (-503.655) (-505.287) -- 0:00:27
      656500 -- (-501.813) (-506.025) (-502.638) [-501.531] * (-503.068) (-503.161) [-502.032] (-503.742) -- 0:00:27
      657000 -- (-504.314) (-509.412) [-502.273] (-501.769) * (-501.740) [-501.738] (-504.831) (-502.777) -- 0:00:27
      657500 -- (-503.150) (-504.182) [-502.793] (-502.465) * (-501.049) [-503.338] (-504.958) (-503.758) -- 0:00:27
      658000 -- (-501.348) (-503.085) (-503.630) [-505.601] * (-503.415) (-500.931) [-501.915] (-501.415) -- 0:00:27
      658500 -- (-506.819) [-502.546] (-503.816) (-509.364) * (-501.594) [-502.197] (-501.852) (-502.942) -- 0:00:26
      659000 -- (-501.438) (-506.855) [-501.214] (-504.118) * (-501.196) (-502.535) (-502.023) [-504.187] -- 0:00:26
      659500 -- (-500.601) [-502.246] (-500.974) (-506.695) * (-503.279) [-501.676] (-503.979) (-506.252) -- 0:00:26
      660000 -- (-503.931) [-501.144] (-502.503) (-501.321) * (-502.585) (-505.721) (-507.828) [-502.371] -- 0:00:27

      Average standard deviation of split frequencies: 0.008898

      660500 -- (-503.442) [-501.542] (-504.030) (-501.337) * [-502.971] (-501.518) (-505.422) (-502.630) -- 0:00:27
      661000 -- [-501.761] (-504.806) (-507.427) (-500.946) * (-502.511) (-504.890) (-505.174) [-503.639] -- 0:00:27
      661500 -- (-501.761) (-507.606) (-503.435) [-500.612] * (-500.405) (-502.172) (-503.364) [-503.051] -- 0:00:27
      662000 -- (-503.060) (-504.326) [-504.086] (-505.407) * (-502.830) (-502.833) (-504.036) [-503.655] -- 0:00:27
      662500 -- (-502.083) [-501.140] (-505.562) (-501.730) * (-501.611) (-501.759) [-501.450] (-501.732) -- 0:00:27
      663000 -- (-504.446) (-501.729) (-508.964) [-503.398] * [-502.353] (-502.493) (-503.497) (-501.288) -- 0:00:26
      663500 -- (-503.052) (-502.543) (-503.826) [-501.926] * [-504.129] (-502.699) (-501.056) (-502.342) -- 0:00:26
      664000 -- [-503.325] (-505.585) (-501.740) (-501.050) * (-503.734) (-503.124) (-501.998) [-502.664] -- 0:00:26
      664500 -- (-510.916) (-503.369) [-502.815] (-502.612) * (-500.750) (-502.265) [-501.166] (-504.530) -- 0:00:26
      665000 -- (-503.556) [-503.180] (-503.119) (-500.482) * (-501.975) [-500.854] (-502.901) (-503.495) -- 0:00:26

      Average standard deviation of split frequencies: 0.008702

      665500 -- [-504.297] (-501.385) (-504.466) (-500.537) * (-501.594) [-504.673] (-502.727) (-503.320) -- 0:00:26
      666000 -- (-501.326) (-503.026) [-504.126] (-501.071) * [-501.377] (-502.197) (-502.128) (-501.689) -- 0:00:26
      666500 -- (-501.135) [-501.247] (-500.843) (-501.462) * (-502.421) (-502.409) (-501.785) [-506.925] -- 0:00:26
      667000 -- (-505.693) [-504.073] (-506.337) (-503.936) * (-504.322) [-502.208] (-505.200) (-501.907) -- 0:00:26
      667500 -- [-508.107] (-504.249) (-504.492) (-502.469) * (-502.349) (-504.856) (-502.448) [-505.075] -- 0:00:26
      668000 -- (-509.190) [-506.212] (-503.185) (-503.245) * (-502.797) [-502.532] (-504.886) (-505.970) -- 0:00:26
      668500 -- (-508.631) (-501.499) (-502.881) [-502.274] * (-504.875) [-503.528] (-503.388) (-505.636) -- 0:00:26
      669000 -- (-506.874) [-504.615] (-503.537) (-502.068) * [-504.403] (-506.268) (-502.121) (-503.230) -- 0:00:26
      669500 -- [-504.183] (-503.244) (-504.156) (-504.002) * (-504.479) (-504.297) (-501.916) [-502.878] -- 0:00:26
      670000 -- (-501.529) [-502.463] (-501.826) (-502.345) * [-504.324] (-502.415) (-501.274) (-504.646) -- 0:00:26

      Average standard deviation of split frequencies: 0.008559

      670500 -- (-502.359) (-501.983) [-505.704] (-504.436) * (-501.940) [-501.075] (-501.526) (-503.378) -- 0:00:26
      671000 -- [-501.142] (-505.324) (-502.843) (-501.383) * (-502.737) [-502.756] (-500.993) (-502.939) -- 0:00:25
      671500 -- (-502.603) (-505.812) (-504.839) [-500.994] * (-503.447) (-503.561) (-503.671) [-501.108] -- 0:00:25
      672000 -- (-502.577) (-503.992) (-502.132) [-502.638] * (-503.134) (-501.916) (-502.728) [-503.693] -- 0:00:25
      672500 -- (-504.487) (-507.253) (-502.528) [-504.135] * (-503.104) [-503.882] (-507.151) (-503.668) -- 0:00:25
      673000 -- [-502.103] (-501.696) (-505.000) (-504.721) * [-505.448] (-503.796) (-503.012) (-503.535) -- 0:00:26
      673500 -- (-502.327) [-503.062] (-504.415) (-502.327) * (-504.212) [-501.599] (-501.845) (-505.493) -- 0:00:26
      674000 -- [-501.904] (-505.629) (-503.295) (-501.125) * (-501.338) (-501.939) [-501.646] (-506.786) -- 0:00:26
      674500 -- [-503.564] (-502.002) (-503.843) (-503.734) * [-504.733] (-501.734) (-508.184) (-505.053) -- 0:00:26
      675000 -- [-501.046] (-503.547) (-501.802) (-511.735) * (-502.197) (-502.266) [-504.787] (-502.310) -- 0:00:26

      Average standard deviation of split frequencies: 0.008614

      675500 -- (-501.897) (-504.863) [-501.416] (-504.972) * [-501.135] (-504.346) (-506.458) (-502.942) -- 0:00:25
      676000 -- (-502.771) [-502.180] (-501.252) (-506.123) * (-501.245) (-504.756) (-503.088) [-501.874] -- 0:00:25
      676500 -- (-501.349) [-501.984] (-501.929) (-502.631) * (-503.239) (-503.723) [-502.724] (-503.054) -- 0:00:25
      677000 -- (-502.207) (-502.134) (-500.770) [-501.689] * (-502.395) [-505.419] (-503.495) (-502.479) -- 0:00:25
      677500 -- (-504.387) (-505.322) [-501.379] (-503.616) * (-508.383) (-502.407) [-505.233] (-504.147) -- 0:00:25
      678000 -- [-501.687] (-508.302) (-504.149) (-505.049) * (-507.398) [-503.053] (-506.031) (-502.701) -- 0:00:25
      678500 -- (-503.823) [-501.173] (-504.971) (-503.750) * (-502.419) (-501.709) [-503.158] (-501.516) -- 0:00:25
      679000 -- (-503.980) (-505.546) (-507.414) [-500.667] * [-503.857] (-501.960) (-503.001) (-503.706) -- 0:00:25
      679500 -- (-503.195) [-503.710] (-502.975) (-500.669) * [-504.089] (-504.281) (-504.082) (-502.577) -- 0:00:25
      680000 -- [-506.814] (-504.897) (-505.694) (-500.564) * [-506.013] (-504.985) (-505.292) (-510.240) -- 0:00:25

      Average standard deviation of split frequencies: 0.009329

      680500 -- (-505.746) [-503.452] (-505.449) (-505.417) * (-501.200) (-504.451) (-504.056) [-503.199] -- 0:00:25
      681000 -- (-505.155) (-503.234) [-508.042] (-504.885) * (-507.572) (-502.378) [-503.323] (-503.950) -- 0:00:25
      681500 -- (-503.535) (-501.743) (-504.834) [-503.247] * [-505.300] (-505.465) (-501.747) (-503.331) -- 0:00:25
      682000 -- (-502.317) (-505.915) (-501.392) [-503.634] * (-505.411) [-501.541] (-501.473) (-501.540) -- 0:00:25
      682500 -- (-502.270) (-502.830) [-501.480] (-506.346) * (-502.990) (-501.924) (-501.291) [-502.942] -- 0:00:25
      683000 -- [-503.630] (-503.487) (-500.620) (-503.480) * [-501.625] (-501.307) (-502.997) (-505.862) -- 0:00:25
      683500 -- (-502.256) [-504.658] (-501.017) (-504.976) * (-502.216) [-502.522] (-501.329) (-504.919) -- 0:00:25
      684000 -- (-503.005) (-501.900) (-503.300) [-503.752] * [-502.645] (-502.916) (-503.250) (-503.101) -- 0:00:24
      684500 -- (-501.566) [-501.698] (-506.624) (-503.894) * (-502.834) [-501.055] (-503.133) (-503.785) -- 0:00:24
      685000 -- (-505.197) (-501.111) [-502.528] (-503.601) * (-501.270) (-500.798) (-504.395) [-504.368] -- 0:00:24

      Average standard deviation of split frequencies: 0.009418

      685500 -- (-505.830) (-502.040) [-500.934] (-509.137) * (-503.240) (-500.579) [-502.454] (-501.896) -- 0:00:24
      686000 -- (-500.922) (-502.301) (-503.163) [-503.917] * (-501.192) (-502.820) [-504.480] (-502.271) -- 0:00:25
      686500 -- (-504.470) (-504.129) [-503.830] (-503.420) * [-504.236] (-506.792) (-502.361) (-502.509) -- 0:00:25
      687000 -- (-502.924) (-502.913) (-503.182) [-500.993] * (-502.162) (-508.749) [-502.801] (-502.159) -- 0:00:25
      687500 -- (-503.626) (-501.998) (-501.611) [-502.298] * (-502.423) (-504.865) (-503.923) [-501.021] -- 0:00:25
      688000 -- [-501.711] (-501.106) (-502.059) (-501.293) * (-502.086) (-502.240) (-506.142) [-502.598] -- 0:00:24
      688500 -- [-501.291] (-503.985) (-502.691) (-501.359) * (-502.440) (-501.425) (-500.974) [-500.696] -- 0:00:24
      689000 -- [-503.827] (-503.394) (-502.278) (-501.954) * (-505.175) [-500.630] (-503.049) (-503.079) -- 0:00:24
      689500 -- (-503.102) (-506.036) [-503.089] (-505.503) * [-501.066] (-505.230) (-505.200) (-503.885) -- 0:00:24
      690000 -- (-503.366) (-504.682) (-507.605) [-501.946] * [-501.278] (-502.651) (-503.140) (-503.794) -- 0:00:24

      Average standard deviation of split frequencies: 0.009475

      690500 -- (-502.063) (-502.869) (-504.820) [-500.830] * (-502.890) (-502.568) (-501.687) [-502.899] -- 0:00:24
      691000 -- (-501.494) (-504.377) (-503.826) [-501.269] * [-500.567] (-503.538) (-502.225) (-504.969) -- 0:00:24
      691500 -- [-505.156] (-505.886) (-502.508) (-502.899) * [-501.601] (-504.192) (-503.532) (-505.291) -- 0:00:24
      692000 -- (-507.668) (-507.838) (-501.632) [-501.576] * [-505.431] (-507.752) (-504.249) (-508.289) -- 0:00:24
      692500 -- (-503.761) (-506.404) (-502.362) [-502.775] * [-504.464] (-505.807) (-503.442) (-507.221) -- 0:00:24
      693000 -- (-502.858) (-502.877) (-501.901) [-503.076] * (-503.713) (-504.123) (-500.504) [-501.289] -- 0:00:24
      693500 -- (-502.149) (-501.091) (-503.383) [-503.499] * [-502.570] (-503.875) (-503.376) (-503.138) -- 0:00:24
      694000 -- (-501.187) (-504.132) (-504.740) [-506.528] * (-502.007) [-501.662] (-503.721) (-502.077) -- 0:00:24
      694500 -- (-500.667) [-501.223] (-501.599) (-506.278) * (-502.190) (-503.564) [-501.621] (-500.407) -- 0:00:24
      695000 -- (-502.848) (-502.663) (-503.829) [-500.775] * (-501.027) [-502.125] (-502.879) (-501.903) -- 0:00:24

      Average standard deviation of split frequencies: 0.008678

      695500 -- (-503.221) (-504.116) (-503.381) [-506.038] * (-502.455) [-502.260] (-501.377) (-500.541) -- 0:00:24
      696000 -- [-502.907] (-503.062) (-502.492) (-501.421) * (-505.523) (-502.796) [-501.932] (-504.066) -- 0:00:24
      696500 -- [-500.635] (-503.129) (-502.122) (-502.137) * (-501.629) (-506.411) [-502.406] (-502.881) -- 0:00:23
      697000 -- (-502.975) (-501.712) (-506.812) [-501.357] * (-500.989) [-503.651] (-502.938) (-502.285) -- 0:00:23
      697500 -- (-504.248) (-501.081) (-501.356) [-501.957] * (-505.624) [-503.791] (-500.391) (-501.298) -- 0:00:23
      698000 -- (-501.597) (-500.793) (-501.227) [-500.801] * (-502.951) (-500.772) (-501.586) [-504.242] -- 0:00:23
      698500 -- (-501.689) [-501.700] (-504.346) (-501.400) * [-504.657] (-501.711) (-502.008) (-505.420) -- 0:00:24
      699000 -- (-502.863) [-501.800] (-502.467) (-502.184) * [-501.151] (-504.091) (-502.398) (-502.384) -- 0:00:24
      699500 -- (-503.188) [-501.857] (-503.766) (-504.015) * [-503.420] (-501.110) (-502.960) (-504.884) -- 0:00:24
      700000 -- (-504.382) (-502.792) (-502.678) [-502.805] * [-501.573] (-502.579) (-505.343) (-505.569) -- 0:00:24

      Average standard deviation of split frequencies: 0.008410

      700500 -- [-503.045] (-502.590) (-502.407) (-503.947) * (-503.111) [-501.577] (-501.832) (-502.819) -- 0:00:23
      701000 -- (-502.690) (-503.183) [-500.566] (-503.827) * (-505.055) [-503.542] (-503.307) (-501.609) -- 0:00:23
      701500 -- (-503.232) (-501.298) [-500.796] (-501.237) * (-503.675) (-502.548) [-504.483] (-502.219) -- 0:00:23
      702000 -- (-502.691) (-501.132) (-503.063) [-504.782] * (-503.097) (-502.078) (-509.678) [-505.075] -- 0:00:23
      702500 -- (-500.342) (-504.521) (-502.818) [-501.553] * (-502.553) (-501.915) [-501.723] (-501.441) -- 0:00:23
      703000 -- (-501.569) (-509.033) [-504.630] (-501.388) * (-502.105) (-502.084) (-502.874) [-504.333] -- 0:00:23
      703500 -- (-501.688) (-500.896) (-502.197) [-502.580] * (-502.743) [-500.971] (-506.152) (-504.189) -- 0:00:23
      704000 -- (-504.595) [-502.331] (-503.386) (-502.788) * (-505.957) (-502.865) (-501.279) [-502.076] -- 0:00:23
      704500 -- (-501.559) (-504.185) (-501.615) [-502.853] * (-502.968) (-503.453) [-501.450] (-502.918) -- 0:00:23
      705000 -- (-503.131) (-504.341) [-501.835] (-503.410) * [-501.566] (-501.807) (-507.839) (-504.208) -- 0:00:23

      Average standard deviation of split frequencies: 0.008388

      705500 -- (-501.497) (-503.817) [-501.057] (-503.247) * [-501.882] (-501.254) (-501.186) (-507.831) -- 0:00:23
      706000 -- (-501.501) (-503.196) (-503.797) [-502.647] * (-505.796) (-501.847) [-501.339] (-506.403) -- 0:00:23
      706500 -- (-502.182) (-503.888) [-503.944] (-505.923) * (-506.469) (-502.429) [-501.749] (-510.675) -- 0:00:23
      707000 -- (-502.396) (-503.934) (-507.276) [-502.538] * [-502.050] (-505.958) (-501.493) (-502.316) -- 0:00:23
      707500 -- (-503.609) (-502.515) [-502.595] (-501.419) * (-501.011) (-506.381) (-503.036) [-502.179] -- 0:00:23
      708000 -- [-502.222] (-502.462) (-505.266) (-501.253) * (-501.811) (-501.246) (-504.799) [-502.719] -- 0:00:23
      708500 -- (-503.506) (-500.667) [-502.093] (-502.197) * (-509.110) (-501.908) (-504.277) [-501.836] -- 0:00:23
      709000 -- (-502.271) [-501.901] (-502.631) (-501.484) * (-504.055) (-501.270) (-502.429) [-503.446] -- 0:00:22
      709500 -- (-502.563) (-502.500) [-504.298] (-503.290) * (-509.073) (-500.879) [-500.932] (-506.435) -- 0:00:22
      710000 -- (-504.317) (-502.174) (-502.207) [-503.416] * (-506.381) (-503.091) [-502.722] (-504.432) -- 0:00:22

      Average standard deviation of split frequencies: 0.008375

      710500 -- (-500.614) [-501.495] (-502.089) (-501.177) * (-504.876) (-502.551) (-501.799) [-501.201] -- 0:00:22
      711000 -- (-501.370) (-502.454) [-502.985] (-506.166) * (-504.790) [-505.204] (-504.115) (-501.170) -- 0:00:22
      711500 -- (-503.451) (-501.717) [-506.475] (-501.521) * [-501.175] (-505.081) (-501.584) (-508.541) -- 0:00:23
      712000 -- (-503.772) (-506.303) [-502.552] (-503.855) * [-501.230] (-501.465) (-502.766) (-502.870) -- 0:00:23
      712500 -- [-504.296] (-502.196) (-502.223) (-501.900) * (-503.530) (-503.293) (-504.617) [-502.780] -- 0:00:23
      713000 -- [-505.763] (-503.161) (-503.224) (-502.225) * (-503.040) (-501.535) (-505.206) [-503.918] -- 0:00:22
      713500 -- (-502.657) (-502.681) (-502.101) [-501.020] * (-502.566) [-502.472] (-502.533) (-501.491) -- 0:00:22
      714000 -- (-501.015) (-501.887) [-504.246] (-503.042) * [-504.385] (-503.797) (-502.675) (-504.892) -- 0:00:22
      714500 -- (-503.440) (-503.597) (-500.847) [-503.805] * (-503.853) (-501.292) (-503.531) [-501.408] -- 0:00:22
      715000 -- [-501.611] (-501.900) (-501.105) (-501.535) * (-507.119) (-506.434) (-505.982) [-502.184] -- 0:00:22

      Average standard deviation of split frequencies: 0.008753

      715500 -- (-501.089) [-501.704] (-501.362) (-502.145) * (-505.302) (-503.687) [-502.241] (-505.424) -- 0:00:22
      716000 -- (-503.865) (-503.256) [-503.633] (-504.256) * (-501.556) (-502.391) (-502.320) [-505.277] -- 0:00:22
      716500 -- (-502.904) (-501.985) (-502.680) [-502.706] * (-501.555) (-501.289) (-505.451) [-501.026] -- 0:00:22
      717000 -- (-502.705) [-502.350] (-500.748) (-501.627) * [-501.243] (-504.386) (-501.962) (-501.372) -- 0:00:22
      717500 -- (-502.250) [-504.944] (-501.940) (-500.713) * (-503.132) [-502.832] (-501.508) (-502.366) -- 0:00:22
      718000 -- [-502.005] (-506.187) (-503.003) (-500.461) * (-502.983) (-502.304) (-501.863) [-501.100] -- 0:00:22
      718500 -- [-501.164] (-503.740) (-502.922) (-500.696) * (-501.187) (-505.308) (-500.935) [-504.873] -- 0:00:22
      719000 -- (-503.232) [-501.170] (-504.719) (-501.580) * (-507.891) [-500.660] (-502.656) (-503.088) -- 0:00:22
      719500 -- [-501.685] (-501.972) (-503.667) (-500.996) * (-501.433) (-503.941) [-500.859] (-501.918) -- 0:00:22
      720000 -- (-501.521) (-507.935) (-502.924) [-500.616] * [-501.392] (-510.022) (-504.093) (-501.871) -- 0:00:22

      Average standard deviation of split frequencies: 0.008544

      720500 -- [-500.604] (-502.655) (-501.754) (-503.566) * (-501.400) [-502.755] (-503.548) (-502.965) -- 0:00:22
      721000 -- (-500.504) (-504.474) (-502.283) [-501.842] * (-506.310) [-501.241] (-504.744) (-503.050) -- 0:00:22
      721500 -- (-503.227) [-500.762] (-501.186) (-503.988) * (-506.223) (-503.239) [-502.853] (-502.418) -- 0:00:22
      722000 -- (-502.934) [-500.511] (-503.389) (-504.316) * [-503.654] (-503.719) (-503.990) (-501.393) -- 0:00:21
      722500 -- [-502.817] (-502.147) (-505.435) (-504.986) * [-501.985] (-500.755) (-501.578) (-501.019) -- 0:00:21
      723000 -- (-502.009) (-503.012) [-507.868] (-503.787) * (-503.195) (-501.906) (-503.432) [-502.396] -- 0:00:21
      723500 -- [-503.382] (-502.126) (-506.343) (-505.295) * (-502.834) (-504.166) [-503.744] (-500.810) -- 0:00:21
      724000 -- [-503.133] (-502.923) (-504.595) (-503.025) * (-502.962) (-501.624) (-500.942) [-502.892] -- 0:00:21
      724500 -- (-503.855) (-507.894) [-504.390] (-502.290) * [-501.063] (-502.269) (-508.865) (-500.647) -- 0:00:22
      725000 -- [-501.370] (-506.091) (-500.562) (-502.237) * (-502.278) (-502.166) (-504.893) [-502.611] -- 0:00:22

      Average standard deviation of split frequencies: 0.008747

      725500 -- (-505.561) [-503.899] (-505.140) (-502.070) * [-503.726] (-502.479) (-504.903) (-502.339) -- 0:00:21
      726000 -- (-502.935) (-503.527) (-503.065) [-500.740] * (-501.194) (-502.798) (-505.411) [-501.303] -- 0:00:21
      726500 -- (-504.363) (-504.971) (-503.189) [-503.979] * (-501.624) [-503.110] (-503.631) (-501.503) -- 0:00:21
      727000 -- (-504.098) [-501.525] (-503.909) (-503.567) * (-505.291) (-502.500) [-502.290] (-500.622) -- 0:00:21
      727500 -- (-503.532) [-502.105] (-501.461) (-516.075) * (-507.884) (-502.881) [-502.878] (-501.929) -- 0:00:21
      728000 -- (-501.376) [-502.188] (-505.676) (-507.697) * (-503.356) (-505.613) (-504.708) [-503.433] -- 0:00:21
      728500 -- (-502.508) [-502.430] (-506.681) (-502.255) * (-501.644) (-503.211) (-501.131) [-500.663] -- 0:00:21
      729000 -- [-501.386] (-502.290) (-502.082) (-502.104) * (-502.179) [-500.935] (-504.643) (-501.311) -- 0:00:21
      729500 -- (-502.024) (-502.484) (-502.642) [-505.838] * (-501.867) (-503.322) (-513.493) [-502.083] -- 0:00:21
      730000 -- (-509.893) (-501.651) (-506.736) [-506.349] * [-501.801] (-501.843) (-501.814) (-505.713) -- 0:00:21

      Average standard deviation of split frequencies: 0.008024

      730500 -- (-509.605) [-504.145] (-503.032) (-507.367) * (-501.465) (-501.203) [-502.036] (-501.744) -- 0:00:21
      731000 -- (-506.022) [-502.235] (-501.277) (-502.859) * [-502.303] (-501.869) (-501.937) (-502.532) -- 0:00:21
      731500 -- (-505.115) [-502.263] (-502.784) (-506.782) * [-501.086] (-502.571) (-503.048) (-502.510) -- 0:00:21
      732000 -- (-504.568) [-501.096] (-502.172) (-502.526) * (-501.557) [-503.467] (-504.785) (-501.384) -- 0:00:21
      732500 -- (-504.427) [-501.199] (-501.611) (-503.750) * (-501.451) (-507.775) (-502.249) [-500.844] -- 0:00:21
      733000 -- (-502.906) (-502.784) [-504.720] (-503.536) * (-502.195) (-504.504) [-501.776] (-500.443) -- 0:00:21
      733500 -- (-501.756) [-502.708] (-504.600) (-503.372) * [-503.013] (-506.282) (-502.633) (-500.765) -- 0:00:21
      734000 -- (-502.545) (-504.960) [-502.401] (-504.350) * (-501.585) (-506.074) [-502.283] (-504.902) -- 0:00:21
      734500 -- (-501.127) [-503.343] (-501.244) (-503.877) * (-503.553) (-503.771) (-502.094) [-502.122] -- 0:00:20
      735000 -- (-501.606) (-503.179) (-501.381) [-504.539] * [-502.176] (-504.296) (-506.247) (-503.064) -- 0:00:20

      Average standard deviation of split frequencies: 0.008086

      735500 -- (-501.752) [-501.645] (-506.196) (-502.428) * [-503.437] (-504.471) (-502.841) (-500.906) -- 0:00:20
      736000 -- (-504.575) [-500.519] (-503.785) (-504.722) * (-504.510) [-502.996] (-501.461) (-503.019) -- 0:00:20
      736500 -- (-503.705) (-503.718) (-505.267) [-502.776] * (-503.402) (-507.035) (-503.272) [-502.241] -- 0:00:20
      737000 -- (-504.368) [-502.070] (-507.579) (-503.735) * (-503.611) (-502.528) [-502.129] (-501.598) -- 0:00:21
      737500 -- (-506.342) (-503.651) (-503.669) [-501.418] * (-504.431) [-501.977] (-500.941) (-503.184) -- 0:00:21
      738000 -- (-502.162) [-500.946] (-501.818) (-503.874) * (-500.758) (-503.668) (-500.746) [-502.113] -- 0:00:20
      738500 -- (-505.193) (-501.977) [-506.709] (-507.002) * (-503.052) (-502.738) (-500.442) [-502.153] -- 0:00:20
      739000 -- (-502.918) (-504.984) (-501.587) [-501.521] * (-501.643) (-503.099) (-501.695) [-507.073] -- 0:00:20
      739500 -- [-503.381] (-504.997) (-505.698) (-503.086) * (-505.282) [-506.548] (-503.152) (-507.673) -- 0:00:20
      740000 -- [-501.177] (-504.419) (-503.353) (-503.431) * [-506.259] (-502.099) (-503.598) (-504.756) -- 0:00:20

      Average standard deviation of split frequencies: 0.008513

      740500 -- (-501.063) (-503.336) [-503.172] (-501.480) * (-502.663) [-500.804] (-504.011) (-502.737) -- 0:00:20
      741000 -- (-503.103) (-500.934) [-504.149] (-501.031) * (-504.640) [-502.047] (-502.904) (-503.008) -- 0:00:20
      741500 -- (-503.608) (-503.103) [-501.895] (-501.544) * (-502.809) (-502.785) [-501.208] (-501.957) -- 0:00:20
      742000 -- (-503.964) (-508.677) (-500.928) [-502.230] * (-501.110) (-506.077) [-502.979] (-504.094) -- 0:00:20
      742500 -- [-503.177] (-502.154) (-502.571) (-504.912) * [-505.002] (-502.765) (-502.349) (-507.197) -- 0:00:20
      743000 -- (-502.570) (-502.332) (-503.732) [-504.580] * [-504.049] (-504.799) (-503.463) (-501.331) -- 0:00:20
      743500 -- (-501.857) (-502.610) (-504.878) [-502.975] * (-502.059) (-503.755) [-502.310] (-501.114) -- 0:00:20
      744000 -- (-507.129) [-504.396] (-505.628) (-504.999) * (-503.225) (-502.143) [-503.917] (-500.612) -- 0:00:20
      744500 -- (-502.898) (-504.943) (-503.485) [-502.461] * [-503.431] (-502.229) (-502.754) (-506.177) -- 0:00:20
      745000 -- (-508.831) (-501.689) [-501.216] (-504.049) * (-506.720) (-503.439) [-504.712] (-502.084) -- 0:00:20

      Average standard deviation of split frequencies: 0.008570

      745500 -- (-504.614) (-502.459) (-501.304) [-505.204] * [-502.226] (-500.805) (-503.694) (-500.952) -- 0:00:20
      746000 -- [-501.050] (-506.990) (-505.396) (-502.112) * [-501.543] (-505.194) (-500.774) (-504.914) -- 0:00:20
      746500 -- [-501.907] (-502.686) (-501.157) (-506.983) * (-502.567) (-500.834) [-500.956] (-501.640) -- 0:00:20
      747000 -- (-506.020) [-506.712] (-504.027) (-500.746) * (-502.502) (-503.079) (-500.442) [-501.701] -- 0:00:19
      747500 -- (-500.925) (-505.137) (-505.069) [-503.325] * (-503.247) [-502.581] (-504.563) (-505.114) -- 0:00:19
      748000 -- (-500.883) [-501.264] (-501.941) (-506.562) * (-503.429) [-500.960] (-503.998) (-504.305) -- 0:00:19
      748500 -- (-503.556) (-502.611) (-507.475) [-502.101] * (-502.166) [-502.116] (-504.079) (-501.964) -- 0:00:19
      749000 -- (-505.242) (-506.471) (-506.068) [-501.954] * (-503.008) [-501.764] (-503.391) (-503.385) -- 0:00:19
      749500 -- (-502.032) [-501.822] (-503.657) (-501.892) * (-502.892) (-500.905) [-506.953] (-502.100) -- 0:00:19
      750000 -- (-503.197) [-501.307] (-505.138) (-504.588) * [-504.213] (-503.493) (-501.724) (-502.352) -- 0:00:20

      Average standard deviation of split frequencies: 0.007968

      750500 -- (-500.524) (-504.120) [-501.133] (-501.540) * (-505.466) (-503.637) (-500.564) [-500.997] -- 0:00:19
      751000 -- (-501.136) (-503.962) [-501.341] (-500.905) * (-503.857) (-502.357) (-503.382) [-501.158] -- 0:00:19
      751500 -- (-501.101) (-504.202) (-501.905) [-501.212] * (-503.507) (-501.982) [-501.054] (-501.568) -- 0:00:19
      752000 -- (-501.598) (-502.666) [-500.914] (-502.481) * (-502.693) (-502.837) [-502.502] (-506.967) -- 0:00:19
      752500 -- (-501.461) (-502.789) (-503.238) [-500.526] * (-504.676) (-501.953) [-501.713] (-507.785) -- 0:00:19
      753000 -- [-503.935] (-501.117) (-504.250) (-500.609) * (-503.961) [-503.051] (-505.119) (-503.212) -- 0:00:19
      753500 -- (-501.801) (-501.949) (-505.821) [-501.714] * (-502.425) [-501.239] (-503.120) (-504.374) -- 0:00:19
      754000 -- [-501.160] (-505.359) (-502.712) (-504.794) * [-505.249] (-502.136) (-503.711) (-503.716) -- 0:00:19
      754500 -- (-502.565) (-503.837) (-506.494) [-501.932] * (-505.048) [-501.293] (-503.105) (-505.663) -- 0:00:19
      755000 -- (-502.244) [-504.222] (-506.908) (-502.421) * (-502.231) [-502.088] (-502.800) (-506.677) -- 0:00:19

      Average standard deviation of split frequencies: 0.007911

      755500 -- (-501.706) (-502.051) [-504.251] (-508.028) * [-506.891] (-501.390) (-503.439) (-502.052) -- 0:00:19
      756000 -- [-501.779] (-502.284) (-502.204) (-502.739) * (-501.162) [-501.748] (-502.009) (-501.516) -- 0:00:19
      756500 -- [-503.416] (-502.617) (-504.387) (-502.467) * [-500.739] (-506.574) (-501.463) (-504.059) -- 0:00:19
      757000 -- (-502.515) [-503.083] (-512.969) (-502.228) * (-502.482) (-506.787) [-503.341] (-504.560) -- 0:00:19
      757500 -- (-504.164) (-510.814) (-504.803) [-502.666] * (-503.282) [-500.686] (-506.962) (-504.410) -- 0:00:19
      758000 -- (-503.590) (-501.809) (-503.356) [-502.998] * [-501.245] (-502.477) (-505.284) (-506.167) -- 0:00:19
      758500 -- [-503.354] (-501.220) (-502.383) (-504.402) * (-503.733) (-509.025) (-502.945) [-504.184] -- 0:00:19
      759000 -- (-507.483) (-501.036) (-501.500) [-502.923] * (-502.621) [-503.115] (-508.665) (-504.041) -- 0:00:19
      759500 -- (-503.378) (-502.896) (-504.809) [-503.979] * [-500.751] (-505.049) (-508.582) (-502.213) -- 0:00:18
      760000 -- (-501.013) (-502.613) (-506.869) [-504.037] * (-501.966) [-502.504] (-502.493) (-501.358) -- 0:00:18

      Average standard deviation of split frequencies: 0.007785

      760500 -- (-500.832) [-501.779] (-504.675) (-507.011) * (-501.379) [-506.923] (-501.830) (-511.399) -- 0:00:18
      761000 -- [-503.492] (-504.516) (-501.514) (-503.682) * [-502.964] (-504.445) (-502.657) (-504.836) -- 0:00:18
      761500 -- (-502.545) (-502.063) [-502.128] (-502.434) * (-502.085) (-503.421) [-500.597] (-502.306) -- 0:00:18
      762000 -- (-505.222) [-504.843] (-505.335) (-501.074) * [-501.389] (-503.850) (