--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:38:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplN/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -502.00 -505.03
2 -501.91 -505.71
--------------------------------------
TOTAL -501.96 -505.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893050 0.089124 0.350626 1.475254 0.856800 1501.00 1501.00 1.001
r(A<->C){all} 0.176069 0.022756 0.000175 0.485162 0.133619 167.59 214.70 1.002
r(A<->G){all} 0.159537 0.019200 0.000150 0.442904 0.119356 183.22 218.52 1.000
r(A<->T){all} 0.162394 0.019755 0.000239 0.445840 0.124047 176.74 213.20 1.000
r(C<->G){all} 0.164313 0.019169 0.000049 0.440118 0.127171 180.12 234.41 1.003
r(C<->T){all} 0.177145 0.020497 0.000021 0.468158 0.141718 190.41 287.34 1.004
r(G<->T){all} 0.160542 0.017399 0.000068 0.424030 0.128895 196.09 214.44 1.002
pi(A){all} 0.223900 0.000458 0.183823 0.265957 0.223112 1270.87 1385.93 1.000
pi(C){all} 0.289586 0.000533 0.247082 0.336924 0.289138 837.90 998.80 1.000
pi(G){all} 0.303019 0.000562 0.255875 0.349882 0.303087 1010.53 1255.77 1.001
pi(T){all} 0.183495 0.000396 0.147292 0.224578 0.183333 1053.31 1190.82 1.000
alpha{1,2} 0.432761 0.240901 0.000103 1.464271 0.253398 1312.84 1331.48 1.000
alpha{3} 0.449303 0.228757 0.000109 1.455813 0.284373 1164.78 1288.67 1.000
pinvar{all} 0.995724 0.000026 0.986306 0.999997 0.997331 1238.98 1303.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -433.063437
Model 2: PositiveSelection -433.063516
Model 0: one-ratio -433.063437
Model 7: beta -433.063437
Model 8: beta&w>1 -433.063437
Model 0 vs 1 0.0
Model 2 vs 1 1.5799999994214886E-4
Model 8 vs 7 0.0
>C1
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C2
VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
RFMKIISLAPEVLooooooooo
>C3
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C4
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C5
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C6
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=131
C1 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C2 ---------VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C3 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C4 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C5 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
C6 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
*****************************************
C1 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C2 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C3 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C4 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C5 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
C6 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
**************************************************
C1 PVGRELREKRFMKIISLAPEVL---------
C2 PVGRELREKRFMKIISLAPEVLooooooooo
C3 PVGRELREKRFMKIISLAPEVL---------
C4 PVGRELREKRFMKIISLAPEVL---------
C5 PVGRELREKRFMKIISLAPEVL---------
C6 PVGRELREKRFMKIISLAPEVL---------
**********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 122 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 122 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3710]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3710]--->[3630]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.451 Mb, Max= 30.642 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C2 VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C3 VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C4 VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C5 VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
C6 VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGGNVKRGDVVK
**************************************************
C1 AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C2 AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C3 AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C4 AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C5 AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
C6 AVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGRELREK
**************************************************
C1 RFMKIISLAPEVL
C2 RFMKIISLAPEVL
C3 RFMKIISLAPEVL
C4 RFMKIISLAPEVL
C5 RFMKIISLAPEVL
C6 RFMKIISLAPEVL
*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C2 ---------------------------GTGGCCGACAACACCGGCGCCAA
C3 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C4 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C5 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
C6 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
***********************
C1 GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C2 GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C3 GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C4 GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C5 GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
C6 GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
**************************************************
C1 GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C2 GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C3 GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C4 GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C5 GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
C6 GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
**************************************************
C1 AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C2 AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C3 AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C4 AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C5 AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
C6 AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
**************************************************
C1 AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C2 AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C3 AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C4 AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C5 AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
C6 AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
**************************************************
C1 CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C2 CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C3 CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C4 CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C5 CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
C6 CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
**************************************************
C1 CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C2 CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C3 CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C4 CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C5 CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
C6 CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
**************************************************
C1 GGCTCCGGAGGTGCTG---------------------------
C2 GGCTCCGGAGGTGCTG---------------------------
C3 GGCTCCGGAGGTGCTG---------------------------
C4 GGCTCCGGAGGTGCTG---------------------------
C5 GGCTCCGGAGGTGCTG---------------------------
C6 GGCTCCGGAGGTGCTG---------------------------
****************
>C1
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C2
---------------------------GTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C3
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C4
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C5
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C6
GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA
GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA
GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC
AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA
AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG
CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG
CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT
GGCTCCGGAGGTGCTG---------------------------
>C1
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C2
oooooooooVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C3
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C4
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C5
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
>C6
VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 393 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790201
Setting output file names to "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 51113878
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0781097559
Seed = 1908335200
Swapseed = 1579790201
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 8 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -816.552464 -- -24.965149
Chain 2 -- -816.555980 -- -24.965149
Chain 3 -- -816.555980 -- -24.965149
Chain 4 -- -816.556261 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -816.555980 -- -24.965149
Chain 2 -- -816.556214 -- -24.965149
Chain 3 -- -816.555980 -- -24.965149
Chain 4 -- -816.556215 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-816.552] (-816.556) (-816.556) (-816.556) * [-816.556] (-816.556) (-816.556) (-816.556)
500 -- (-512.335) (-511.797) (-514.563) [-509.010] * (-514.429) [-510.585] (-520.157) (-510.459) -- 0:00:00
1000 -- (-509.979) [-517.547] (-517.774) (-513.725) * (-517.448) [-507.618] (-505.561) (-515.681) -- 0:00:00
1500 -- (-508.588) (-517.229) [-515.537] (-508.742) * [-508.685] (-519.316) (-509.638) (-517.497) -- 0:00:00
2000 -- [-511.380] (-515.108) (-507.891) (-510.804) * [-507.773] (-519.024) (-508.971) (-525.060) -- 0:00:00
2500 -- (-510.737) (-509.194) (-519.403) [-515.592] * [-509.640] (-523.088) (-510.741) (-508.540) -- 0:00:00
3000 -- (-519.819) [-509.961] (-512.376) (-514.814) * (-506.980) (-511.562) (-512.056) [-506.665] -- 0:00:00
3500 -- (-508.863) [-511.295] (-519.118) (-519.659) * (-510.347) [-508.963] (-513.384) (-508.591) -- 0:00:00
4000 -- [-507.657] (-517.422) (-514.986) (-512.681) * [-506.956] (-512.593) (-511.875) (-512.476) -- 0:00:00
4500 -- (-510.522) (-512.481) (-511.431) [-507.296] * [-506.544] (-510.938) (-507.070) (-510.735) -- 0:00:00
5000 -- (-509.871) [-508.770] (-514.486) (-514.762) * [-512.796] (-508.481) (-519.619) (-513.196) -- 0:00:00
Average standard deviation of split frequencies: 0.100566
5500 -- (-509.717) [-512.023] (-506.354) (-512.446) * (-517.583) (-515.538) [-512.534] (-520.514) -- 0:00:00
6000 -- [-506.673] (-511.253) (-511.603) (-514.684) * (-516.032) (-517.330) (-521.601) [-510.979] -- 0:02:45
6500 -- (-513.799) (-511.309) (-508.214) [-514.209] * (-514.684) (-511.743) [-512.929] (-513.782) -- 0:02:32
7000 -- (-507.987) [-509.704] (-510.889) (-519.630) * (-517.100) (-507.186) [-511.162] (-510.134) -- 0:02:21
7500 -- [-512.230] (-513.565) (-511.274) (-510.454) * [-509.286] (-513.541) (-512.581) (-513.462) -- 0:02:12
8000 -- (-511.330) [-512.092] (-513.731) (-511.625) * [-509.758] (-523.365) (-513.282) (-517.981) -- 0:02:04
8500 -- [-505.387] (-507.444) (-512.866) (-515.786) * [-510.231] (-521.710) (-513.885) (-508.176) -- 0:01:56
9000 -- (-507.254) (-517.217) [-513.837] (-517.089) * (-516.259) [-514.337] (-515.187) (-508.547) -- 0:01:50
9500 -- (-508.041) (-509.613) [-510.521] (-511.958) * (-511.626) (-510.846) (-510.863) [-516.473] -- 0:01:44
10000 -- [-510.349] (-515.101) (-510.530) (-516.081) * (-510.586) [-513.571] (-522.657) (-510.355) -- 0:01:39
Average standard deviation of split frequencies: 0.073657
10500 -- (-507.369) [-510.279] (-507.419) (-512.168) * (-511.886) (-516.901) [-511.693] (-511.787) -- 0:01:34
11000 -- [-513.291] (-513.774) (-510.246) (-507.624) * (-518.325) [-509.770] (-511.557) (-507.572) -- 0:01:29
11500 -- [-515.150] (-509.038) (-516.640) (-512.916) * (-515.256) (-507.647) [-509.269] (-521.542) -- 0:01:25
12000 -- (-509.828) (-512.893) (-529.334) [-508.168] * (-516.039) (-509.480) [-504.290] (-516.220) -- 0:01:22
12500 -- (-512.535) (-514.703) (-514.259) [-508.031] * (-518.340) [-512.466] (-500.315) (-515.346) -- 0:01:19
13000 -- [-509.747] (-513.136) (-515.238) (-509.398) * (-516.923) (-510.345) [-500.835] (-521.399) -- 0:01:15
13500 -- (-513.439) [-510.252] (-511.054) (-510.583) * (-510.131) (-515.785) [-501.301] (-503.908) -- 0:01:13
14000 -- (-514.185) (-522.038) (-515.408) [-512.928] * (-516.619) (-514.234) (-503.930) [-506.236] -- 0:01:10
14500 -- (-511.241) (-513.494) [-506.785] (-512.396) * (-519.784) (-518.404) (-501.734) [-503.808] -- 0:01:07
15000 -- (-517.175) (-512.848) (-512.087) [-516.366] * (-512.014) (-509.740) [-503.298] (-502.482) -- 0:01:05
Average standard deviation of split frequencies: 0.051172
15500 -- [-510.178] (-511.550) (-509.961) (-514.747) * [-508.814] (-519.944) (-503.560) (-502.956) -- 0:01:03
16000 -- (-525.112) [-507.656] (-521.953) (-510.420) * (-513.121) (-510.084) [-501.139] (-505.780) -- 0:01:01
16500 -- (-516.974) (-516.383) [-511.475] (-511.056) * [-516.161] (-510.465) (-502.680) (-503.996) -- 0:00:59
17000 -- (-515.624) (-503.590) (-509.995) [-511.027] * (-508.051) (-513.938) (-500.346) [-502.828] -- 0:00:57
17500 -- (-508.344) (-509.104) (-522.015) [-509.912] * (-514.115) (-511.165) [-501.296] (-503.854) -- 0:00:56
18000 -- [-501.702] (-515.696) (-511.726) (-517.889) * [-513.542] (-511.829) (-503.825) (-507.951) -- 0:00:54
18500 -- (-503.047) [-508.890] (-518.999) (-512.415) * (-521.310) (-512.877) [-502.695] (-502.709) -- 0:01:46
19000 -- (-502.869) [-510.317] (-511.730) (-508.627) * (-510.642) (-511.370) [-501.753] (-506.018) -- 0:01:43
19500 -- (-503.284) [-513.733] (-506.391) (-509.295) * [-508.889] (-511.380) (-504.513) (-503.258) -- 0:01:40
20000 -- (-502.919) [-506.643] (-507.628) (-507.141) * [-504.783] (-508.521) (-504.327) (-501.668) -- 0:01:38
Average standard deviation of split frequencies: 0.038417
20500 -- (-502.328) (-516.726) [-506.305] (-509.460) * (-510.111) (-513.797) [-501.599] (-501.273) -- 0:01:35
21000 -- [-501.875] (-511.877) (-522.001) (-514.837) * [-510.438] (-510.879) (-501.353) (-502.533) -- 0:01:33
21500 -- (-501.703) (-511.568) [-513.913] (-511.888) * (-516.505) (-513.148) (-502.946) [-502.440] -- 0:01:31
22000 -- (-504.289) [-501.686] (-514.639) (-510.046) * (-510.569) [-507.229] (-503.456) (-502.779) -- 0:01:28
22500 -- (-502.908) [-502.532] (-511.922) (-515.993) * (-520.294) (-509.803) [-503.697] (-507.755) -- 0:01:26
23000 -- (-501.869) [-500.732] (-509.192) (-516.208) * (-519.403) (-511.455) [-503.825] (-501.899) -- 0:01:24
23500 -- [-502.659] (-502.797) (-505.310) (-514.136) * (-509.358) (-509.294) (-501.549) [-502.038] -- 0:01:23
24000 -- (-507.899) [-502.794] (-508.160) (-519.022) * (-521.681) (-514.643) (-500.744) [-504.743] -- 0:01:21
24500 -- (-501.707) (-502.184) [-511.641] (-513.582) * (-526.990) (-515.783) [-503.242] (-504.419) -- 0:01:19
25000 -- [-504.724] (-502.817) (-521.216) (-514.765) * [-514.787] (-515.530) (-507.170) (-506.297) -- 0:01:18
Average standard deviation of split frequencies: 0.038982
25500 -- [-503.315] (-504.233) (-509.530) (-510.761) * (-521.486) (-507.550) [-501.135] (-504.501) -- 0:01:16
26000 -- [-502.222] (-502.759) (-513.394) (-510.457) * (-508.942) [-509.228] (-503.096) (-501.971) -- 0:01:14
26500 -- (-502.583) [-502.740] (-510.238) (-515.951) * (-525.219) [-508.886] (-503.398) (-502.885) -- 0:01:13
27000 -- (-503.946) [-501.739] (-514.292) (-512.068) * (-508.125) [-508.812] (-504.281) (-501.023) -- 0:01:12
27500 -- [-502.973] (-502.854) (-511.923) (-509.215) * (-508.233) (-510.722) [-505.672] (-501.948) -- 0:01:10
28000 -- (-502.846) [-502.243] (-511.829) (-509.255) * (-504.003) (-513.621) (-507.593) [-500.650] -- 0:01:09
28500 -- (-501.651) [-504.685] (-510.914) (-506.138) * (-502.253) (-512.042) [-502.760] (-501.405) -- 0:01:08
29000 -- (-504.068) (-505.603) [-511.000] (-507.692) * (-502.701) [-506.305] (-502.686) (-506.566) -- 0:01:06
29500 -- [-503.088] (-507.190) (-513.217) (-512.015) * [-506.392] (-508.826) (-501.634) (-501.817) -- 0:01:05
30000 -- (-505.075) (-512.730) [-511.607] (-512.098) * [-500.976] (-506.305) (-501.301) (-501.797) -- 0:01:04
Average standard deviation of split frequencies: 0.041504
30500 -- (-503.382) (-504.430) [-508.749] (-507.336) * (-504.590) [-508.574] (-501.024) (-503.041) -- 0:01:03
31000 -- (-503.387) (-503.879) [-509.133] (-521.583) * (-504.245) (-509.881) [-502.374] (-500.796) -- 0:01:33
31500 -- (-501.723) (-503.579) [-511.497] (-512.043) * (-504.066) (-512.521) (-501.644) [-503.866] -- 0:01:32
32000 -- (-501.605) [-504.200] (-509.149) (-512.236) * (-506.500) (-507.232) [-501.081] (-503.997) -- 0:01:30
32500 -- [-502.331] (-505.078) (-508.827) (-506.716) * (-505.876) [-510.276] (-502.641) (-501.575) -- 0:01:29
33000 -- (-500.808) [-503.086] (-512.007) (-509.640) * [-501.852] (-512.319) (-501.667) (-504.013) -- 0:01:27
33500 -- [-500.626] (-502.151) (-517.228) (-519.014) * (-505.515) [-508.533] (-501.842) (-503.147) -- 0:01:26
34000 -- (-503.154) (-503.385) [-515.589] (-504.541) * (-502.221) (-514.665) [-504.711] (-502.241) -- 0:01:25
34500 -- (-503.431) [-501.707] (-513.377) (-504.687) * (-501.224) (-513.246) (-501.396) [-505.894] -- 0:01:23
35000 -- (-501.061) (-501.788) (-507.291) [-502.816] * (-502.406) [-506.123] (-500.921) (-502.593) -- 0:01:22
Average standard deviation of split frequencies: 0.048637
35500 -- (-501.908) (-501.783) [-512.287] (-503.643) * (-501.300) (-513.872) (-503.089) [-500.462] -- 0:01:21
36000 -- [-502.249] (-503.703) (-516.685) (-502.465) * (-502.453) [-512.286] (-504.765) (-503.517) -- 0:01:20
36500 -- (-502.162) (-501.757) (-512.481) [-504.068] * [-502.607] (-506.371) (-502.245) (-503.458) -- 0:01:19
37000 -- (-504.157) (-505.715) [-510.557] (-501.813) * [-504.296] (-516.529) (-505.298) (-502.552) -- 0:01:18
37500 -- (-502.407) [-501.848] (-517.300) (-502.859) * (-509.170) (-511.798) [-502.108] (-503.848) -- 0:01:17
38000 -- (-501.146) (-503.497) [-506.149] (-501.864) * [-506.540] (-512.766) (-502.447) (-501.836) -- 0:01:15
38500 -- (-503.866) (-502.242) (-513.492) [-503.252] * [-502.750] (-514.262) (-504.273) (-502.545) -- 0:01:14
39000 -- (-503.538) [-501.936] (-516.882) (-502.746) * (-503.746) (-518.424) (-504.731) [-503.632] -- 0:01:13
39500 -- [-501.941] (-500.800) (-507.036) (-502.395) * (-502.061) [-512.975] (-509.075) (-501.838) -- 0:01:12
40000 -- (-505.607) [-502.155] (-526.811) (-503.634) * (-503.117) (-511.097) (-507.387) [-501.771] -- 0:01:12
Average standard deviation of split frequencies: 0.046368
40500 -- (-501.567) (-502.680) [-510.231] (-505.632) * (-511.125) (-509.645) (-503.091) [-503.619] -- 0:01:11
41000 -- (-501.107) [-502.809] (-509.607) (-504.287) * (-505.939) [-511.713] (-503.699) (-504.973) -- 0:01:10
41500 -- (-502.372) (-502.069) [-510.754] (-503.372) * [-503.903] (-516.239) (-501.663) (-502.695) -- 0:01:09
42000 -- (-504.673) [-502.758] (-508.350) (-503.351) * (-504.695) (-512.882) (-502.737) [-504.449] -- 0:01:08
42500 -- (-502.250) [-504.089] (-513.831) (-503.728) * [-506.801] (-519.890) (-501.377) (-502.834) -- 0:01:07
43000 -- (-501.430) (-507.243) (-515.832) [-501.479] * (-502.567) (-501.298) [-503.592] (-501.306) -- 0:01:06
43500 -- (-510.582) (-501.352) [-513.544] (-500.443) * (-502.360) [-502.746] (-500.480) (-505.395) -- 0:01:05
44000 -- (-507.575) [-503.454] (-509.056) (-500.694) * [-504.983] (-503.724) (-501.395) (-502.451) -- 0:01:26
44500 -- [-503.764] (-506.131) (-512.300) (-500.719) * (-503.943) (-505.126) (-500.730) [-505.875] -- 0:01:25
45000 -- [-502.697] (-505.529) (-512.312) (-501.517) * (-506.199) [-500.932] (-501.961) (-505.425) -- 0:01:24
Average standard deviation of split frequencies: 0.042529
45500 -- (-503.979) (-502.576) (-506.580) [-500.902] * (-505.146) (-503.245) (-503.740) [-501.008] -- 0:01:23
46000 -- [-503.492] (-502.691) (-512.519) (-501.331) * (-502.968) (-504.526) [-503.863] (-504.618) -- 0:01:22
46500 -- (-509.235) (-501.757) (-512.385) [-502.013] * (-503.040) (-501.519) (-502.064) [-500.440] -- 0:01:22
47000 -- (-501.455) (-504.870) [-507.505] (-503.372) * (-500.566) [-501.932] (-500.870) (-508.020) -- 0:01:21
47500 -- [-502.372] (-505.790) (-512.779) (-504.028) * (-500.853) [-500.884] (-502.102) (-503.036) -- 0:01:20
48000 -- [-503.024] (-500.502) (-512.424) (-501.951) * (-501.500) (-501.787) (-505.542) [-502.492] -- 0:01:19
48500 -- (-501.323) (-502.722) (-504.307) [-502.817] * (-502.901) (-503.409) (-504.235) [-501.237] -- 0:01:18
49000 -- (-503.348) (-502.151) (-502.497) [-502.653] * (-502.472) (-503.906) (-502.781) [-500.953] -- 0:01:17
49500 -- (-503.914) (-501.586) (-501.501) [-504.570] * (-503.181) [-501.163] (-501.013) (-506.072) -- 0:01:16
50000 -- (-503.293) [-500.292] (-503.515) (-502.815) * (-502.559) (-502.279) (-501.261) [-501.149] -- 0:01:16
Average standard deviation of split frequencies: 0.041134
50500 -- (-503.250) (-501.908) [-503.257] (-504.135) * (-502.742) [-503.769] (-502.396) (-502.711) -- 0:01:15
51000 -- [-501.558] (-501.094) (-501.927) (-503.460) * [-501.392] (-501.861) (-501.755) (-501.978) -- 0:01:14
51500 -- (-504.413) (-503.840) (-501.408) [-503.195] * [-502.559] (-501.011) (-503.730) (-503.184) -- 0:01:13
52000 -- [-503.517] (-503.524) (-502.515) (-502.634) * (-501.213) [-502.596] (-504.602) (-504.823) -- 0:01:12
52500 -- (-502.498) [-503.294] (-501.197) (-503.856) * (-503.189) [-501.973] (-503.238) (-504.652) -- 0:01:12
53000 -- [-504.925] (-502.106) (-502.174) (-501.456) * [-501.188] (-501.827) (-503.759) (-503.839) -- 0:01:11
53500 -- [-500.687] (-502.042) (-503.579) (-502.986) * (-507.575) [-504.055] (-504.525) (-501.936) -- 0:01:10
54000 -- (-501.676) [-503.617] (-504.850) (-501.181) * (-516.082) (-505.036) [-502.531] (-501.916) -- 0:01:10
54500 -- (-505.672) (-504.144) (-502.649) [-502.014] * [-503.036] (-501.499) (-504.559) (-502.916) -- 0:01:09
55000 -- [-501.988] (-501.114) (-504.605) (-502.941) * (-503.909) (-502.802) (-500.701) [-502.138] -- 0:01:08
Average standard deviation of split frequencies: 0.044305
55500 -- (-506.830) (-501.008) [-501.128] (-506.210) * [-502.453] (-503.816) (-502.180) (-502.320) -- 0:01:08
56000 -- (-503.158) [-501.588] (-506.250) (-501.187) * (-505.276) (-504.139) [-504.397] (-503.089) -- 0:01:07
56500 -- (-502.172) (-501.658) [-500.652] (-501.381) * (-502.574) (-505.137) [-500.599] (-504.417) -- 0:01:06
57000 -- [-502.974] (-502.079) (-500.941) (-503.119) * (-504.178) [-501.198] (-501.205) (-501.556) -- 0:01:22
57500 -- (-503.614) (-502.370) [-501.727] (-502.147) * [-502.021] (-503.269) (-501.530) (-503.130) -- 0:01:21
58000 -- [-502.477] (-501.788) (-501.948) (-503.952) * [-504.253] (-501.473) (-500.754) (-501.141) -- 0:01:21
58500 -- [-502.655] (-500.972) (-505.324) (-502.736) * [-502.004] (-502.827) (-502.264) (-502.642) -- 0:01:20
59000 -- [-502.907] (-501.063) (-502.321) (-502.632) * (-502.562) (-503.617) (-502.947) [-501.988] -- 0:01:19
59500 -- (-502.239) [-501.087] (-501.678) (-501.564) * (-502.278) (-504.018) [-503.716] (-503.143) -- 0:01:19
60000 -- [-502.152] (-503.048) (-501.755) (-503.094) * (-500.748) [-502.362] (-505.121) (-503.314) -- 0:01:18
Average standard deviation of split frequencies: 0.035171
60500 -- (-501.261) [-503.519] (-503.685) (-503.891) * (-504.354) [-504.978] (-502.114) (-502.305) -- 0:01:17
61000 -- (-505.999) (-507.359) (-507.400) [-503.446] * (-501.359) (-505.829) [-504.496] (-503.828) -- 0:01:16
61500 -- (-502.853) (-506.199) (-504.212) [-501.782] * (-502.854) (-503.400) (-504.177) [-506.054] -- 0:01:16
62000 -- (-502.057) (-505.824) (-505.209) [-503.051] * (-502.612) [-501.683] (-501.433) (-507.453) -- 0:01:15
62500 -- (-502.116) [-501.748] (-501.184) (-504.172) * [-502.441] (-501.338) (-502.972) (-505.758) -- 0:01:15
63000 -- (-504.661) (-506.665) [-501.176] (-501.832) * [-500.613] (-506.843) (-502.481) (-505.735) -- 0:01:14
63500 -- [-502.099] (-500.825) (-501.524) (-502.949) * (-501.620) (-503.165) (-503.955) [-501.199] -- 0:01:13
64000 -- (-501.043) (-503.274) [-500.945] (-510.678) * (-502.284) (-501.271) (-502.695) [-502.322] -- 0:01:13
64500 -- (-501.351) [-502.961] (-503.227) (-502.267) * (-502.998) [-501.382] (-504.455) (-502.108) -- 0:01:12
65000 -- (-500.910) (-502.218) [-509.412] (-501.960) * (-503.884) [-501.513] (-503.064) (-502.003) -- 0:01:11
Average standard deviation of split frequencies: 0.030074
65500 -- (-501.320) [-502.203] (-506.458) (-504.622) * [-505.360] (-501.970) (-503.791) (-501.188) -- 0:01:11
66000 -- [-501.483] (-502.519) (-508.027) (-501.793) * [-503.359] (-507.703) (-502.042) (-503.136) -- 0:01:10
66500 -- [-502.545] (-501.352) (-501.553) (-502.793) * [-501.596] (-501.860) (-501.344) (-501.503) -- 0:01:10
67000 -- (-501.670) (-504.095) [-503.347] (-501.867) * (-502.239) [-501.129] (-503.077) (-502.747) -- 0:01:09
67500 -- [-501.889] (-501.512) (-504.001) (-507.295) * [-501.695] (-503.841) (-501.767) (-503.234) -- 0:01:09
68000 -- [-501.859] (-501.310) (-501.202) (-506.848) * (-500.382) [-504.729] (-501.200) (-504.537) -- 0:01:08
68500 -- (-503.762) (-502.131) (-505.979) [-504.288] * [-501.866] (-502.748) (-504.069) (-501.463) -- 0:01:07
69000 -- (-501.948) (-503.365) [-502.852] (-503.552) * (-504.381) (-501.067) (-503.277) [-502.304] -- 0:01:07
69500 -- (-502.547) [-501.763] (-502.950) (-503.621) * [-503.920] (-501.564) (-502.769) (-504.301) -- 0:01:20
70000 -- [-500.838] (-501.445) (-501.281) (-503.813) * (-502.156) (-501.795) [-504.466] (-502.157) -- 0:01:19
Average standard deviation of split frequencies: 0.031019
70500 -- [-502.315] (-504.301) (-501.249) (-504.925) * [-501.365] (-501.993) (-501.315) (-502.584) -- 0:01:19
71000 -- [-501.622] (-502.548) (-500.677) (-502.611) * (-504.473) [-501.223] (-500.450) (-501.892) -- 0:01:18
71500 -- [-501.805] (-502.014) (-501.937) (-505.486) * [-505.596] (-503.108) (-501.317) (-501.765) -- 0:01:17
72000 -- (-502.540) (-503.414) [-501.116] (-502.445) * [-502.299] (-501.329) (-503.763) (-504.228) -- 0:01:17
72500 -- [-501.479] (-501.636) (-506.247) (-503.824) * [-501.734] (-500.733) (-501.398) (-502.056) -- 0:01:16
73000 -- (-502.295) [-506.046] (-501.637) (-502.872) * (-503.381) (-505.200) (-501.251) [-502.108] -- 0:01:16
73500 -- (-503.986) [-501.663] (-501.798) (-502.680) * (-502.173) (-503.759) (-502.461) [-502.932] -- 0:01:15
74000 -- [-503.053] (-501.399) (-503.141) (-503.838) * [-505.392] (-503.798) (-506.631) (-502.797) -- 0:01:15
74500 -- (-504.058) [-502.067] (-502.756) (-501.703) * (-503.916) (-502.906) [-501.982] (-503.937) -- 0:01:14
75000 -- (-505.287) (-507.102) (-501.157) [-504.661] * (-501.356) (-501.920) [-504.068] (-502.170) -- 0:01:14
Average standard deviation of split frequencies: 0.026117
75500 -- (-500.987) (-503.694) [-501.162] (-501.961) * (-504.572) (-502.098) (-503.207) [-502.670] -- 0:01:13
76000 -- (-502.777) (-500.985) (-501.930) [-502.108] * (-501.108) (-501.984) (-502.913) [-504.381] -- 0:01:12
76500 -- (-502.742) [-502.245] (-505.779) (-501.191) * [-501.990] (-503.725) (-505.234) (-503.431) -- 0:01:12
77000 -- (-503.812) (-503.668) [-504.580] (-502.355) * [-503.280] (-505.234) (-503.658) (-504.463) -- 0:01:11
77500 -- (-501.723) (-505.407) (-503.825) [-507.084] * [-500.886] (-504.291) (-502.623) (-503.592) -- 0:01:11
78000 -- (-502.124) [-502.053] (-508.283) (-501.913) * (-504.522) [-502.332] (-507.764) (-501.767) -- 0:01:10
78500 -- [-503.110] (-501.607) (-502.382) (-505.180) * (-502.644) [-502.697] (-504.724) (-500.951) -- 0:01:10
79000 -- [-503.747] (-501.155) (-501.825) (-506.276) * (-502.666) (-504.795) [-502.231] (-500.859) -- 0:01:09
79500 -- [-502.731] (-501.632) (-505.631) (-506.854) * (-505.497) (-503.898) [-502.001] (-504.268) -- 0:01:09
80000 -- (-503.282) (-501.553) (-504.903) [-503.224] * (-503.440) (-501.815) (-500.483) [-501.903] -- 0:01:09
Average standard deviation of split frequencies: 0.028876
80500 -- (-503.658) (-502.710) (-508.664) [-501.283] * [-507.205] (-501.572) (-501.000) (-502.153) -- 0:01:08
81000 -- [-502.507] (-505.578) (-503.326) (-506.535) * [-503.950] (-501.345) (-505.890) (-504.058) -- 0:01:08
81500 -- (-505.470) (-507.275) [-502.460] (-503.027) * [-501.072] (-502.898) (-502.514) (-503.150) -- 0:01:07
82000 -- [-502.643] (-504.741) (-502.056) (-502.245) * (-502.570) (-503.343) (-501.764) [-501.542] -- 0:01:18
82500 -- (-504.855) (-505.037) [-501.454] (-500.674) * (-502.365) [-501.052] (-502.880) (-505.327) -- 0:01:17
83000 -- (-503.928) [-501.275] (-503.675) (-503.608) * (-500.925) (-501.555) [-504.402] (-507.106) -- 0:01:17
83500 -- (-501.019) (-501.078) (-501.639) [-501.310] * (-504.812) [-501.460] (-502.313) (-506.858) -- 0:01:16
84000 -- (-503.209) [-502.115] (-505.993) (-508.548) * (-502.069) [-502.557] (-502.793) (-504.268) -- 0:01:16
84500 -- (-503.732) (-503.787) (-501.893) [-502.663] * (-505.797) (-501.092) [-503.062] (-501.633) -- 0:01:15
85000 -- (-501.627) [-503.772] (-503.281) (-501.265) * (-501.668) (-507.186) [-501.328] (-504.126) -- 0:01:15
Average standard deviation of split frequencies: 0.025319
85500 -- (-501.510) (-501.635) (-502.900) [-501.678] * (-500.832) [-502.505] (-503.942) (-504.259) -- 0:01:14
86000 -- (-501.182) (-506.259) [-502.206] (-500.549) * (-502.018) (-502.192) (-501.597) [-503.214] -- 0:01:14
86500 -- [-501.994] (-502.335) (-501.402) (-503.142) * (-502.299) (-502.476) [-501.627] (-503.627) -- 0:01:13
87000 -- (-500.995) (-503.103) (-502.368) [-502.688] * (-504.350) (-514.124) [-500.828] (-506.359) -- 0:01:13
87500 -- (-501.321) (-505.467) [-500.621] (-501.608) * (-501.743) (-504.711) [-504.935] (-501.367) -- 0:01:13
88000 -- [-503.727] (-503.355) (-501.350) (-506.074) * (-503.695) [-501.741] (-501.702) (-502.347) -- 0:01:12
88500 -- (-502.480) (-504.562) [-501.657] (-502.438) * (-501.080) (-501.643) [-502.091] (-502.320) -- 0:01:12
89000 -- [-503.279] (-502.736) (-502.062) (-502.089) * (-502.219) (-501.759) (-501.938) [-501.756] -- 0:01:11
89500 -- [-502.039] (-507.750) (-502.942) (-505.908) * [-502.256] (-502.715) (-503.072) (-502.266) -- 0:01:11
90000 -- [-501.440] (-501.087) (-503.255) (-503.658) * (-501.423) [-502.632] (-506.053) (-501.617) -- 0:01:10
Average standard deviation of split frequencies: 0.023026
90500 -- (-501.886) (-504.219) [-502.017] (-501.599) * (-501.477) [-503.731] (-505.458) (-501.120) -- 0:01:10
91000 -- (-503.514) [-502.440] (-503.649) (-502.256) * (-506.253) (-507.840) [-502.661] (-500.378) -- 0:01:09
91500 -- (-505.228) (-501.139) (-505.713) [-501.549] * (-502.024) (-501.280) [-505.829] (-503.286) -- 0:01:09
92000 -- (-500.779) (-502.781) (-503.125) [-500.979] * [-500.976] (-502.826) (-501.414) (-502.654) -- 0:01:09
92500 -- [-501.665] (-501.978) (-502.139) (-502.379) * [-503.253] (-500.809) (-501.278) (-501.991) -- 0:01:08
93000 -- [-501.818] (-504.504) (-502.124) (-500.788) * (-504.285) (-501.360) [-502.731] (-504.538) -- 0:01:08
93500 -- (-501.887) (-502.302) [-503.946] (-502.259) * [-502.982] (-502.946) (-504.385) (-503.133) -- 0:01:07
94000 -- (-501.083) (-501.907) [-501.893] (-505.756) * [-501.069] (-504.097) (-504.043) (-504.710) -- 0:01:07
94500 -- (-502.074) (-504.395) (-502.386) [-501.252] * (-502.572) (-504.188) [-503.322] (-503.802) -- 0:01:07
95000 -- [-502.898] (-502.769) (-501.774) (-505.146) * (-502.697) (-506.217) [-501.340] (-501.625) -- 0:01:16
Average standard deviation of split frequencies: 0.022743
95500 -- (-501.308) (-500.968) [-502.589] (-506.063) * [-504.008] (-504.102) (-501.680) (-504.493) -- 0:01:15
96000 -- (-504.493) [-502.948] (-501.411) (-500.968) * (-502.551) [-503.360] (-502.768) (-503.469) -- 0:01:15
96500 -- (-503.540) (-502.397) (-504.486) [-501.016] * (-502.867) [-502.425] (-503.975) (-503.990) -- 0:01:14
97000 -- (-502.555) (-502.504) [-501.990] (-501.146) * [-503.349] (-505.101) (-503.958) (-502.401) -- 0:01:14
97500 -- [-501.535] (-501.159) (-502.642) (-505.825) * [-502.518] (-505.497) (-502.970) (-503.700) -- 0:01:14
98000 -- [-508.468] (-505.584) (-504.402) (-505.240) * (-501.670) [-501.107] (-502.154) (-502.205) -- 0:01:13
98500 -- (-501.597) [-501.266] (-501.920) (-505.926) * (-500.646) [-502.813] (-501.480) (-502.018) -- 0:01:13
99000 -- (-504.963) (-500.758) (-501.555) [-501.777] * (-501.980) (-502.882) [-501.034] (-502.961) -- 0:01:12
99500 -- (-502.749) (-501.733) (-505.084) [-503.003] * (-500.453) (-505.475) (-502.958) [-500.886] -- 0:01:12
100000 -- (-504.586) [-501.900] (-503.900) (-505.765) * [-501.850] (-502.479) (-500.872) (-502.008) -- 0:01:12
Average standard deviation of split frequencies: 0.021935
100500 -- [-503.524] (-501.573) (-502.429) (-507.219) * (-502.884) [-501.035] (-501.211) (-502.097) -- 0:01:11
101000 -- [-505.111] (-500.539) (-504.528) (-503.143) * (-500.635) (-503.752) (-504.100) [-500.458] -- 0:01:11
101500 -- [-503.288] (-502.951) (-501.858) (-501.774) * (-501.326) (-504.407) (-506.059) [-503.951] -- 0:01:10
102000 -- (-503.209) (-503.112) [-511.715] (-503.299) * (-500.561) (-501.451) (-505.323) [-502.945] -- 0:01:10
102500 -- (-501.354) (-501.699) (-508.104) [-502.886] * (-505.754) (-502.857) (-501.039) [-501.781] -- 0:01:10
103000 -- (-502.790) (-502.396) (-503.144) [-503.428] * (-505.785) [-502.619] (-506.130) (-502.026) -- 0:01:09
103500 -- (-504.894) (-503.807) [-501.543] (-504.123) * (-503.398) (-501.455) (-506.283) [-501.507] -- 0:01:09
104000 -- (-504.817) [-502.247] (-504.876) (-507.119) * (-502.324) (-503.288) [-501.970] (-501.636) -- 0:01:08
104500 -- [-505.064] (-502.527) (-503.710) (-501.631) * (-501.434) (-503.240) (-501.260) [-502.810] -- 0:01:08
105000 -- [-501.419] (-503.885) (-501.730) (-504.518) * (-503.147) (-507.007) (-503.066) [-502.321] -- 0:01:08
Average standard deviation of split frequencies: 0.021768
105500 -- (-500.617) [-503.020] (-502.770) (-503.399) * [-508.718] (-503.746) (-502.452) (-500.989) -- 0:01:07
106000 -- (-500.567) [-503.718] (-505.105) (-505.080) * (-501.526) [-501.292] (-504.936) (-504.221) -- 0:01:07
106500 -- (-502.181) [-504.407] (-503.166) (-505.678) * (-502.440) (-500.911) [-504.634] (-502.693) -- 0:01:07
107000 -- (-502.983) (-504.112) (-505.016) [-504.150] * (-501.781) (-501.010) [-506.071] (-500.516) -- 0:01:06
107500 -- (-501.193) (-501.589) [-503.532] (-502.812) * [-502.498] (-502.055) (-501.753) (-501.596) -- 0:01:14
108000 -- (-502.928) (-503.530) [-502.434] (-504.013) * (-501.722) (-502.707) [-506.690] (-504.584) -- 0:01:14
108500 -- (-502.415) (-502.555) [-503.247] (-502.293) * (-501.751) (-502.885) (-505.904) [-502.037] -- 0:01:13
109000 -- (-502.417) (-503.659) [-502.098] (-503.307) * [-502.041] (-503.691) (-504.684) (-502.622) -- 0:01:13
109500 -- (-502.185) [-502.715] (-509.151) (-504.189) * (-502.923) [-501.628] (-506.007) (-501.749) -- 0:01:13
110000 -- (-503.841) (-501.335) [-505.232] (-504.025) * (-503.188) [-503.942] (-502.185) (-502.851) -- 0:01:12
Average standard deviation of split frequencies: 0.018832
110500 -- (-504.085) (-500.854) (-504.869) [-502.242] * (-500.686) (-502.309) (-503.099) [-505.000] -- 0:01:12
111000 -- (-505.187) (-502.340) [-507.188] (-502.031) * [-504.607] (-502.865) (-503.381) (-506.541) -- 0:01:12
111500 -- [-500.736] (-502.430) (-502.583) (-503.126) * (-502.208) [-501.952] (-502.879) (-502.413) -- 0:01:11
112000 -- (-501.584) (-507.975) [-503.958] (-502.133) * (-506.283) [-501.995] (-502.143) (-505.115) -- 0:01:11
112500 -- (-501.210) (-502.062) [-501.769] (-505.615) * (-503.851) (-504.705) (-503.133) [-503.404] -- 0:01:11
113000 -- (-501.576) (-502.013) [-502.073] (-503.508) * (-500.678) (-500.782) (-504.580) [-502.221] -- 0:01:10
113500 -- (-501.242) (-502.366) (-501.418) [-501.938] * (-503.066) (-500.813) [-504.184] (-500.836) -- 0:01:10
114000 -- [-502.421] (-505.914) (-502.344) (-501.512) * [-501.648] (-501.757) (-505.663) (-502.761) -- 0:01:09
114500 -- (-501.415) (-502.128) [-500.875] (-503.992) * (-504.210) [-502.239] (-505.444) (-504.225) -- 0:01:09
115000 -- (-502.766) (-502.340) [-501.593] (-501.300) * (-502.498) (-501.246) (-502.775) [-503.836] -- 0:01:09
Average standard deviation of split frequencies: 0.018608
115500 -- [-504.321] (-501.437) (-501.889) (-502.086) * (-501.745) [-502.157] (-503.534) (-505.010) -- 0:01:08
116000 -- (-504.643) (-504.745) [-502.411] (-502.242) * (-502.249) (-504.963) [-502.344] (-505.660) -- 0:01:08
116500 -- (-503.030) [-502.571] (-505.380) (-506.069) * (-504.290) (-503.470) [-502.190] (-502.898) -- 0:01:08
117000 -- [-504.922] (-506.353) (-503.213) (-503.313) * [-501.617] (-502.390) (-503.530) (-506.327) -- 0:01:07
117500 -- (-502.339) (-502.575) [-501.738] (-505.444) * [-503.665] (-501.539) (-502.900) (-504.372) -- 0:01:07
118000 -- (-502.390) (-503.003) [-503.026] (-502.003) * (-501.762) (-501.545) (-501.102) [-501.741] -- 0:01:07
118500 -- (-501.894) [-500.895] (-503.697) (-502.614) * [-501.793] (-502.690) (-501.126) (-501.477) -- 0:01:06
119000 -- (-504.382) (-501.925) [-502.008] (-506.396) * (-505.993) (-502.505) [-501.066] (-502.985) -- 0:01:06
119500 -- (-502.054) (-503.372) (-500.842) [-503.063] * (-501.315) (-503.921) [-501.789] (-502.433) -- 0:01:06
120000 -- (-503.077) (-503.345) [-502.718] (-503.452) * (-502.653) (-502.756) (-502.175) [-501.897] -- 0:01:06
Average standard deviation of split frequencies: 0.016449
120500 -- (-502.533) (-502.617) (-503.176) [-505.252] * [-500.498] (-506.247) (-502.370) (-503.358) -- 0:01:12
121000 -- (-503.689) (-508.640) [-502.022] (-503.936) * (-502.189) [-501.173] (-502.131) (-501.106) -- 0:01:12
121500 -- (-502.213) [-503.020] (-505.313) (-506.502) * (-502.628) (-502.052) [-501.802] (-504.992) -- 0:01:12
122000 -- (-502.085) (-503.812) [-502.745] (-510.037) * (-504.007) [-502.920] (-501.561) (-502.751) -- 0:01:11
122500 -- (-503.984) (-506.190) (-505.787) [-502.551] * (-501.789) (-501.805) [-505.105] (-501.524) -- 0:01:11
123000 -- (-502.968) [-501.108] (-509.736) (-504.043) * (-502.384) (-500.416) (-503.696) [-502.070] -- 0:01:11
123500 -- (-507.979) [-502.607] (-505.277) (-502.353) * (-505.746) (-502.446) (-503.671) [-501.912] -- 0:01:10
124000 -- [-502.144] (-502.771) (-503.698) (-501.002) * (-508.281) [-503.978] (-502.739) (-509.479) -- 0:01:10
124500 -- (-501.737) (-502.230) (-502.554) [-501.222] * (-504.291) (-503.728) (-503.480) [-504.041] -- 0:01:10
125000 -- (-502.995) (-503.041) [-504.589] (-504.136) * (-502.059) (-500.360) (-505.992) [-502.384] -- 0:01:10
Average standard deviation of split frequencies: 0.013390
125500 -- (-500.838) (-501.580) (-503.251) [-503.069] * (-503.437) [-503.953] (-505.520) (-501.256) -- 0:01:09
126000 -- [-502.287] (-504.013) (-503.841) (-501.332) * [-503.346] (-506.473) (-504.485) (-503.049) -- 0:01:09
126500 -- (-501.163) [-502.742] (-503.144) (-500.594) * (-502.001) [-505.224] (-506.780) (-501.857) -- 0:01:09
127000 -- (-503.510) (-504.789) (-503.667) [-501.111] * (-504.126) (-504.492) (-503.076) [-500.719] -- 0:01:08
127500 -- (-504.153) [-502.967] (-502.882) (-502.046) * [-501.830] (-504.076) (-504.308) (-501.076) -- 0:01:08
128000 -- [-502.386] (-500.999) (-501.029) (-501.431) * (-502.041) (-506.416) [-502.189] (-503.687) -- 0:01:08
128500 -- (-502.913) (-501.971) (-502.530) [-502.050] * (-501.159) (-501.895) (-502.324) [-502.232] -- 0:01:07
129000 -- (-501.581) [-502.413] (-503.438) (-502.489) * [-503.718] (-500.444) (-501.200) (-500.988) -- 0:01:07
129500 -- (-501.860) (-503.403) [-502.591] (-503.094) * (-503.733) (-501.492) [-501.984] (-502.193) -- 0:01:07
130000 -- [-501.796] (-504.279) (-506.964) (-506.151) * (-502.561) (-502.039) [-502.359] (-500.573) -- 0:01:06
Average standard deviation of split frequencies: 0.017437
130500 -- (-505.732) [-510.940] (-506.737) (-504.759) * (-503.035) [-501.700] (-505.196) (-506.459) -- 0:01:06
131000 -- (-505.105) [-502.300] (-508.558) (-501.150) * (-503.867) (-501.346) [-502.561] (-508.651) -- 0:01:06
131500 -- (-501.807) (-502.197) (-506.624) [-502.402] * (-504.224) [-503.283] (-501.487) (-508.839) -- 0:01:06
132000 -- (-503.776) (-501.792) [-503.091] (-502.248) * (-501.029) (-505.067) (-504.097) [-506.672] -- 0:01:05
132500 -- (-507.178) (-503.144) (-506.752) [-500.803] * (-500.921) [-503.013] (-502.869) (-503.161) -- 0:01:05
133000 -- (-509.200) [-503.631] (-504.010) (-507.704) * [-501.817] (-501.406) (-503.799) (-507.374) -- 0:01:11
133500 -- [-505.461] (-504.050) (-501.141) (-504.861) * [-503.554] (-504.168) (-509.259) (-507.352) -- 0:01:11
134000 -- (-504.100) [-501.333] (-505.396) (-501.486) * [-504.856] (-501.630) (-505.954) (-504.744) -- 0:01:11
134500 -- (-504.980) (-503.682) (-504.253) [-501.716] * (-501.981) (-501.176) (-502.953) [-505.798] -- 0:01:10
135000 -- (-501.437) [-502.032] (-502.343) (-503.221) * (-505.029) [-504.507] (-501.184) (-502.837) -- 0:01:10
Average standard deviation of split frequencies: 0.015791
135500 -- [-502.225] (-511.517) (-505.324) (-504.004) * (-503.111) [-502.931] (-502.204) (-502.329) -- 0:01:10
136000 -- (-502.774) (-506.718) [-506.089] (-500.902) * [-500.969] (-501.442) (-501.581) (-501.206) -- 0:01:09
136500 -- [-506.201] (-502.353) (-502.155) (-502.895) * [-504.862] (-504.941) (-500.458) (-502.019) -- 0:01:09
137000 -- (-503.701) (-507.517) (-504.886) [-500.758] * (-500.625) (-504.067) (-501.713) [-502.304] -- 0:01:09
137500 -- [-503.125] (-502.284) (-503.139) (-501.350) * (-503.553) (-504.670) [-500.835] (-502.623) -- 0:01:09
138000 -- (-504.091) (-503.588) (-503.419) [-501.978] * [-502.572] (-501.893) (-500.560) (-505.406) -- 0:01:08
138500 -- (-502.426) [-502.446] (-504.080) (-503.347) * (-500.449) [-501.097] (-507.229) (-505.288) -- 0:01:08
139000 -- (-502.151) [-504.419] (-503.996) (-504.475) * (-501.745) [-501.788] (-502.408) (-503.330) -- 0:01:08
139500 -- (-501.102) (-501.745) [-502.831] (-504.754) * (-504.457) [-501.250] (-502.817) (-503.862) -- 0:01:07
140000 -- (-502.812) (-502.522) [-501.938] (-503.336) * (-502.845) (-504.697) [-501.478] (-504.492) -- 0:01:07
Average standard deviation of split frequencies: 0.019176
140500 -- (-502.412) [-502.479] (-501.874) (-502.632) * (-504.729) (-509.856) (-507.569) [-502.232] -- 0:01:07
141000 -- (-501.743) (-502.620) [-503.450] (-503.480) * (-503.827) [-505.829] (-502.133) (-502.952) -- 0:01:07
141500 -- (-500.724) (-506.106) [-503.522] (-503.302) * (-501.656) (-501.597) [-501.018] (-501.209) -- 0:01:06
142000 -- [-502.897] (-504.749) (-504.823) (-502.257) * (-502.697) (-501.350) [-500.856] (-501.681) -- 0:01:06
142500 -- (-503.024) (-502.966) (-508.999) [-502.999] * (-502.189) (-501.891) (-502.094) [-501.818] -- 0:01:06
143000 -- (-504.409) [-501.872] (-504.809) (-502.021) * (-505.128) (-503.149) [-504.961] (-505.148) -- 0:01:05
143500 -- (-505.288) (-504.096) (-502.969) [-502.129] * (-501.713) (-502.519) (-510.088) [-503.172] -- 0:01:05
144000 -- (-506.883) (-503.815) (-503.605) [-501.609] * (-500.604) (-501.562) (-502.290) [-505.382] -- 0:01:05
144500 -- (-503.970) (-501.198) [-504.401] (-502.641) * [-500.919] (-501.904) (-505.168) (-503.100) -- 0:01:05
145000 -- (-505.787) (-502.631) [-504.923] (-504.056) * (-504.403) (-501.308) (-504.350) [-502.858] -- 0:01:04
Average standard deviation of split frequencies: 0.019373
145500 -- (-503.238) [-502.032] (-505.945) (-502.181) * [-504.556] (-502.408) (-505.339) (-503.251) -- 0:01:04
146000 -- [-501.960] (-502.881) (-505.033) (-502.302) * (-505.887) [-500.304] (-504.235) (-502.517) -- 0:01:10
146500 -- (-502.342) [-501.906] (-500.989) (-502.216) * (-502.003) [-500.875] (-502.014) (-501.171) -- 0:01:09
147000 -- [-500.542] (-502.958) (-502.824) (-501.899) * [-500.271] (-501.209) (-502.380) (-501.869) -- 0:01:09
147500 -- (-505.723) (-501.761) [-502.932] (-503.308) * (-502.424) (-503.363) (-500.981) [-502.684] -- 0:01:09
148000 -- (-504.298) (-503.533) (-501.035) [-501.947] * (-501.904) (-505.846) [-504.518] (-502.924) -- 0:01:09
148500 -- (-504.582) (-505.146) [-502.308] (-502.932) * [-502.828] (-503.493) (-505.695) (-507.874) -- 0:01:08
149000 -- (-502.723) (-503.583) (-503.256) [-503.056] * (-501.420) (-502.835) (-504.410) [-503.844] -- 0:01:08
149500 -- (-505.263) (-510.263) [-500.382] (-502.319) * (-501.502) (-504.793) [-501.555] (-502.767) -- 0:01:08
150000 -- (-504.596) (-504.915) (-504.799) [-501.797] * [-500.342] (-502.695) (-502.572) (-505.199) -- 0:01:08
Average standard deviation of split frequencies: 0.019468
150500 -- [-505.102] (-502.107) (-503.224) (-502.468) * (-501.133) (-502.581) [-505.607] (-506.470) -- 0:01:07
151000 -- [-501.490] (-501.923) (-500.751) (-508.101) * (-500.702) (-505.248) (-501.995) [-500.802] -- 0:01:07
151500 -- (-504.095) (-502.965) [-501.438] (-503.602) * (-501.229) (-503.106) (-507.193) [-502.448] -- 0:01:07
152000 -- (-503.282) (-503.646) [-501.412] (-502.913) * (-501.712) (-501.612) [-503.696] (-504.961) -- 0:01:06
152500 -- (-501.029) [-502.355] (-503.324) (-502.231) * (-502.012) (-501.543) [-503.267] (-503.985) -- 0:01:06
153000 -- [-501.954] (-501.243) (-502.671) (-500.832) * (-507.216) [-502.858] (-503.252) (-502.892) -- 0:01:06
153500 -- (-500.782) (-502.288) (-501.718) [-503.502] * (-503.967) (-505.043) [-503.928] (-506.507) -- 0:01:06
154000 -- (-502.973) [-501.994] (-501.062) (-503.694) * (-503.963) (-507.347) (-503.245) [-501.330] -- 0:01:05
154500 -- (-506.546) (-501.197) (-501.778) [-503.653] * (-501.446) [-502.819] (-501.567) (-504.008) -- 0:01:05
155000 -- (-505.070) (-502.776) [-504.794] (-502.176) * (-502.369) (-502.442) [-502.360] (-502.172) -- 0:01:05
Average standard deviation of split frequencies: 0.020481
155500 -- (-506.753) (-503.466) (-502.719) [-503.105] * (-505.828) [-507.239] (-502.425) (-504.042) -- 0:01:05
156000 -- [-500.851] (-502.937) (-502.087) (-507.310) * [-501.449] (-502.337) (-501.434) (-503.890) -- 0:01:04
156500 -- (-505.618) [-503.638] (-503.139) (-501.363) * (-501.477) [-500.771] (-501.491) (-501.445) -- 0:01:04
157000 -- (-501.242) (-504.221) [-500.969] (-502.192) * (-503.482) [-504.748] (-505.025) (-501.986) -- 0:01:04
157500 -- (-501.841) (-501.325) [-502.449] (-502.028) * (-503.045) (-503.908) [-501.141] (-502.411) -- 0:01:04
158000 -- (-500.574) (-505.223) [-504.952] (-503.870) * (-506.959) (-502.673) (-505.161) [-502.532] -- 0:01:03
158500 -- (-501.716) (-502.801) (-503.950) [-502.303] * (-508.874) (-507.136) [-500.701] (-503.050) -- 0:01:09
159000 -- (-502.879) (-501.141) [-501.429] (-504.633) * (-500.853) (-502.746) (-503.244) [-501.566] -- 0:01:08
159500 -- (-501.435) [-500.568] (-503.580) (-507.747) * (-500.685) (-501.903) [-501.956] (-502.735) -- 0:01:08
160000 -- [-504.536] (-507.455) (-504.413) (-506.359) * (-501.974) [-503.012] (-505.935) (-501.398) -- 0:01:08
Average standard deviation of split frequencies: 0.018745
160500 -- (-502.113) (-502.518) (-504.204) [-502.160] * [-501.515] (-504.204) (-503.728) (-501.785) -- 0:01:07
161000 -- (-500.938) [-501.654] (-501.615) (-501.131) * (-502.279) (-503.703) [-501.351] (-502.215) -- 0:01:07
161500 -- (-505.217) (-503.566) [-500.333] (-503.351) * (-506.303) (-501.880) [-501.805] (-504.563) -- 0:01:07
162000 -- [-501.094] (-502.499) (-501.799) (-501.195) * (-503.724) [-501.592] (-503.704) (-503.201) -- 0:01:07
162500 -- (-501.008) (-504.250) (-506.511) [-502.516] * (-505.069) (-501.202) (-506.965) [-502.585] -- 0:01:07
163000 -- (-500.454) (-504.282) (-503.456) [-502.349] * [-500.735] (-503.907) (-501.904) (-502.967) -- 0:01:06
163500 -- (-501.914) (-505.684) [-502.705] (-502.606) * [-502.925] (-507.725) (-501.137) (-503.723) -- 0:01:06
164000 -- [-502.353] (-501.268) (-502.964) (-503.032) * [-502.730] (-502.009) (-502.936) (-505.324) -- 0:01:06
164500 -- (-501.783) (-501.296) (-501.902) [-501.705] * (-505.944) [-500.626] (-503.535) (-502.024) -- 0:01:06
165000 -- (-502.163) (-502.944) (-504.661) [-502.097] * (-501.059) (-504.072) (-503.842) [-504.665] -- 0:01:05
Average standard deviation of split frequencies: 0.019247
165500 -- [-506.569] (-502.436) (-502.368) (-501.566) * (-500.322) (-503.878) (-504.057) [-503.163] -- 0:01:05
166000 -- [-503.130] (-501.754) (-502.075) (-505.209) * [-500.404] (-506.492) (-505.483) (-502.161) -- 0:01:05
166500 -- (-508.220) (-502.476) (-503.775) [-505.904] * [-501.640] (-502.257) (-504.370) (-504.066) -- 0:01:05
167000 -- [-502.678] (-506.462) (-505.727) (-501.433) * [-501.533] (-502.927) (-502.962) (-503.928) -- 0:01:04
167500 -- (-500.789) (-502.474) (-502.959) [-500.538] * (-503.480) (-506.127) [-507.671] (-505.280) -- 0:01:04
168000 -- (-502.878) (-505.115) (-502.713) [-502.131] * (-503.026) (-504.451) [-502.182] (-501.637) -- 0:01:04
168500 -- (-505.830) (-502.705) [-503.561] (-501.066) * [-503.402] (-500.967) (-503.829) (-504.348) -- 0:01:04
169000 -- (-502.678) (-502.074) (-503.243) [-501.769] * (-501.609) (-504.228) (-501.999) [-501.215] -- 0:01:03
169500 -- (-501.757) (-501.214) [-501.347] (-502.185) * (-501.669) [-503.128] (-502.330) (-502.577) -- 0:01:03
170000 -- (-506.422) (-500.624) (-503.650) [-501.476] * [-500.606] (-502.233) (-501.689) (-500.919) -- 0:01:03
Average standard deviation of split frequencies: 0.017954
170500 -- (-506.841) (-504.052) (-505.750) [-502.330] * (-503.169) (-500.842) (-506.609) [-501.054] -- 0:01:03
171000 -- (-503.692) (-503.615) [-503.293] (-501.488) * (-504.439) [-500.957] (-503.233) (-503.010) -- 0:01:07
171500 -- (-503.950) [-502.140] (-505.296) (-502.037) * (-503.477) (-504.975) (-508.412) [-504.278] -- 0:01:07
172000 -- (-503.544) [-504.593] (-508.115) (-500.944) * (-501.847) (-505.064) (-502.362) [-507.225] -- 0:01:07
172500 -- (-501.462) (-503.945) (-501.829) [-500.542] * (-500.990) (-501.510) (-501.425) [-506.582] -- 0:01:07
173000 -- (-502.963) (-501.582) [-507.824] (-503.286) * (-501.932) (-505.523) (-501.968) [-501.284] -- 0:01:06
173500 -- (-505.145) (-502.874) (-502.104) [-502.476] * [-505.292] (-504.224) (-503.203) (-504.407) -- 0:01:06
174000 -- (-503.336) (-506.290) (-507.567) [-502.140] * [-506.884] (-506.279) (-504.931) (-500.689) -- 0:01:06
174500 -- (-506.962) (-501.977) [-501.532] (-502.693) * (-503.299) [-504.874] (-501.458) (-501.366) -- 0:01:06
175000 -- (-506.879) (-502.593) [-501.219] (-503.093) * (-501.797) (-501.835) (-503.353) [-501.159] -- 0:01:06
Average standard deviation of split frequencies: 0.017559
175500 -- (-501.449) (-501.569) [-503.396] (-506.166) * (-507.571) (-501.854) [-501.159] (-501.260) -- 0:01:05
176000 -- (-507.716) [-501.833] (-501.749) (-505.175) * [-501.841] (-501.397) (-504.711) (-502.985) -- 0:01:05
176500 -- (-503.705) (-502.689) [-502.259] (-502.435) * (-504.968) (-503.392) (-503.547) [-501.231] -- 0:01:05
177000 -- (-507.223) (-501.603) [-504.169] (-503.703) * [-501.690] (-502.627) (-502.234) (-501.175) -- 0:01:05
177500 -- (-502.937) (-505.183) (-504.186) [-503.714] * (-501.465) (-507.040) (-501.405) [-501.480] -- 0:01:04
178000 -- [-501.660] (-504.218) (-503.076) (-501.357) * (-504.825) (-501.329) [-504.965] (-508.137) -- 0:01:04
178500 -- [-502.499] (-503.622) (-503.097) (-504.149) * (-503.875) (-503.100) [-501.564] (-501.858) -- 0:01:04
179000 -- (-505.952) (-509.050) [-502.692] (-502.160) * [-503.977] (-504.572) (-502.274) (-502.917) -- 0:01:04
179500 -- (-508.886) (-508.714) [-501.860] (-501.219) * (-506.727) [-505.112] (-501.703) (-503.161) -- 0:01:03
180000 -- [-505.907] (-508.448) (-502.083) (-501.475) * (-503.634) (-500.861) [-502.907] (-502.602) -- 0:01:03
Average standard deviation of split frequencies: 0.018265
180500 -- (-502.543) (-501.877) (-503.330) [-504.236] * (-506.785) (-501.040) [-500.746] (-502.511) -- 0:01:03
181000 -- (-504.181) [-502.380] (-501.844) (-500.984) * [-505.800] (-502.642) (-500.632) (-500.883) -- 0:01:03
181500 -- (-501.404) [-504.281] (-501.992) (-502.027) * (-501.521) (-503.498) [-502.529] (-500.964) -- 0:01:03
182000 -- (-503.618) (-501.259) [-502.534] (-500.921) * [-505.133] (-500.879) (-501.351) (-501.762) -- 0:01:02
182500 -- (-505.777) (-501.276) (-502.320) [-500.997] * (-500.524) (-501.384) (-500.487) [-501.648] -- 0:01:02
183000 -- (-504.265) [-501.075] (-502.230) (-500.572) * (-500.660) (-501.734) [-500.292] (-501.715) -- 0:01:02
183500 -- [-503.931] (-502.275) (-504.726) (-501.357) * (-503.649) (-502.608) [-503.227] (-500.907) -- 0:01:02
184000 -- (-501.748) (-502.062) [-507.718] (-503.342) * (-508.627) (-502.414) [-501.056] (-503.511) -- 0:01:06
184500 -- (-502.792) (-504.821) [-503.548] (-504.964) * (-503.151) [-500.872] (-504.072) (-501.605) -- 0:01:06
185000 -- (-500.998) [-504.315] (-502.200) (-503.663) * (-502.419) (-501.505) (-504.635) [-504.715] -- 0:01:06
Average standard deviation of split frequencies: 0.016333
185500 -- (-500.543) (-502.769) [-502.646] (-502.946) * (-506.125) (-503.087) (-504.415) [-500.948] -- 0:01:05
186000 -- (-504.659) (-503.935) (-503.165) [-504.851] * (-510.054) (-506.094) [-505.119] (-504.262) -- 0:01:05
186500 -- [-504.134] (-504.300) (-502.794) (-501.132) * (-506.187) (-503.259) (-503.123) [-503.105] -- 0:01:05
187000 -- (-506.054) (-501.944) (-504.656) [-502.901] * (-503.109) [-503.836] (-505.272) (-504.379) -- 0:01:05
187500 -- (-501.412) [-502.221] (-502.503) (-502.653) * (-502.203) (-502.374) (-503.950) [-502.732] -- 0:01:05
188000 -- (-504.062) (-501.218) (-504.579) [-504.200] * (-503.982) (-500.653) [-503.151] (-501.200) -- 0:01:04
188500 -- (-506.424) [-501.620] (-504.295) (-503.423) * (-501.691) (-501.382) [-504.299] (-504.420) -- 0:01:04
189000 -- (-508.640) [-505.866] (-500.736) (-503.292) * (-501.671) (-503.070) [-502.166] (-507.117) -- 0:01:04
189500 -- (-507.355) (-500.382) (-502.247) [-500.722] * (-501.950) [-501.014] (-500.751) (-501.795) -- 0:01:04
190000 -- (-506.091) (-501.819) (-504.167) [-503.299] * (-503.365) (-500.888) (-503.961) [-503.231] -- 0:01:03
Average standard deviation of split frequencies: 0.014253
190500 -- (-503.526) (-502.617) (-501.842) [-503.551] * (-502.444) (-506.428) [-501.749] (-507.015) -- 0:01:03
191000 -- [-501.949] (-500.435) (-501.234) (-503.785) * (-503.321) [-500.717] (-500.936) (-502.988) -- 0:01:03
191500 -- (-502.711) [-502.886] (-501.089) (-501.344) * [-502.844] (-502.586) (-504.747) (-502.283) -- 0:01:03
192000 -- (-503.096) [-501.398] (-502.734) (-503.066) * (-503.209) (-502.398) [-502.327] (-505.585) -- 0:01:03
192500 -- (-502.838) [-501.274] (-504.505) (-501.474) * [-504.963] (-500.703) (-504.588) (-503.335) -- 0:01:02
193000 -- (-503.374) (-503.396) [-502.400] (-502.740) * [-500.354] (-504.596) (-505.102) (-501.840) -- 0:01:02
193500 -- (-502.872) [-503.057] (-503.074) (-502.243) * [-501.360] (-503.458) (-503.424) (-500.827) -- 0:01:02
194000 -- (-502.398) [-500.907] (-504.371) (-501.664) * (-502.425) (-502.972) (-503.398) [-501.562] -- 0:01:02
194500 -- [-504.917] (-502.749) (-502.715) (-502.097) * (-501.157) (-504.903) [-503.463] (-500.896) -- 0:01:02
195000 -- (-504.745) [-501.413] (-508.071) (-504.016) * [-503.553] (-502.255) (-501.096) (-506.687) -- 0:01:01
Average standard deviation of split frequencies: 0.015099
195500 -- (-506.525) [-501.880] (-504.103) (-502.164) * [-502.143] (-501.206) (-500.607) (-501.594) -- 0:01:01
196000 -- (-504.055) (-506.069) (-502.247) [-501.467] * [-502.953] (-500.968) (-502.668) (-500.602) -- 0:01:01
196500 -- (-501.618) (-510.504) [-505.140] (-505.389) * (-509.527) [-504.202] (-501.909) (-500.895) -- 0:01:01
197000 -- (-501.179) [-504.964] (-505.086) (-502.128) * (-503.459) (-507.727) [-503.689] (-502.057) -- 0:01:05
197500 -- [-501.234] (-502.318) (-500.714) (-503.669) * (-503.466) [-501.567] (-503.050) (-502.922) -- 0:01:05
198000 -- (-504.790) (-503.835) [-502.241] (-504.494) * [-501.711] (-507.195) (-504.802) (-502.010) -- 0:01:04
198500 -- (-503.244) [-502.354] (-501.498) (-503.063) * (-501.648) (-502.007) (-505.320) [-501.451] -- 0:01:04
199000 -- (-504.226) [-500.959] (-501.636) (-501.965) * [-510.598] (-502.908) (-502.050) (-502.321) -- 0:01:04
199500 -- (-504.689) [-501.047] (-500.713) (-501.088) * (-507.936) [-500.879] (-501.762) (-502.979) -- 0:01:04
200000 -- (-501.019) (-500.599) (-501.737) [-501.833] * [-502.722] (-500.661) (-503.068) (-501.490) -- 0:01:04
Average standard deviation of split frequencies: 0.014924
200500 -- (-502.444) (-509.213) (-503.418) [-502.424] * [-502.162] (-503.752) (-502.076) (-501.947) -- 0:01:03
201000 -- [-502.987] (-501.428) (-504.699) (-502.118) * (-501.712) [-501.264] (-502.984) (-503.811) -- 0:01:03
201500 -- (-503.120) [-501.161] (-502.260) (-501.828) * (-500.701) [-501.079] (-502.008) (-502.270) -- 0:01:03
202000 -- (-511.622) [-501.165] (-504.612) (-503.279) * (-501.678) (-504.799) [-505.772] (-500.811) -- 0:01:03
202500 -- (-507.675) (-501.972) (-501.818) [-505.632] * (-502.309) (-500.414) (-503.087) [-502.312] -- 0:01:03
203000 -- (-505.262) (-501.633) (-502.365) [-502.128] * [-503.295] (-503.899) (-502.251) (-505.537) -- 0:01:02
203500 -- (-504.629) (-502.162) (-504.740) [-503.078] * (-505.822) (-503.354) [-502.891] (-500.452) -- 0:01:02
204000 -- (-502.094) [-503.635] (-502.637) (-502.407) * (-507.269) [-501.750] (-501.589) (-501.418) -- 0:01:02
204500 -- (-502.883) (-504.588) [-502.676] (-508.981) * (-502.504) [-502.200] (-501.030) (-503.743) -- 0:01:02
205000 -- (-500.549) [-501.679] (-504.948) (-506.190) * (-502.029) (-503.134) [-500.900] (-507.589) -- 0:01:02
Average standard deviation of split frequencies: 0.015346
205500 -- [-500.759] (-504.647) (-503.032) (-503.179) * [-501.197] (-503.614) (-507.466) (-501.936) -- 0:01:01
206000 -- (-501.279) (-501.585) [-501.654] (-502.153) * (-504.298) [-501.632] (-504.522) (-502.531) -- 0:01:01
206500 -- (-501.165) (-500.920) (-501.335) [-505.455] * (-503.652) (-501.784) (-503.665) [-502.778] -- 0:01:01
207000 -- (-503.335) [-501.213] (-502.527) (-502.655) * (-502.761) (-502.909) (-502.372) [-502.914] -- 0:01:01
207500 -- (-503.595) [-504.212] (-503.384) (-503.139) * (-502.664) (-503.240) [-504.071] (-502.563) -- 0:01:01
208000 -- [-500.605] (-501.877) (-501.381) (-501.692) * [-506.099] (-502.556) (-500.975) (-505.430) -- 0:01:00
208500 -- (-503.352) (-502.621) [-505.594] (-501.453) * [-501.953] (-507.660) (-500.303) (-506.285) -- 0:01:00
209000 -- (-500.743) [-502.202] (-503.237) (-501.774) * (-502.534) (-510.465) (-502.212) [-505.201] -- 0:01:00
209500 -- (-501.745) [-504.495] (-503.359) (-504.120) * (-501.590) (-505.669) (-504.430) [-503.478] -- 0:01:04
210000 -- (-501.750) (-501.296) (-503.568) [-500.832] * (-502.649) [-502.098] (-506.132) (-505.690) -- 0:01:03
Average standard deviation of split frequencies: 0.015927
210500 -- [-500.586] (-501.462) (-501.538) (-500.947) * (-503.577) (-503.411) (-502.207) [-506.247] -- 0:01:03
211000 -- (-504.246) (-503.147) [-502.035] (-500.668) * (-504.217) (-502.620) (-502.107) [-501.898] -- 0:01:03
211500 -- [-502.839] (-502.544) (-502.579) (-502.244) * [-501.811] (-502.852) (-501.844) (-502.283) -- 0:01:03
212000 -- (-503.294) (-503.406) [-502.281] (-500.343) * (-500.914) [-503.134] (-504.184) (-502.546) -- 0:01:03
212500 -- (-504.287) (-502.806) (-501.491) [-501.308] * (-501.162) (-502.104) (-502.860) [-503.136] -- 0:01:03
213000 -- (-504.285) [-501.096] (-503.249) (-505.924) * (-506.182) [-503.464] (-503.549) (-504.685) -- 0:01:02
213500 -- (-502.750) [-500.458] (-502.210) (-504.370) * (-503.062) [-503.703] (-504.258) (-502.792) -- 0:01:02
214000 -- [-501.462] (-505.176) (-501.391) (-504.001) * (-503.525) [-504.635] (-502.484) (-503.755) -- 0:01:02
214500 -- (-501.583) (-503.393) (-501.465) [-501.634] * (-507.843) (-504.956) (-502.584) [-503.123] -- 0:01:02
215000 -- (-504.443) (-501.174) [-506.500] (-501.298) * (-504.171) (-505.107) (-502.233) [-501.216] -- 0:01:02
Average standard deviation of split frequencies: 0.017331
215500 -- (-506.801) [-501.051] (-503.729) (-500.897) * [-505.023] (-501.122) (-502.643) (-501.012) -- 0:01:01
216000 -- (-506.978) (-501.030) (-501.537) [-503.326] * [-501.625] (-506.589) (-505.981) (-502.170) -- 0:01:01
216500 -- (-503.138) [-503.756] (-501.233) (-505.429) * (-502.683) (-502.064) [-504.254] (-502.662) -- 0:01:01
217000 -- (-502.110) (-510.926) (-501.443) [-502.143] * (-506.680) [-502.107] (-502.846) (-500.808) -- 0:01:01
217500 -- (-502.565) (-506.677) [-501.724] (-503.827) * [-502.561] (-501.109) (-501.190) (-506.012) -- 0:01:01
218000 -- [-501.335] (-509.326) (-504.383) (-504.052) * (-508.274) (-501.285) [-502.564] (-502.648) -- 0:01:00
218500 -- (-502.743) [-501.671] (-503.376) (-503.775) * (-507.089) (-502.076) (-503.471) [-502.098] -- 0:01:00
219000 -- (-501.315) (-502.236) [-500.842] (-504.542) * [-502.056] (-501.071) (-504.101) (-501.401) -- 0:01:00
219500 -- (-501.474) (-502.832) (-500.494) [-502.306] * (-504.239) (-503.354) [-505.862] (-502.383) -- 0:01:00
220000 -- (-504.247) (-502.104) (-500.906) [-502.426] * [-505.749] (-501.580) (-503.053) (-501.166) -- 0:01:00
Average standard deviation of split frequencies: 0.017467
220500 -- (-502.061) (-502.162) [-503.612] (-502.649) * [-502.725] (-500.853) (-502.133) (-503.150) -- 0:01:00
221000 -- (-503.331) [-501.975] (-503.437) (-501.885) * (-502.846) (-501.220) [-503.597] (-504.037) -- 0:00:59
221500 -- [-503.863] (-502.362) (-507.228) (-504.223) * [-503.948] (-501.874) (-504.494) (-503.139) -- 0:00:59
222000 -- (-507.067) [-503.914] (-507.297) (-506.222) * (-506.426) (-501.338) [-504.456] (-503.596) -- 0:00:59
222500 -- (-501.417) [-503.727] (-504.763) (-501.028) * (-502.499) (-506.136) (-503.989) [-503.714] -- 0:01:02
223000 -- (-501.268) [-503.267] (-504.947) (-501.672) * (-505.047) (-504.845) (-504.790) [-505.511] -- 0:01:02
223500 -- [-508.322] (-504.398) (-500.710) (-501.454) * (-502.473) (-502.582) [-501.849] (-502.768) -- 0:01:02
224000 -- (-503.230) (-502.556) [-502.583] (-501.644) * (-502.175) (-503.425) [-503.426] (-501.366) -- 0:01:02
224500 -- (-509.630) (-504.241) [-503.982] (-503.562) * [-505.973] (-503.174) (-503.364) (-504.196) -- 0:01:02
225000 -- (-503.327) (-505.014) [-506.453] (-505.531) * (-505.943) (-505.418) [-502.996] (-505.251) -- 0:01:02
Average standard deviation of split frequencies: 0.017382
225500 -- (-504.380) (-503.988) [-506.583] (-503.330) * (-504.459) (-505.807) (-503.329) [-503.245] -- 0:01:01
226000 -- (-502.785) (-505.573) (-502.810) [-501.384] * (-502.535) (-501.693) [-504.401] (-503.023) -- 0:01:01
226500 -- (-504.305) (-509.796) (-502.604) [-500.649] * [-503.706] (-503.460) (-504.616) (-505.386) -- 0:01:01
227000 -- (-503.383) (-501.102) (-501.379) [-502.881] * [-503.773] (-501.276) (-501.341) (-501.983) -- 0:01:01
227500 -- (-501.558) (-504.927) (-504.452) [-502.758] * (-506.069) (-501.406) [-501.284] (-505.138) -- 0:01:01
228000 -- [-501.568] (-502.974) (-505.270) (-501.043) * (-504.436) [-501.021] (-503.045) (-501.420) -- 0:01:00
228500 -- (-501.714) (-501.335) (-501.386) [-503.728] * (-503.086) (-504.484) (-506.977) [-503.165] -- 0:01:00
229000 -- [-505.134] (-506.351) (-502.396) (-503.903) * [-503.040] (-511.214) (-501.441) (-502.444) -- 0:01:00
229500 -- (-503.855) [-502.770] (-501.556) (-507.638) * (-501.504) [-502.930] (-503.142) (-504.685) -- 0:01:00
230000 -- (-501.465) (-505.007) [-501.355] (-501.327) * (-501.564) (-501.680) (-501.752) [-503.461] -- 0:01:00
Average standard deviation of split frequencies: 0.018716
230500 -- (-501.685) [-501.489] (-507.380) (-501.296) * (-503.381) (-508.629) [-503.230] (-501.760) -- 0:01:00
231000 -- (-504.028) (-504.750) (-508.491) [-500.832] * (-504.414) (-503.919) [-502.040] (-501.571) -- 0:00:59
231500 -- (-503.610) (-508.520) [-509.542] (-504.102) * [-501.552] (-501.475) (-501.958) (-502.982) -- 0:00:59
232000 -- (-501.388) (-502.727) (-506.080) [-501.273] * (-503.061) [-502.400] (-503.649) (-503.205) -- 0:00:59
232500 -- (-503.165) [-502.067] (-503.204) (-501.039) * (-503.409) [-502.155] (-505.333) (-501.023) -- 0:00:59
233000 -- (-501.145) [-500.692] (-504.388) (-501.378) * (-506.889) (-503.352) (-501.860) [-501.234] -- 0:00:59
233500 -- (-502.053) (-505.277) [-502.361] (-504.120) * (-504.990) [-501.644] (-502.080) (-502.446) -- 0:00:59
234000 -- (-502.855) (-502.983) [-504.063] (-503.447) * (-511.997) (-501.230) [-501.536] (-501.755) -- 0:00:58
234500 -- (-502.143) [-504.926] (-504.374) (-502.262) * (-502.953) [-500.562] (-501.204) (-502.933) -- 0:00:58
235000 -- [-504.030] (-504.504) (-503.368) (-504.573) * (-501.335) (-502.068) (-506.249) [-503.784] -- 0:01:01
Average standard deviation of split frequencies: 0.018643
235500 -- (-504.305) [-502.843] (-507.741) (-504.561) * (-501.302) (-502.651) (-507.812) [-502.246] -- 0:01:01
236000 -- [-503.738] (-505.544) (-502.849) (-505.041) * (-502.171) (-501.958) [-503.342] (-502.186) -- 0:01:01
236500 -- (-502.962) (-510.494) [-501.895] (-503.891) * (-501.801) (-502.143) (-501.892) [-500.964] -- 0:01:01
237000 -- (-503.180) [-504.639] (-501.360) (-503.412) * (-502.826) [-501.935] (-505.670) (-502.002) -- 0:01:01
237500 -- (-502.949) (-501.825) (-500.906) [-501.313] * (-503.045) [-501.847] (-501.652) (-505.524) -- 0:01:01
238000 -- (-503.589) (-504.300) (-502.210) [-504.980] * [-502.071] (-501.444) (-501.195) (-502.145) -- 0:01:00
238500 -- (-504.739) (-504.226) (-502.510) [-504.026] * (-501.235) (-504.254) [-504.720] (-502.746) -- 0:01:00
239000 -- (-503.216) (-503.256) (-504.276) [-504.863] * (-502.700) [-501.313] (-502.709) (-502.825) -- 0:01:00
239500 -- (-505.002) [-502.282] (-505.836) (-504.238) * (-503.261) (-500.618) [-502.651] (-504.207) -- 0:01:00
240000 -- (-502.051) (-503.500) (-505.950) [-505.451] * (-503.907) [-503.104] (-503.328) (-504.527) -- 0:01:00
Average standard deviation of split frequencies: 0.019152
240500 -- (-502.427) (-501.788) (-505.708) [-501.699] * [-503.521] (-503.149) (-504.861) (-504.498) -- 0:01:00
241000 -- (-505.376) [-501.017] (-506.105) (-500.963) * (-501.768) (-500.912) [-502.267] (-504.904) -- 0:00:59
241500 -- (-501.021) (-502.091) [-500.526] (-503.045) * (-503.323) (-500.518) [-504.750] (-504.368) -- 0:00:59
242000 -- (-503.730) [-502.399] (-503.816) (-504.177) * [-503.186] (-503.559) (-501.509) (-502.827) -- 0:00:59
242500 -- [-506.928] (-501.912) (-503.709) (-502.072) * (-502.107) (-507.953) [-501.962] (-503.002) -- 0:00:59
243000 -- (-502.609) (-504.570) (-502.693) [-500.526] * (-504.299) (-501.786) [-504.545] (-503.030) -- 0:00:59
243500 -- [-501.997] (-503.293) (-506.696) (-500.822) * [-503.890] (-503.016) (-502.063) (-500.661) -- 0:00:59
244000 -- [-507.224] (-503.071) (-506.735) (-501.956) * [-501.207] (-502.567) (-500.962) (-502.134) -- 0:00:58
244500 -- (-503.476) [-502.579] (-501.781) (-501.648) * [-502.928] (-504.728) (-503.345) (-502.782) -- 0:00:58
245000 -- (-502.128) [-503.211] (-504.782) (-503.074) * (-503.802) (-502.494) [-502.844] (-507.824) -- 0:00:58
Average standard deviation of split frequencies: 0.017726
245500 -- (-502.266) (-502.362) [-502.338] (-502.594) * (-501.360) (-503.034) [-502.191] (-506.672) -- 0:00:58
246000 -- (-503.634) (-502.226) (-501.770) [-501.679] * (-500.777) (-501.469) [-504.943] (-502.194) -- 0:00:58
246500 -- [-501.748] (-503.562) (-509.395) (-501.938) * [-500.932] (-501.077) (-501.704) (-502.508) -- 0:00:58
247000 -- [-502.745] (-504.044) (-500.960) (-502.904) * (-503.181) (-503.894) [-501.420] (-505.349) -- 0:00:57
247500 -- [-502.006] (-502.786) (-504.654) (-505.863) * (-502.851) [-503.358] (-502.773) (-500.450) -- 0:01:00
248000 -- (-504.632) [-501.242] (-501.789) (-502.082) * (-502.104) [-501.679] (-501.494) (-501.138) -- 0:01:00
248500 -- (-502.396) (-502.109) (-505.027) [-504.170] * (-508.184) (-502.222) (-504.150) [-501.324] -- 0:01:00
249000 -- [-501.050] (-503.183) (-502.518) (-502.547) * (-506.125) (-501.259) [-502.358] (-500.898) -- 0:01:00
249500 -- (-502.363) (-504.844) (-502.580) [-503.363] * (-505.038) (-501.382) [-501.916] (-501.401) -- 0:01:00
250000 -- (-503.800) (-508.477) (-502.668) [-505.472] * (-502.420) [-501.800] (-501.515) (-502.036) -- 0:01:00
Average standard deviation of split frequencies: 0.017970
250500 -- (-502.611) (-503.375) (-503.893) [-505.613] * (-501.683) [-502.608] (-501.124) (-500.805) -- 0:00:59
251000 -- (-502.367) (-502.104) (-504.337) [-501.519] * (-501.188) [-501.778] (-503.439) (-501.208) -- 0:00:59
251500 -- (-503.619) (-502.528) [-504.358] (-502.375) * (-503.593) (-501.542) [-502.239] (-501.547) -- 0:00:59
252000 -- (-503.653) (-501.688) [-501.221] (-501.253) * (-501.698) (-504.861) [-504.448] (-502.354) -- 0:00:59
252500 -- (-502.121) (-503.521) (-500.462) [-501.400] * (-501.524) [-502.091] (-501.014) (-503.248) -- 0:00:59
253000 -- (-501.847) (-502.293) (-501.475) [-501.681] * (-501.725) [-502.919] (-500.474) (-502.956) -- 0:00:59
253500 -- [-501.041] (-505.361) (-502.767) (-504.658) * (-504.063) [-502.325] (-500.763) (-503.063) -- 0:00:58
254000 -- [-502.486] (-504.158) (-503.193) (-503.760) * (-500.570) (-504.650) (-501.837) [-503.212] -- 0:00:58
254500 -- (-501.005) [-500.978] (-505.517) (-508.712) * (-504.083) (-501.068) (-502.898) [-501.201] -- 0:00:58
255000 -- (-503.193) (-501.376) (-506.273) [-501.865] * [-504.284] (-503.133) (-506.747) (-500.774) -- 0:00:58
Average standard deviation of split frequencies: 0.015991
255500 -- (-502.686) (-500.838) [-502.072] (-504.448) * (-502.328) [-502.422] (-505.198) (-502.746) -- 0:00:58
256000 -- (-503.346) [-503.392] (-501.055) (-506.667) * (-503.516) (-502.079) (-501.591) [-502.900] -- 0:00:58
256500 -- (-503.670) (-505.203) [-500.775] (-506.668) * (-510.188) (-504.857) [-504.999] (-503.649) -- 0:00:57
257000 -- (-502.053) (-503.357) [-505.190] (-501.849) * (-503.775) [-502.920] (-505.605) (-505.858) -- 0:00:57
257500 -- (-502.142) (-503.418) [-503.146] (-501.570) * [-502.795] (-501.261) (-507.197) (-501.882) -- 0:00:57
258000 -- (-503.877) [-503.579] (-500.927) (-501.482) * (-503.193) [-503.082] (-504.526) (-500.733) -- 0:00:57
258500 -- (-500.698) (-503.523) [-501.841] (-501.617) * (-505.798) [-501.830] (-501.725) (-507.486) -- 0:00:57
259000 -- (-501.976) (-504.830) (-501.137) [-502.059] * (-500.593) (-503.294) [-502.687] (-501.592) -- 0:00:57
259500 -- (-501.029) (-501.953) (-502.086) [-503.941] * (-502.098) (-508.591) [-504.154] (-503.234) -- 0:00:57
260000 -- (-501.061) (-501.892) [-502.544] (-505.148) * [-501.580] (-506.734) (-503.268) (-505.030) -- 0:00:59
Average standard deviation of split frequencies: 0.016595
260500 -- (-502.172) (-500.514) [-503.085] (-501.675) * (-503.237) [-509.289] (-507.522) (-502.038) -- 0:00:59
261000 -- (-503.915) (-502.316) [-502.663] (-501.694) * (-504.088) [-502.301] (-504.759) (-503.091) -- 0:00:59
261500 -- (-504.087) (-501.221) [-503.718] (-502.651) * [-502.740] (-502.268) (-503.987) (-509.494) -- 0:00:59
262000 -- [-502.577] (-500.601) (-501.211) (-501.903) * (-503.826) (-502.894) (-503.288) [-504.627] -- 0:00:59
262500 -- (-502.688) [-503.021] (-503.666) (-506.130) * (-503.205) (-503.882) (-501.911) [-500.488] -- 0:00:59
263000 -- (-500.747) (-504.333) [-502.023] (-514.505) * (-500.635) [-507.310] (-502.437) (-504.371) -- 0:00:58
263500 -- (-500.838) [-503.366] (-502.492) (-503.951) * [-500.941] (-503.678) (-501.232) (-504.190) -- 0:00:58
264000 -- (-504.738) (-507.414) (-502.269) [-503.518] * (-505.932) (-502.615) (-503.937) [-503.991] -- 0:00:58
264500 -- (-503.492) (-507.333) (-508.897) [-502.691] * (-501.229) (-504.107) [-506.647] (-504.153) -- 0:00:58
265000 -- [-502.489] (-504.064) (-508.275) (-503.022) * (-502.585) (-500.536) [-502.594] (-503.574) -- 0:00:58
Average standard deviation of split frequencies: 0.015261
265500 -- (-501.880) [-501.539] (-509.586) (-504.244) * (-503.848) [-501.136] (-503.557) (-502.199) -- 0:00:58
266000 -- [-505.965] (-502.510) (-502.518) (-503.083) * (-503.765) (-501.113) [-505.389] (-507.414) -- 0:00:57
266500 -- (-502.039) (-504.424) [-501.965] (-503.594) * (-503.676) [-501.545] (-504.451) (-501.064) -- 0:00:57
267000 -- [-504.226] (-503.652) (-500.413) (-504.879) * (-503.010) [-502.091] (-501.827) (-501.121) -- 0:00:57
267500 -- (-502.552) (-503.759) [-500.585] (-503.124) * [-500.628] (-508.755) (-504.147) (-503.605) -- 0:00:57
268000 -- (-503.097) (-503.031) [-503.951] (-501.175) * (-503.608) [-502.799] (-507.564) (-504.393) -- 0:00:57
268500 -- [-503.020] (-506.007) (-506.306) (-501.803) * (-503.704) (-502.520) (-507.589) [-505.286] -- 0:00:57
269000 -- (-500.870) (-501.337) [-503.129] (-502.175) * (-503.716) (-503.429) (-501.444) [-501.314] -- 0:00:57
269500 -- (-501.942) (-500.786) [-500.837] (-503.401) * [-502.367] (-503.197) (-501.047) (-501.874) -- 0:00:56
270000 -- (-500.862) (-502.030) (-502.773) [-506.055] * (-503.156) (-501.439) [-501.843] (-502.713) -- 0:00:56
Average standard deviation of split frequencies: 0.014997
270500 -- (-504.540) [-502.173] (-501.693) (-502.358) * (-502.158) (-503.547) (-504.057) [-502.632] -- 0:00:56
271000 -- [-502.569] (-505.826) (-503.703) (-503.256) * (-505.078) (-506.631) (-501.837) [-502.351] -- 0:00:56
271500 -- (-501.294) [-503.694] (-502.324) (-504.860) * [-502.882] (-506.761) (-505.143) (-501.611) -- 0:00:56
272000 -- (-501.697) (-504.256) [-502.338] (-508.700) * (-509.567) (-505.757) (-505.175) [-504.236] -- 0:00:56
272500 -- [-503.964] (-502.671) (-500.958) (-504.556) * [-502.026] (-504.169) (-504.571) (-500.560) -- 0:00:58
273000 -- (-501.570) (-501.600) (-500.627) [-501.162] * [-501.867] (-501.820) (-506.871) (-506.344) -- 0:00:58
273500 -- (-502.818) [-502.748] (-506.337) (-501.426) * (-501.770) (-500.949) [-501.630] (-502.992) -- 0:00:58
274000 -- [-501.575] (-503.103) (-502.235) (-501.774) * (-501.132) (-504.872) [-503.871] (-502.731) -- 0:00:58
274500 -- (-507.613) [-502.174] (-500.732) (-501.594) * (-501.991) (-502.116) [-502.766] (-502.613) -- 0:00:58
275000 -- (-503.929) [-501.291] (-502.053) (-501.575) * (-503.542) (-501.269) (-502.489) [-501.617] -- 0:00:58
Average standard deviation of split frequencies: 0.016131
275500 -- [-502.720] (-503.254) (-504.793) (-508.506) * (-501.478) [-504.413] (-501.312) (-502.069) -- 0:00:57
276000 -- (-502.676) (-502.540) (-502.316) [-502.902] * [-500.795] (-504.873) (-501.861) (-503.474) -- 0:00:57
276500 -- [-501.397] (-502.015) (-501.590) (-501.626) * (-500.255) (-505.958) [-503.003] (-504.209) -- 0:00:57
277000 -- (-502.827) (-503.535) (-501.805) [-502.308] * (-501.074) (-505.802) (-504.690) [-502.657] -- 0:00:57
277500 -- [-503.340] (-502.405) (-502.583) (-501.825) * (-504.441) (-502.253) (-506.829) [-502.575] -- 0:00:57
278000 -- (-501.204) (-503.939) [-501.715] (-500.661) * [-506.102] (-504.227) (-507.050) (-504.836) -- 0:00:57
278500 -- (-502.866) (-507.814) (-500.969) [-501.628] * [-504.012] (-503.464) (-505.153) (-502.512) -- 0:00:56
279000 -- (-501.924) (-503.130) (-500.987) [-503.017] * (-501.417) (-508.244) (-502.127) [-502.366] -- 0:00:56
279500 -- (-505.124) (-507.445) (-505.711) [-500.818] * [-502.333] (-504.730) (-500.909) (-502.714) -- 0:00:56
280000 -- (-502.521) (-501.467) (-501.149) [-501.971] * (-504.413) (-503.459) [-501.839] (-502.744) -- 0:00:56
Average standard deviation of split frequencies: 0.016703
280500 -- [-503.091] (-504.049) (-503.098) (-501.145) * [-502.615] (-502.006) (-503.613) (-501.322) -- 0:00:56
281000 -- (-502.514) [-504.684] (-502.624) (-502.097) * (-503.621) [-501.228] (-501.827) (-500.430) -- 0:00:56
281500 -- (-503.486) [-503.008] (-502.212) (-503.683) * (-500.727) (-501.477) [-501.338] (-504.416) -- 0:00:56
282000 -- (-502.927) (-501.841) (-502.455) [-502.176] * (-504.536) [-503.473] (-508.049) (-501.913) -- 0:00:56
282500 -- [-501.727] (-502.154) (-501.672) (-504.311) * (-502.726) (-502.837) [-504.176] (-503.389) -- 0:00:55
283000 -- [-501.041] (-503.525) (-506.017) (-506.360) * (-502.888) [-504.511] (-501.312) (-502.973) -- 0:00:55
283500 -- [-501.038] (-503.486) (-502.068) (-502.704) * (-502.373) [-501.066] (-504.169) (-509.074) -- 0:00:55
284000 -- [-503.324] (-501.952) (-501.329) (-501.713) * (-504.303) (-505.509) [-504.017] (-502.636) -- 0:00:55
284500 -- (-502.035) (-502.291) [-504.202] (-504.122) * (-506.853) (-507.358) (-509.034) [-503.102] -- 0:00:55
285000 -- (-503.197) [-501.590] (-504.701) (-506.621) * [-500.919] (-504.807) (-500.941) (-502.331) -- 0:00:57
Average standard deviation of split frequencies: 0.017142
285500 -- (-506.508) [-508.397] (-505.220) (-503.787) * (-501.323) (-507.404) [-501.076] (-503.316) -- 0:00:57
286000 -- (-504.613) (-503.156) [-503.061] (-501.707) * (-504.897) (-504.155) [-501.692] (-504.398) -- 0:00:57
286500 -- (-504.378) (-502.393) [-501.086] (-501.510) * (-501.557) (-505.233) (-505.210) [-503.274] -- 0:00:57
287000 -- [-502.164] (-504.595) (-502.749) (-502.076) * (-501.469) (-501.769) (-503.793) [-506.103] -- 0:00:57
287500 -- [-502.993] (-501.546) (-504.231) (-504.767) * [-503.544] (-503.279) (-503.154) (-511.253) -- 0:00:57
288000 -- (-502.877) (-501.799) (-501.577) [-501.389] * [-504.935] (-501.769) (-505.106) (-503.618) -- 0:00:56
288500 -- (-502.115) (-501.834) (-503.544) [-504.406] * (-504.328) [-502.795] (-501.707) (-502.706) -- 0:00:56
289000 -- (-504.819) (-502.306) (-503.235) [-502.493] * (-502.881) (-501.862) [-501.812] (-503.411) -- 0:00:56
289500 -- (-503.395) (-503.274) [-501.181] (-506.847) * [-504.208] (-501.380) (-502.285) (-502.729) -- 0:00:56
290000 -- (-503.120) [-501.425] (-501.475) (-507.868) * (-503.422) (-501.118) [-504.614] (-505.673) -- 0:00:56
Average standard deviation of split frequencies: 0.016488
290500 -- (-502.125) (-503.056) [-504.360] (-508.083) * [-501.983] (-503.838) (-503.264) (-504.178) -- 0:00:56
291000 -- (-502.250) [-501.225] (-503.818) (-502.657) * (-504.903) (-506.224) (-502.269) [-501.268] -- 0:00:56
291500 -- (-505.353) [-501.792] (-504.328) (-502.890) * (-501.885) (-505.258) [-506.491] (-501.940) -- 0:00:55
292000 -- (-505.783) (-501.292) [-501.925] (-502.407) * [-500.705] (-500.723) (-503.106) (-503.179) -- 0:00:55
292500 -- (-504.115) (-503.487) (-502.823) [-502.901] * [-502.806] (-501.214) (-505.350) (-506.478) -- 0:00:55
293000 -- (-504.320) [-505.288] (-502.207) (-501.133) * [-501.026] (-501.247) (-501.512) (-506.797) -- 0:00:55
293500 -- (-501.806) [-503.549] (-501.020) (-501.133) * [-501.576] (-505.783) (-501.626) (-503.251) -- 0:00:55
294000 -- [-502.556] (-504.104) (-504.169) (-501.237) * (-501.740) (-505.501) (-502.057) [-504.644] -- 0:00:55
294500 -- (-502.602) (-504.751) (-505.859) [-500.367] * [-502.629] (-504.858) (-503.069) (-507.642) -- 0:00:55
295000 -- [-502.521] (-501.762) (-502.289) (-503.746) * (-503.608) (-500.965) (-501.596) [-504.676] -- 0:00:54
Average standard deviation of split frequencies: 0.017253
295500 -- (-501.704) (-501.153) [-501.251] (-502.446) * (-500.583) (-502.411) (-502.535) [-501.887] -- 0:00:54
296000 -- (-501.725) (-502.962) [-501.351] (-505.017) * [-503.805] (-504.353) (-501.857) (-501.569) -- 0:00:54
296500 -- (-501.531) [-500.706] (-504.699) (-509.860) * (-503.139) [-504.249] (-502.688) (-505.044) -- 0:00:54
297000 -- (-501.138) [-503.241] (-503.994) (-505.680) * [-503.022] (-503.039) (-504.708) (-502.071) -- 0:00:56
297500 -- (-507.167) (-503.909) (-502.547) [-503.848] * [-503.780] (-502.737) (-504.818) (-504.477) -- 0:00:56
298000 -- (-503.256) (-501.868) [-501.020] (-503.219) * (-502.917) [-503.380] (-506.883) (-501.705) -- 0:00:56
298500 -- (-502.916) (-504.668) [-502.318] (-500.838) * (-504.682) [-500.623] (-506.714) (-502.597) -- 0:00:56
299000 -- (-501.741) (-503.080) (-503.136) [-503.044] * (-502.993) (-500.885) [-503.355] (-507.208) -- 0:00:56
299500 -- (-504.184) [-502.485] (-506.640) (-503.922) * [-501.646] (-502.568) (-505.568) (-505.495) -- 0:00:56
300000 -- (-502.706) [-501.358] (-503.524) (-506.036) * (-505.267) (-500.611) (-507.781) [-501.805] -- 0:00:56
Average standard deviation of split frequencies: 0.016227
300500 -- (-501.636) [-500.892] (-504.049) (-504.162) * [-505.645] (-503.090) (-503.178) (-500.942) -- 0:00:55
301000 -- (-503.333) (-500.402) [-501.502] (-501.120) * [-502.111] (-501.775) (-503.964) (-507.281) -- 0:00:55
301500 -- (-502.003) (-504.003) [-502.902] (-503.134) * (-502.623) (-502.913) [-502.928] (-506.368) -- 0:00:55
302000 -- (-501.748) (-506.776) [-505.252] (-505.120) * [-504.546] (-500.851) (-502.070) (-503.601) -- 0:00:55
302500 -- [-501.485] (-501.355) (-501.228) (-504.341) * (-501.634) (-501.577) (-501.559) [-502.089] -- 0:00:55
303000 -- (-501.610) (-501.280) (-501.259) [-501.617] * (-504.355) (-501.135) (-504.716) [-500.900] -- 0:00:55
303500 -- (-500.947) (-504.484) (-507.572) [-503.489] * (-501.770) [-501.895] (-502.616) (-504.501) -- 0:00:55
304000 -- [-500.884] (-501.329) (-505.846) (-501.588) * (-501.170) [-501.706] (-506.135) (-505.625) -- 0:00:54
304500 -- (-502.698) (-501.466) [-501.762] (-504.457) * (-501.677) [-500.464] (-504.209) (-501.933) -- 0:00:54
305000 -- (-501.406) [-502.331] (-505.462) (-504.938) * (-508.355) (-502.330) [-502.938] (-501.276) -- 0:00:54
Average standard deviation of split frequencies: 0.014525
305500 -- (-507.068) (-502.305) (-503.989) [-503.058] * (-500.968) [-502.044] (-505.771) (-502.687) -- 0:00:54
306000 -- (-500.871) [-502.712] (-506.115) (-502.585) * [-506.306] (-509.760) (-504.085) (-505.046) -- 0:00:54
306500 -- (-503.909) (-505.183) (-502.279) [-501.763] * [-503.175] (-502.494) (-503.600) (-506.847) -- 0:00:54
307000 -- (-503.116) (-503.437) [-503.111] (-505.160) * [-501.324] (-502.619) (-503.472) (-502.394) -- 0:00:54
307500 -- [-503.777] (-505.185) (-503.238) (-500.895) * (-505.615) [-501.544] (-504.630) (-504.746) -- 0:00:54
308000 -- (-500.849) (-506.548) (-502.408) [-501.559] * (-504.177) (-502.527) [-502.979] (-503.910) -- 0:00:53
308500 -- (-505.249) (-502.060) [-502.448] (-502.754) * (-502.112) (-504.480) (-502.290) [-503.602] -- 0:00:53
309000 -- (-501.970) (-503.600) [-501.204] (-505.476) * (-502.333) (-500.636) [-501.597] (-501.006) -- 0:00:53
309500 -- (-503.840) [-502.480] (-509.041) (-503.667) * (-502.194) (-502.517) (-501.103) [-503.228] -- 0:00:55
310000 -- (-502.903) (-505.483) (-502.339) [-501.085] * (-500.629) (-502.018) [-505.274] (-503.730) -- 0:00:55
Average standard deviation of split frequencies: 0.013657
310500 -- [-501.317] (-500.866) (-501.782) (-502.003) * (-501.938) (-510.828) (-504.962) [-504.112] -- 0:00:55
311000 -- [-501.038] (-505.013) (-502.840) (-503.019) * (-503.934) (-502.547) (-504.458) [-502.214] -- 0:00:55
311500 -- (-501.930) (-501.353) [-501.054] (-508.156) * [-501.428] (-502.664) (-501.976) (-504.857) -- 0:00:55
312000 -- (-501.142) [-502.553] (-502.196) (-508.861) * [-502.505] (-502.777) (-501.776) (-501.624) -- 0:00:55
312500 -- [-501.398] (-503.019) (-502.423) (-503.577) * [-500.824] (-503.149) (-502.713) (-502.417) -- 0:00:55
313000 -- [-505.125] (-503.315) (-503.952) (-503.320) * (-502.842) [-501.286] (-502.553) (-502.883) -- 0:00:54
313500 -- (-502.632) (-503.700) [-507.135] (-504.455) * [-502.929] (-502.957) (-504.963) (-501.598) -- 0:00:54
314000 -- [-502.596] (-502.103) (-505.351) (-501.854) * (-503.124) (-502.183) (-504.323) [-504.368] -- 0:00:54
314500 -- [-502.430] (-505.395) (-505.286) (-501.448) * (-502.670) (-502.087) (-502.155) [-504.214] -- 0:00:54
315000 -- (-503.718) (-504.713) [-502.346] (-501.842) * (-501.733) (-500.717) (-503.788) [-502.516] -- 0:00:54
Average standard deviation of split frequencies: 0.013852
315500 -- (-502.869) (-505.206) [-501.003] (-503.389) * (-506.006) (-501.621) (-502.605) [-501.815] -- 0:00:54
316000 -- (-503.451) [-502.950] (-503.964) (-503.637) * (-504.872) (-505.312) [-503.788] (-502.081) -- 0:00:54
316500 -- (-505.774) (-502.679) [-502.830] (-501.252) * (-503.191) (-503.133) [-501.480] (-504.852) -- 0:00:53
317000 -- (-501.695) (-503.865) (-505.294) [-503.312] * [-502.166] (-503.244) (-503.780) (-503.083) -- 0:00:53
317500 -- [-502.489] (-501.924) (-501.741) (-502.269) * [-503.744] (-502.973) (-500.808) (-503.402) -- 0:00:53
318000 -- [-501.270] (-502.825) (-503.759) (-503.745) * (-502.790) (-501.570) [-500.929] (-502.109) -- 0:00:53
318500 -- [-501.409] (-502.860) (-503.346) (-501.650) * (-500.510) (-500.593) [-505.464] (-503.018) -- 0:00:53
319000 -- [-504.606] (-502.741) (-504.147) (-502.161) * (-503.691) [-502.924] (-503.317) (-500.584) -- 0:00:53
319500 -- (-504.702) (-505.372) (-503.370) [-502.435] * (-507.804) (-500.615) [-502.248] (-502.345) -- 0:00:53
320000 -- (-501.793) (-506.843) (-502.487) [-504.794] * (-506.641) (-503.572) (-502.554) [-502.003] -- 0:00:53
Average standard deviation of split frequencies: 0.013819
320500 -- (-503.224) (-502.728) (-502.576) [-500.818] * (-502.265) (-504.850) (-502.485) [-505.111] -- 0:00:53
321000 -- [-503.058] (-504.421) (-503.205) (-503.676) * [-501.585] (-504.464) (-501.909) (-500.563) -- 0:00:54
321500 -- (-503.355) [-502.461] (-503.922) (-503.564) * [-501.821] (-506.361) (-507.609) (-503.885) -- 0:00:54
322000 -- (-509.978) (-502.575) [-502.097] (-503.731) * (-505.553) (-506.240) (-503.061) [-500.544] -- 0:00:54
322500 -- (-506.244) (-502.562) [-503.095] (-503.061) * (-501.499) [-504.517] (-502.823) (-502.178) -- 0:00:54
323000 -- (-501.764) [-501.088] (-502.367) (-502.872) * (-504.155) (-505.109) (-501.646) [-500.747] -- 0:00:54
323500 -- (-502.916) [-504.462] (-503.107) (-501.370) * [-504.734] (-500.792) (-507.079) (-506.096) -- 0:00:54
324000 -- (-501.302) [-502.458] (-501.906) (-504.085) * (-502.194) (-505.428) (-500.989) [-503.539] -- 0:00:54
324500 -- (-501.451) (-507.386) [-503.930] (-503.949) * (-504.059) (-503.674) (-505.300) [-503.969] -- 0:00:54
325000 -- (-501.663) [-502.593] (-503.490) (-501.647) * (-500.569) (-502.269) (-500.756) [-501.571] -- 0:00:54
Average standard deviation of split frequencies: 0.014460
325500 -- (-501.538) [-500.795] (-505.105) (-501.200) * (-502.638) (-501.897) (-502.144) [-503.361] -- 0:00:53
326000 -- (-504.372) [-501.129] (-502.201) (-508.100) * (-501.741) [-501.201] (-502.475) (-500.264) -- 0:00:53
326500 -- (-503.954) (-504.101) (-502.341) [-500.805] * (-502.591) [-501.532] (-501.651) (-501.127) -- 0:00:53
327000 -- (-501.558) (-503.702) [-501.815] (-503.457) * (-502.912) (-501.567) [-501.987] (-500.981) -- 0:00:53
327500 -- (-502.646) (-501.922) [-501.924] (-503.761) * [-502.853] (-503.733) (-501.202) (-503.215) -- 0:00:53
328000 -- (-502.456) (-501.552) (-502.029) [-506.235] * [-502.336] (-501.574) (-501.831) (-504.571) -- 0:00:53
328500 -- (-502.768) (-503.453) [-501.636] (-502.111) * [-502.700] (-501.981) (-502.061) (-502.877) -- 0:00:53
329000 -- (-500.821) (-505.252) (-501.629) [-503.416] * (-503.381) (-503.930) [-502.249] (-500.897) -- 0:00:53
329500 -- [-501.593] (-502.169) (-505.119) (-502.669) * (-501.350) (-501.981) [-502.610] (-502.096) -- 0:00:52
330000 -- (-505.386) (-509.420) (-506.225) [-501.815] * (-506.155) (-501.404) (-501.734) [-501.919] -- 0:00:52
Average standard deviation of split frequencies: 0.013985
330500 -- (-506.302) (-506.708) [-503.323] (-503.123) * (-508.380) (-505.112) [-501.598] (-505.081) -- 0:00:52
331000 -- (-503.367) (-504.532) [-501.218] (-502.507) * [-503.910] (-506.639) (-505.226) (-501.699) -- 0:00:52
331500 -- (-503.222) (-503.104) (-501.300) [-502.532] * (-503.318) [-501.614] (-506.690) (-502.236) -- 0:00:52
332000 -- [-503.145] (-502.686) (-501.494) (-501.106) * [-501.092] (-502.170) (-502.620) (-502.261) -- 0:00:52
332500 -- (-503.920) [-501.685] (-504.139) (-504.037) * (-502.843) [-500.680] (-501.472) (-503.245) -- 0:00:54
333000 -- [-503.925] (-506.221) (-501.985) (-506.073) * (-505.813) [-501.840] (-502.950) (-501.664) -- 0:00:54
333500 -- (-501.343) (-503.322) [-503.034] (-503.278) * [-502.857] (-502.970) (-502.361) (-501.353) -- 0:00:53
334000 -- [-502.336] (-501.680) (-503.101) (-502.309) * [-500.799] (-502.172) (-502.071) (-506.069) -- 0:00:53
334500 -- [-501.326] (-503.020) (-504.215) (-502.088) * (-505.336) [-504.009] (-501.792) (-505.409) -- 0:00:53
335000 -- (-502.194) [-503.437] (-505.414) (-507.120) * (-503.127) [-502.009] (-502.320) (-503.069) -- 0:00:53
Average standard deviation of split frequencies: 0.015363
335500 -- [-501.162] (-504.595) (-500.775) (-503.696) * [-501.841] (-502.040) (-502.788) (-503.144) -- 0:00:53
336000 -- (-502.186) (-502.466) [-504.688] (-502.602) * (-502.412) [-500.961] (-504.306) (-502.257) -- 0:00:53
336500 -- (-501.967) (-505.559) (-501.660) [-502.996] * (-503.478) (-503.545) [-505.157] (-503.331) -- 0:00:53
337000 -- [-500.711] (-507.244) (-505.680) (-501.481) * [-501.301] (-506.127) (-505.907) (-504.756) -- 0:00:53
337500 -- (-502.938) (-503.711) [-505.768] (-502.432) * (-501.835) (-503.981) (-500.940) [-502.560] -- 0:00:53
338000 -- [-503.859] (-501.856) (-502.648) (-504.729) * [-501.818] (-503.886) (-502.898) (-502.631) -- 0:00:52
338500 -- [-500.689] (-504.883) (-509.117) (-503.324) * (-500.526) [-504.663] (-502.643) (-503.328) -- 0:00:52
339000 -- (-500.915) (-501.855) [-505.345] (-503.294) * (-504.124) [-500.600] (-503.275) (-502.783) -- 0:00:52
339500 -- (-507.166) (-501.032) (-503.957) [-503.738] * (-506.175) (-502.663) (-502.828) [-501.461] -- 0:00:52
340000 -- (-501.768) (-501.518) [-501.313] (-503.718) * [-503.610] (-505.275) (-504.475) (-502.444) -- 0:00:52
Average standard deviation of split frequencies: 0.016190
340500 -- (-505.640) [-501.567] (-504.564) (-501.836) * (-504.409) (-504.393) [-502.089] (-502.545) -- 0:00:52
341000 -- (-505.131) (-503.451) (-501.571) [-503.228] * (-503.579) (-502.092) (-503.107) [-502.636] -- 0:00:52
341500 -- (-503.347) [-501.550] (-502.621) (-503.136) * (-502.237) (-502.177) (-503.241) [-500.460] -- 0:00:52
342000 -- [-504.614] (-505.075) (-503.619) (-506.724) * [-504.945] (-500.745) (-505.248) (-501.311) -- 0:00:51
342500 -- (-505.263) (-503.265) (-500.995) [-502.933] * [-500.757] (-502.890) (-501.986) (-500.587) -- 0:00:51
343000 -- (-504.365) [-503.156] (-508.980) (-501.471) * (-501.312) (-501.560) (-502.669) [-500.854] -- 0:00:51
343500 -- [-504.828] (-500.806) (-504.479) (-501.183) * (-504.074) (-502.167) (-504.343) [-501.316] -- 0:00:51
344000 -- (-502.620) [-506.111] (-505.109) (-501.515) * (-505.218) (-504.063) [-501.738] (-501.729) -- 0:00:51
344500 -- (-501.725) (-505.160) [-505.285] (-503.747) * [-505.236] (-504.730) (-501.045) (-504.652) -- 0:00:53
345000 -- (-502.140) [-504.290] (-502.285) (-506.126) * (-502.550) (-502.026) [-502.433] (-506.734) -- 0:00:53
Average standard deviation of split frequencies: 0.015532
345500 -- (-504.691) (-502.467) (-501.115) [-502.989] * [-501.767] (-501.036) (-500.817) (-504.404) -- 0:00:53
346000 -- (-510.229) [-500.502] (-502.328) (-502.533) * (-502.544) [-501.656] (-506.355) (-502.103) -- 0:00:52
346500 -- (-502.055) [-504.507] (-502.538) (-503.767) * [-504.264] (-503.677) (-502.978) (-500.602) -- 0:00:52
347000 -- (-500.654) (-501.006) (-500.901) [-503.019] * (-504.361) (-503.650) [-502.925] (-500.518) -- 0:00:52
347500 -- (-505.068) [-503.014] (-502.985) (-500.978) * (-506.167) (-502.308) (-504.889) [-500.501] -- 0:00:52
348000 -- (-502.093) [-501.786] (-505.070) (-506.841) * (-504.614) (-502.308) [-501.774] (-501.608) -- 0:00:52
348500 -- (-504.203) [-501.163] (-504.475) (-507.289) * (-501.595) (-503.281) (-503.233) [-502.984] -- 0:00:52
349000 -- (-500.649) [-503.380] (-501.535) (-502.565) * [-504.449] (-505.755) (-501.352) (-503.142) -- 0:00:52
349500 -- (-500.770) (-505.652) (-502.814) [-504.581] * (-502.201) [-500.889] (-502.898) (-500.999) -- 0:00:52
350000 -- (-502.722) [-501.573] (-501.952) (-504.077) * (-504.375) (-500.944) [-501.302] (-504.564) -- 0:00:52
Average standard deviation of split frequencies: 0.016627
350500 -- (-501.910) [-505.178] (-502.039) (-504.432) * [-504.718] (-501.066) (-504.077) (-505.102) -- 0:00:51
351000 -- (-502.429) [-504.435] (-504.049) (-500.982) * (-502.354) [-501.218] (-502.432) (-503.292) -- 0:00:51
351500 -- (-502.592) [-504.836] (-508.365) (-501.448) * [-501.485] (-500.728) (-500.835) (-504.996) -- 0:00:51
352000 -- (-500.572) (-502.862) [-501.947] (-506.190) * (-503.212) (-503.888) [-504.305] (-500.815) -- 0:00:51
352500 -- [-502.172] (-501.312) (-503.946) (-505.651) * (-504.906) (-501.273) [-500.742] (-503.276) -- 0:00:51
353000 -- [-501.257] (-503.904) (-503.353) (-502.716) * (-500.999) (-502.120) (-502.192) [-501.431] -- 0:00:51
353500 -- [-501.673] (-503.669) (-501.403) (-503.006) * [-502.890] (-503.405) (-503.736) (-506.850) -- 0:00:51
354000 -- (-504.678) [-502.267] (-504.276) (-501.906) * [-501.703] (-504.195) (-503.711) (-503.389) -- 0:00:51
354500 -- (-503.577) (-501.387) [-502.804] (-501.578) * [-501.226] (-502.755) (-504.504) (-501.958) -- 0:00:50
355000 -- (-502.712) [-501.831] (-502.332) (-503.324) * [-501.236] (-505.693) (-502.621) (-502.707) -- 0:00:50
Average standard deviation of split frequencies: 0.016448
355500 -- (-512.420) (-501.135) [-501.346] (-502.472) * (-502.590) (-501.635) (-502.712) [-502.703] -- 0:00:50
356000 -- (-500.595) (-501.747) [-501.241] (-504.470) * (-502.712) [-506.345] (-503.204) (-501.104) -- 0:00:52
356500 -- (-500.475) (-508.179) [-503.833] (-502.267) * [-502.500] (-501.171) (-506.836) (-501.691) -- 0:00:52
357000 -- (-503.332) (-503.365) (-501.095) [-503.156] * (-501.801) [-501.499] (-504.838) (-502.047) -- 0:00:52
357500 -- (-503.763) (-506.800) (-502.134) [-504.089] * (-500.966) (-503.317) (-502.834) [-501.324] -- 0:00:52
358000 -- (-504.655) (-505.107) (-504.128) [-506.570] * [-500.410] (-503.143) (-502.851) (-500.447) -- 0:00:52
358500 -- (-506.044) (-502.310) [-503.507] (-506.002) * (-502.996) [-502.469] (-504.281) (-501.435) -- 0:00:51
359000 -- [-504.859] (-502.700) (-503.922) (-501.010) * (-502.410) [-503.596] (-502.203) (-501.156) -- 0:00:51
359500 -- (-506.800) (-502.756) [-501.696] (-502.446) * (-502.571) (-502.518) (-508.735) [-500.598] -- 0:00:51
360000 -- [-502.829] (-502.678) (-505.161) (-502.622) * [-502.152] (-505.648) (-501.166) (-509.181) -- 0:00:51
Average standard deviation of split frequencies: 0.016097
360500 -- [-503.551] (-502.499) (-505.340) (-503.623) * [-501.878] (-502.409) (-502.466) (-504.126) -- 0:00:51
361000 -- [-502.431] (-505.723) (-505.888) (-504.293) * [-502.248] (-503.068) (-502.078) (-503.477) -- 0:00:51
361500 -- (-502.998) (-503.932) [-503.797] (-503.686) * (-503.260) (-502.563) (-502.670) [-507.208] -- 0:00:51
362000 -- [-503.094] (-503.167) (-504.748) (-501.993) * (-502.565) (-508.343) [-502.507] (-504.071) -- 0:00:51
362500 -- (-504.808) [-502.215] (-504.107) (-506.376) * (-502.407) (-505.235) [-501.623] (-504.362) -- 0:00:51
363000 -- [-503.415] (-501.829) (-500.982) (-501.290) * [-502.466] (-501.151) (-503.400) (-504.630) -- 0:00:50
363500 -- (-505.505) (-505.477) [-501.400] (-506.452) * (-504.774) (-506.478) [-503.782] (-507.286) -- 0:00:50
364000 -- (-501.016) (-508.274) [-503.167] (-503.329) * [-501.334] (-503.959) (-507.538) (-502.113) -- 0:00:50
364500 -- (-504.592) (-502.559) [-503.193] (-501.464) * (-506.201) (-513.409) (-501.946) [-501.155] -- 0:00:50
365000 -- (-501.608) (-504.196) [-501.678] (-503.078) * (-501.934) (-503.635) (-501.734) [-504.199] -- 0:00:50
Average standard deviation of split frequencies: 0.015395
365500 -- (-502.718) [-503.279] (-503.177) (-502.496) * (-501.532) [-503.083] (-502.369) (-506.837) -- 0:00:50
366000 -- [-503.808] (-504.779) (-502.910) (-504.808) * [-502.059] (-504.719) (-501.106) (-503.355) -- 0:00:50
366500 -- (-504.055) [-500.874] (-500.711) (-503.568) * (-502.614) [-502.723] (-504.765) (-506.707) -- 0:00:50
367000 -- [-505.578] (-502.786) (-501.663) (-504.160) * (-506.473) (-503.345) (-515.814) [-504.444] -- 0:00:50
367500 -- (-500.891) (-501.892) [-502.840] (-505.064) * (-506.314) [-500.661] (-504.371) (-501.202) -- 0:00:49
368000 -- (-502.121) (-501.224) (-503.766) [-501.696] * [-502.836] (-505.567) (-502.231) (-501.591) -- 0:00:51
368500 -- [-502.740] (-504.651) (-503.582) (-503.615) * (-501.651) [-502.096] (-504.018) (-504.257) -- 0:00:51
369000 -- (-502.888) (-502.835) [-503.869] (-503.128) * [-501.346] (-503.768) (-502.556) (-509.249) -- 0:00:51
369500 -- (-504.351) (-504.106) (-504.876) [-502.489] * (-501.911) [-502.914] (-502.805) (-505.673) -- 0:00:51
370000 -- (-502.435) (-504.927) [-503.108] (-502.797) * [-501.636] (-501.233) (-502.034) (-501.362) -- 0:00:51
Average standard deviation of split frequencies: 0.014391
370500 -- (-502.670) [-502.683] (-504.019) (-514.454) * [-505.567] (-503.730) (-504.356) (-504.975) -- 0:00:50
371000 -- [-500.826] (-500.869) (-502.396) (-505.098) * (-505.528) [-502.970] (-501.896) (-504.124) -- 0:00:50
371500 -- (-500.856) [-502.496] (-504.100) (-504.049) * (-500.989) (-501.585) [-500.729] (-501.479) -- 0:00:50
372000 -- (-500.660) [-503.089] (-504.945) (-505.795) * (-504.877) [-501.876] (-501.503) (-503.811) -- 0:00:50
372500 -- (-500.892) (-507.121) (-501.744) [-506.457] * (-507.025) (-502.560) (-506.879) [-502.345] -- 0:00:50
373000 -- [-501.349] (-503.803) (-502.810) (-504.734) * (-501.288) (-503.713) [-500.635] (-502.054) -- 0:00:50
373500 -- [-505.227] (-503.670) (-504.114) (-502.021) * (-501.449) (-503.072) [-502.116] (-502.848) -- 0:00:50
374000 -- (-506.111) (-503.986) [-501.364] (-501.343) * (-501.274) [-503.780] (-500.680) (-509.458) -- 0:00:50
374500 -- (-506.140) (-508.261) (-503.346) [-504.138] * (-501.018) (-506.265) [-501.622] (-506.403) -- 0:00:50
375000 -- [-502.023] (-501.882) (-502.790) (-503.325) * (-502.479) (-501.815) (-501.681) [-504.154] -- 0:00:50
Average standard deviation of split frequencies: 0.013861
375500 -- (-506.972) [-501.615] (-502.162) (-502.060) * [-502.372] (-505.409) (-503.835) (-506.730) -- 0:00:49
376000 -- (-502.247) (-503.605) [-504.425] (-502.933) * (-504.070) (-503.782) (-503.308) [-503.893] -- 0:00:49
376500 -- (-501.219) (-503.101) [-501.852] (-508.181) * (-502.207) (-501.281) [-506.147] (-502.981) -- 0:00:49
377000 -- [-502.589] (-506.089) (-501.387) (-501.249) * (-504.188) [-500.815] (-501.837) (-504.158) -- 0:00:49
377500 -- (-504.046) (-503.981) (-505.194) [-502.016] * (-501.205) (-502.441) [-501.228] (-501.870) -- 0:00:49
378000 -- [-502.641] (-505.128) (-500.597) (-501.752) * [-501.061] (-501.079) (-503.972) (-503.102) -- 0:00:49
378500 -- [-503.557] (-504.596) (-500.611) (-501.942) * (-505.350) (-502.967) [-500.737] (-500.852) -- 0:00:49
379000 -- (-501.764) (-504.133) [-502.433] (-503.315) * (-509.044) [-501.205] (-505.320) (-501.059) -- 0:00:49
379500 -- (-503.304) (-504.811) [-501.744] (-507.120) * (-502.777) [-501.351] (-507.952) (-501.246) -- 0:00:49
380000 -- (-505.999) (-500.659) [-505.503] (-505.743) * (-500.836) (-502.418) [-502.932] (-501.760) -- 0:00:48
Average standard deviation of split frequencies: 0.013484
380500 -- (-503.189) (-501.427) [-502.939] (-502.664) * (-504.509) [-503.937] (-504.948) (-505.572) -- 0:00:50
381000 -- (-507.052) [-502.320] (-503.016) (-503.034) * [-503.629] (-503.866) (-503.870) (-503.700) -- 0:00:50
381500 -- [-501.341] (-510.763) (-505.417) (-506.408) * [-504.727] (-504.527) (-503.413) (-507.476) -- 0:00:50
382000 -- [-501.244] (-507.388) (-504.926) (-504.004) * (-501.494) [-500.708] (-502.630) (-500.998) -- 0:00:50
382500 -- (-500.735) [-504.719] (-501.565) (-505.532) * [-501.798] (-502.876) (-506.743) (-501.058) -- 0:00:50
383000 -- [-500.774] (-501.235) (-503.630) (-508.285) * [-501.422] (-501.909) (-504.459) (-502.051) -- 0:00:49
383500 -- (-501.696) [-500.650] (-502.225) (-505.576) * (-505.505) [-500.960] (-502.315) (-502.206) -- 0:00:49
384000 -- (-500.869) (-500.729) [-501.978] (-505.052) * (-503.328) (-504.565) (-502.985) [-503.148] -- 0:00:49
384500 -- (-503.010) (-501.572) [-503.136] (-502.014) * [-500.959] (-505.857) (-502.593) (-501.326) -- 0:00:49
385000 -- (-505.586) (-501.410) (-500.960) [-502.439] * (-501.213) (-504.916) [-501.716] (-501.481) -- 0:00:49
Average standard deviation of split frequencies: 0.013230
385500 -- (-506.382) [-501.764] (-502.242) (-502.193) * (-504.637) (-501.813) [-501.831] (-501.925) -- 0:00:49
386000 -- (-506.010) (-504.299) (-503.104) [-502.193] * [-503.053] (-502.074) (-503.588) (-501.170) -- 0:00:49
386500 -- (-507.760) (-500.783) (-502.452) [-502.332] * (-504.251) (-506.163) [-502.477] (-502.603) -- 0:00:49
387000 -- (-503.821) (-502.449) (-505.791) [-500.673] * (-502.595) (-502.446) (-504.231) [-501.968] -- 0:00:49
387500 -- (-506.337) (-500.473) (-501.160) [-502.456] * (-503.308) [-503.916] (-504.176) (-503.942) -- 0:00:49
388000 -- (-506.952) [-501.366] (-502.873) (-502.043) * (-506.289) (-503.152) [-502.361] (-506.098) -- 0:00:48
388500 -- [-501.505] (-501.633) (-508.781) (-500.987) * (-506.162) [-503.565] (-502.840) (-501.365) -- 0:00:48
389000 -- (-501.897) (-500.807) (-501.338) [-501.948] * (-502.718) [-500.792] (-501.623) (-505.855) -- 0:00:48
389500 -- (-503.024) (-504.447) (-503.351) [-501.672] * (-502.239) (-501.486) [-504.820] (-505.211) -- 0:00:48
390000 -- (-501.931) (-502.863) [-500.515] (-504.112) * [-502.547] (-503.726) (-502.981) (-507.556) -- 0:00:48
Average standard deviation of split frequencies: 0.013557
390500 -- (-502.103) (-504.129) [-502.067] (-500.924) * [-504.596] (-502.006) (-502.396) (-505.275) -- 0:00:48
391000 -- (-503.580) (-505.287) [-502.252] (-502.552) * [-502.381] (-506.748) (-513.481) (-501.652) -- 0:00:48
391500 -- (-504.582) (-503.440) (-501.404) [-506.374] * [-501.876] (-506.106) (-502.416) (-501.475) -- 0:00:48
392000 -- (-502.123) [-502.059] (-500.711) (-501.651) * (-502.415) [-501.360] (-501.268) (-502.102) -- 0:00:48
392500 -- (-504.290) (-501.868) [-502.376] (-501.177) * [-501.209] (-502.349) (-501.618) (-501.552) -- 0:00:47
393000 -- (-503.699) (-502.625) (-501.983) [-507.258] * (-503.491) [-500.524] (-501.891) (-502.459) -- 0:00:47
393500 -- (-504.971) [-500.871] (-502.257) (-502.705) * (-503.754) (-502.202) [-502.793] (-503.042) -- 0:00:49
394000 -- (-502.577) (-503.778) (-501.991) [-504.293] * (-503.446) (-501.648) (-501.756) [-502.426] -- 0:00:49
394500 -- (-502.426) (-504.342) (-502.130) [-503.832] * (-504.688) [-504.010] (-500.992) (-501.316) -- 0:00:49
395000 -- (-501.466) (-501.903) (-504.996) [-502.524] * [-501.634] (-503.317) (-501.380) (-503.306) -- 0:00:49
Average standard deviation of split frequencies: 0.012367
395500 -- [-501.356] (-502.793) (-502.208) (-503.397) * [-503.180] (-501.726) (-504.333) (-503.977) -- 0:00:48
396000 -- (-500.539) (-501.263) [-501.615] (-509.722) * (-503.103) [-501.196] (-504.466) (-504.955) -- 0:00:48
396500 -- (-500.891) (-502.204) [-501.491] (-506.013) * (-500.892) (-500.963) [-501.108] (-503.525) -- 0:00:48
397000 -- (-501.058) (-502.022) [-503.595] (-506.802) * (-505.531) [-501.718] (-501.896) (-503.571) -- 0:00:48
397500 -- [-501.729] (-502.334) (-504.867) (-507.948) * (-503.078) (-501.590) (-504.653) [-501.150] -- 0:00:48
398000 -- [-502.023] (-502.086) (-503.467) (-502.119) * (-501.979) (-501.101) (-502.274) [-504.279] -- 0:00:48
398500 -- (-502.479) (-501.484) [-504.980] (-502.081) * (-501.396) (-505.187) [-503.741] (-504.655) -- 0:00:48
399000 -- (-503.607) [-501.755] (-500.942) (-500.694) * [-501.301] (-504.252) (-506.414) (-506.069) -- 0:00:48
399500 -- (-502.741) (-502.660) (-501.004) [-500.603] * (-504.709) (-501.135) [-504.622] (-506.454) -- 0:00:48
400000 -- (-506.506) [-501.087] (-502.769) (-501.354) * [-502.683] (-501.927) (-501.306) (-500.870) -- 0:00:48
Average standard deviation of split frequencies: 0.013634
400500 -- [-502.910] (-505.886) (-506.150) (-505.124) * [-501.317] (-503.143) (-500.922) (-505.011) -- 0:00:47
401000 -- (-501.234) (-502.653) [-502.872] (-501.381) * (-503.860) [-501.273] (-503.290) (-500.833) -- 0:00:47
401500 -- [-505.089] (-502.399) (-505.492) (-502.917) * (-501.795) (-504.057) [-502.992] (-501.064) -- 0:00:47
402000 -- (-504.861) [-502.123] (-502.561) (-504.305) * (-502.524) (-502.488) [-502.827] (-502.016) -- 0:00:47
402500 -- (-502.739) (-502.868) (-502.317) [-503.580] * (-504.811) (-501.700) (-503.315) [-501.005] -- 0:00:47
403000 -- [-500.628] (-504.195) (-502.404) (-501.733) * [-503.052] (-501.579) (-502.893) (-507.284) -- 0:00:47
403500 -- (-500.649) (-502.323) (-504.261) [-501.858] * [-502.178] (-501.315) (-501.516) (-501.705) -- 0:00:47
404000 -- (-501.348) (-504.971) [-503.443] (-500.982) * (-503.134) [-501.133] (-503.358) (-502.349) -- 0:00:47
404500 -- (-501.843) [-502.063] (-501.294) (-504.153) * (-504.676) (-503.229) [-501.134] (-502.431) -- 0:00:47
405000 -- (-501.378) (-503.668) [-502.521] (-502.127) * (-502.042) (-504.703) (-501.526) [-501.575] -- 0:00:47
Average standard deviation of split frequencies: 0.013114
405500 -- (-500.764) (-500.851) (-505.561) [-502.716] * (-502.484) (-502.092) (-501.901) [-502.242] -- 0:00:46
406000 -- (-504.083) [-502.692] (-503.430) (-507.617) * (-502.053) [-501.416] (-503.432) (-505.246) -- 0:00:48
406500 -- (-504.055) (-501.554) [-502.361] (-502.788) * [-502.283] (-501.186) (-501.297) (-502.869) -- 0:00:48
407000 -- (-503.660) [-503.256] (-500.818) (-502.956) * [-501.588] (-501.036) (-501.343) (-502.244) -- 0:00:48
407500 -- (-502.471) (-509.451) [-502.928] (-500.752) * (-504.241) (-505.781) (-501.070) [-500.553] -- 0:00:47
408000 -- (-501.609) (-504.870) (-506.955) [-501.450] * (-502.716) (-500.647) (-501.010) [-501.317] -- 0:00:47
408500 -- (-501.525) [-502.438] (-502.749) (-500.795) * [-502.761] (-501.796) (-501.150) (-501.694) -- 0:00:47
409000 -- [-504.463] (-503.379) (-506.075) (-500.879) * (-501.412) (-503.166) [-502.738] (-505.205) -- 0:00:47
409500 -- (-504.937) (-503.734) [-505.635] (-506.865) * (-501.216) [-504.025] (-505.078) (-505.747) -- 0:00:47
410000 -- (-503.342) (-507.988) [-505.458] (-504.304) * (-503.937) (-503.905) [-502.313] (-503.341) -- 0:00:47
Average standard deviation of split frequencies: 0.013167
410500 -- (-501.558) (-504.936) [-503.879] (-501.794) * (-506.438) (-504.148) (-501.454) [-504.314] -- 0:00:47
411000 -- (-502.261) [-502.320] (-503.094) (-500.911) * (-502.506) (-504.904) [-501.699] (-503.308) -- 0:00:47
411500 -- (-501.082) (-501.195) [-500.948] (-504.186) * (-501.299) (-501.909) (-501.696) [-502.398] -- 0:00:47
412000 -- (-504.282) [-503.060] (-505.673) (-510.880) * (-500.778) (-502.256) (-503.780) [-502.649] -- 0:00:47
412500 -- [-506.110] (-504.432) (-502.847) (-501.386) * (-505.665) (-501.404) [-507.272] (-507.732) -- 0:00:47
413000 -- [-501.455] (-501.144) (-503.895) (-503.031) * (-502.200) (-501.595) [-502.477] (-501.106) -- 0:00:46
413500 -- (-502.299) (-503.583) [-504.991] (-503.272) * (-502.339) (-503.261) (-505.397) [-503.416] -- 0:00:46
414000 -- (-503.074) (-502.210) [-501.258] (-501.743) * (-502.540) (-504.367) (-502.234) [-502.661] -- 0:00:46
414500 -- (-506.885) (-501.557) [-502.942] (-502.904) * (-502.057) [-505.956] (-501.651) (-503.695) -- 0:00:46
415000 -- (-503.024) (-503.598) (-502.693) [-502.713] * [-500.712] (-502.293) (-503.557) (-506.066) -- 0:00:46
Average standard deviation of split frequencies: 0.012865
415500 -- (-501.156) (-503.830) (-503.087) [-501.275] * (-501.347) [-502.109] (-502.290) (-505.701) -- 0:00:46
416000 -- (-502.589) (-502.940) [-502.644] (-503.975) * (-500.899) (-504.097) [-500.690] (-500.735) -- 0:00:46
416500 -- [-501.752] (-502.091) (-501.751) (-505.590) * (-502.277) (-505.321) (-504.989) [-502.172] -- 0:00:46
417000 -- (-500.709) (-502.434) [-502.100] (-504.959) * (-501.919) (-503.871) [-501.863] (-502.922) -- 0:00:46
417500 -- (-501.965) [-501.783] (-503.664) (-501.711) * (-502.567) (-505.571) (-501.543) [-503.233] -- 0:00:46
418000 -- (-505.428) (-501.242) [-501.077] (-506.699) * (-501.196) [-501.256] (-503.521) (-501.285) -- 0:00:47
418500 -- [-503.134] (-507.220) (-500.508) (-506.128) * (-505.276) [-502.552] (-505.939) (-504.223) -- 0:00:47
419000 -- (-504.981) (-501.415) [-500.644] (-503.266) * (-502.590) [-504.750] (-505.038) (-505.462) -- 0:00:47
419500 -- (-502.929) (-506.367) (-503.340) [-501.832] * (-501.343) [-500.370] (-501.554) (-505.203) -- 0:00:47
420000 -- [-502.887] (-504.251) (-505.733) (-501.017) * (-502.969) [-500.468] (-503.691) (-505.929) -- 0:00:46
Average standard deviation of split frequencies: 0.012920
420500 -- (-508.139) (-504.218) (-505.138) [-501.544] * [-502.616] (-502.932) (-503.029) (-505.573) -- 0:00:46
421000 -- [-502.910] (-501.174) (-506.674) (-501.659) * (-503.918) [-502.788] (-503.216) (-506.417) -- 0:00:46
421500 -- (-501.030) (-500.817) (-501.263) [-502.079] * (-503.071) (-506.097) (-503.551) [-501.671] -- 0:00:46
422000 -- [-501.600] (-502.213) (-505.151) (-505.309) * [-503.698] (-501.480) (-500.635) (-505.296) -- 0:00:46
422500 -- (-502.590) [-502.062] (-505.957) (-502.015) * (-502.476) (-508.002) [-504.898] (-505.633) -- 0:00:46
423000 -- (-503.424) [-503.011] (-502.331) (-503.412) * [-502.843] (-501.222) (-501.495) (-508.220) -- 0:00:46
423500 -- (-502.989) (-506.761) [-501.176] (-502.112) * (-502.549) (-500.702) [-500.761] (-507.388) -- 0:00:46
424000 -- [-506.342] (-502.055) (-500.527) (-502.112) * [-501.301] (-502.268) (-503.235) (-506.261) -- 0:00:46
424500 -- (-507.014) (-501.258) (-500.396) [-501.624] * (-504.671) (-504.553) (-503.068) [-503.011] -- 0:00:46
425000 -- (-502.344) [-502.873] (-502.633) (-502.836) * (-503.767) (-504.194) (-501.406) [-503.311] -- 0:00:46
Average standard deviation of split frequencies: 0.012910
425500 -- (-502.472) (-501.611) [-502.201] (-501.673) * [-501.925] (-501.807) (-503.999) (-503.114) -- 0:00:45
426000 -- (-502.654) [-503.335] (-503.437) (-503.735) * (-502.013) (-501.290) [-501.342] (-503.698) -- 0:00:45
426500 -- (-500.886) (-500.479) (-502.348) [-503.384] * (-502.636) [-500.414] (-501.988) (-501.575) -- 0:00:45
427000 -- (-503.037) (-501.232) (-502.821) [-503.595] * [-502.500] (-503.003) (-502.104) (-502.385) -- 0:00:45
427500 -- (-504.947) (-505.124) [-504.107] (-504.014) * (-502.793) [-502.197] (-501.373) (-501.607) -- 0:00:45
428000 -- (-501.997) (-506.176) (-504.179) [-502.505] * (-501.337) (-501.273) (-501.389) [-501.054] -- 0:00:45
428500 -- [-500.887] (-510.181) (-501.271) (-508.711) * (-503.905) (-501.273) (-502.362) [-501.575] -- 0:00:45
429000 -- (-500.974) [-501.706] (-502.827) (-502.465) * (-504.533) (-500.483) (-501.787) [-502.694] -- 0:00:46
429500 -- (-503.302) (-503.077) [-504.386] (-504.326) * (-504.665) [-500.895] (-502.521) (-501.380) -- 0:00:46
430000 -- (-503.602) (-508.131) [-501.789] (-502.162) * (-504.365) (-500.831) [-501.261] (-503.216) -- 0:00:46
Average standard deviation of split frequencies: 0.014165
430500 -- (-500.837) (-504.101) (-502.925) [-503.232] * [-503.842] (-505.049) (-506.065) (-504.263) -- 0:00:46
431000 -- (-502.358) (-504.361) [-507.484] (-505.585) * (-501.468) [-501.960] (-502.772) (-502.210) -- 0:00:46
431500 -- (-501.355) (-501.222) (-503.169) [-502.984] * (-504.672) [-502.427] (-503.317) (-501.867) -- 0:00:46
432000 -- (-507.008) (-506.339) [-503.133] (-504.721) * [-501.944] (-501.898) (-500.949) (-502.504) -- 0:00:46
432500 -- [-500.905] (-503.794) (-501.856) (-506.027) * (-504.451) [-500.876] (-502.153) (-501.563) -- 0:00:45
433000 -- (-501.487) (-504.021) [-501.952] (-502.982) * [-502.568] (-501.960) (-501.810) (-501.930) -- 0:00:45
433500 -- [-501.793] (-501.278) (-502.275) (-510.609) * [-504.295] (-503.565) (-502.697) (-501.543) -- 0:00:45
434000 -- [-501.914] (-504.885) (-501.867) (-503.396) * (-502.139) [-502.838] (-501.280) (-501.420) -- 0:00:45
434500 -- [-502.677] (-505.471) (-507.344) (-502.190) * [-501.007] (-501.076) (-501.630) (-502.969) -- 0:00:45
435000 -- (-503.405) [-503.526] (-504.578) (-506.036) * (-502.274) (-501.067) (-506.733) [-501.255] -- 0:00:45
Average standard deviation of split frequencies: 0.013996
435500 -- (-501.741) [-503.409] (-505.166) (-503.231) * (-504.403) (-503.866) (-501.057) [-502.539] -- 0:00:45
436000 -- (-504.881) (-504.648) [-501.330] (-502.278) * [-500.884] (-503.373) (-504.448) (-501.624) -- 0:00:45
436500 -- (-506.918) (-502.450) [-501.665] (-502.810) * (-503.020) (-502.380) [-503.563] (-506.317) -- 0:00:45
437000 -- (-504.261) (-502.844) (-500.603) [-504.116] * [-506.197] (-501.840) (-506.043) (-502.455) -- 0:00:45
437500 -- (-502.797) [-501.249] (-502.141) (-508.301) * (-502.371) [-502.415] (-507.102) (-503.459) -- 0:00:45
438000 -- (-502.641) (-503.973) (-502.399) [-503.434] * (-504.662) (-508.276) (-505.043) [-501.820] -- 0:00:44
438500 -- (-503.031) (-502.235) (-500.784) [-502.395] * (-503.990) (-503.497) (-505.132) [-501.552] -- 0:00:44
439000 -- (-502.083) (-502.129) [-502.477] (-503.142) * (-502.340) (-500.611) (-507.897) [-502.035] -- 0:00:44
439500 -- (-502.506) [-501.646] (-501.767) (-501.113) * [-501.035] (-502.028) (-504.401) (-501.114) -- 0:00:44
440000 -- (-503.780) (-505.764) [-501.535] (-501.713) * [-502.679] (-504.205) (-502.658) (-500.521) -- 0:00:44
Average standard deviation of split frequencies: 0.013966
440500 -- (-502.564) (-504.031) (-501.878) [-503.709] * (-500.986) (-504.007) [-504.926] (-503.180) -- 0:00:44
441000 -- [-508.787] (-500.887) (-500.893) (-505.513) * [-502.474] (-502.682) (-504.177) (-503.707) -- 0:00:44
441500 -- (-503.613) (-502.251) [-501.486] (-507.352) * (-508.279) [-503.808] (-504.030) (-506.673) -- 0:00:44
442000 -- (-509.982) [-503.559] (-502.860) (-504.531) * (-506.432) [-505.003] (-504.928) (-512.826) -- 0:00:45
442500 -- (-501.185) [-502.961] (-502.739) (-504.263) * (-504.534) (-503.906) (-503.251) [-502.658] -- 0:00:45
443000 -- (-501.827) (-502.995) (-504.668) [-500.542] * (-504.268) [-505.003] (-501.148) (-502.780) -- 0:00:45
443500 -- (-501.196) (-503.247) [-506.469] (-504.348) * (-507.378) (-506.675) (-501.517) [-502.151] -- 0:00:45
444000 -- [-502.469] (-503.509) (-503.280) (-503.830) * [-503.107] (-503.427) (-504.087) (-501.119) -- 0:00:45
444500 -- (-503.798) (-506.656) [-501.813] (-502.537) * (-504.365) (-504.545) [-504.058] (-501.641) -- 0:00:44
445000 -- (-503.283) (-501.686) (-502.689) [-501.276] * [-502.331] (-502.377) (-507.693) (-501.586) -- 0:00:44
Average standard deviation of split frequencies: 0.014152
445500 -- (-501.937) [-502.526] (-503.610) (-502.075) * [-502.377] (-501.357) (-502.847) (-502.976) -- 0:00:44
446000 -- [-501.919] (-503.184) (-504.553) (-503.868) * (-501.643) [-503.499] (-505.026) (-504.614) -- 0:00:44
446500 -- (-504.292) (-500.626) (-506.875) [-511.315] * (-504.605) [-502.483] (-503.291) (-504.275) -- 0:00:44
447000 -- (-507.022) [-501.726] (-501.027) (-508.285) * [-504.011] (-503.606) (-504.568) (-501.532) -- 0:00:44
447500 -- (-506.794) (-502.179) [-503.620] (-501.052) * (-505.312) [-502.908] (-503.108) (-503.166) -- 0:00:44
448000 -- (-507.226) [-502.375] (-501.030) (-502.868) * (-503.437) (-502.412) [-500.953] (-502.020) -- 0:00:44
448500 -- (-501.915) [-507.300] (-503.495) (-506.510) * [-501.369] (-503.764) (-502.620) (-503.890) -- 0:00:44
449000 -- (-501.752) [-503.480] (-502.382) (-510.723) * [-501.052] (-501.480) (-504.536) (-501.739) -- 0:00:44
449500 -- (-501.250) (-502.529) (-501.745) [-502.185] * (-502.498) (-502.946) [-503.017] (-500.977) -- 0:00:44
450000 -- (-501.542) [-502.145] (-500.755) (-502.136) * (-504.280) (-504.689) [-502.783] (-503.997) -- 0:00:44
Average standard deviation of split frequencies: 0.014152
450500 -- (-501.479) [-500.708] (-504.461) (-500.800) * (-505.039) (-505.434) [-505.220] (-503.143) -- 0:00:43
451000 -- (-502.189) [-500.808] (-505.890) (-504.405) * (-501.680) (-501.324) (-506.479) [-502.329] -- 0:00:43
451500 -- [-501.748] (-503.635) (-503.894) (-504.239) * (-502.462) [-500.768] (-502.656) (-502.315) -- 0:00:43
452000 -- [-500.680] (-501.847) (-501.709) (-501.179) * (-503.913) [-504.071] (-501.039) (-503.869) -- 0:00:43
452500 -- (-503.016) (-504.423) [-507.247] (-502.046) * (-508.214) [-501.368] (-501.800) (-502.174) -- 0:00:43
453000 -- [-501.159] (-500.886) (-502.385) (-502.191) * (-503.023) (-501.564) (-509.561) [-500.962] -- 0:00:43
453500 -- (-501.092) [-501.296] (-502.526) (-504.972) * [-506.058] (-505.658) (-508.410) (-507.752) -- 0:00:43
454000 -- (-501.746) (-503.430) [-505.636] (-505.590) * (-510.824) (-502.874) (-502.175) [-502.136] -- 0:00:43
454500 -- (-503.886) [-501.612] (-504.398) (-508.192) * (-501.731) [-501.397] (-501.818) (-501.817) -- 0:00:44
455000 -- [-502.766] (-503.824) (-504.491) (-502.062) * (-501.107) (-508.892) (-501.431) [-501.447] -- 0:00:44
Average standard deviation of split frequencies: 0.014291
455500 -- [-503.453] (-501.776) (-502.919) (-502.330) * (-504.300) (-507.544) (-502.617) [-505.044] -- 0:00:44
456000 -- (-502.952) [-501.613] (-503.664) (-501.154) * (-505.137) (-502.571) (-501.423) [-504.052] -- 0:00:44
456500 -- (-506.448) [-502.264] (-505.557) (-502.800) * (-503.464) [-503.911] (-505.892) (-502.053) -- 0:00:44
457000 -- (-506.983) (-505.044) (-501.214) [-500.899] * (-502.334) [-504.541] (-505.208) (-504.020) -- 0:00:43
457500 -- [-503.169] (-502.290) (-501.793) (-500.681) * (-505.023) (-503.551) (-502.935) [-502.937] -- 0:00:43
458000 -- (-501.353) (-502.570) [-502.255] (-503.651) * (-502.283) (-502.647) (-506.125) [-501.291] -- 0:00:43
458500 -- (-502.876) [-503.418] (-505.516) (-501.373) * [-502.100] (-503.222) (-503.337) (-500.579) -- 0:00:43
459000 -- (-501.302) [-505.273] (-502.850) (-501.870) * [-505.882] (-503.466) (-503.132) (-502.682) -- 0:00:43
459500 -- (-500.621) (-505.618) [-504.700] (-503.836) * (-501.816) (-503.983) [-503.048] (-506.240) -- 0:00:43
460000 -- [-501.718] (-504.093) (-503.363) (-500.417) * (-501.369) [-501.943] (-503.061) (-504.131) -- 0:00:43
Average standard deviation of split frequencies: 0.013076
460500 -- [-502.357] (-504.662) (-501.591) (-509.048) * (-502.855) (-501.310) [-502.226] (-503.194) -- 0:00:43
461000 -- [-501.595] (-504.971) (-501.295) (-505.509) * (-500.687) [-502.584] (-500.944) (-504.979) -- 0:00:43
461500 -- (-503.184) (-502.040) [-503.439] (-507.270) * [-500.896] (-501.326) (-502.708) (-505.241) -- 0:00:43
462000 -- (-502.687) (-502.720) (-503.815) [-503.516] * (-501.269) [-503.774] (-506.373) (-504.018) -- 0:00:43
462500 -- [-502.014] (-503.072) (-501.716) (-502.622) * (-504.586) [-502.393] (-505.851) (-500.851) -- 0:00:43
463000 -- (-501.447) (-502.351) [-502.535] (-505.221) * (-502.164) [-501.341] (-505.543) (-503.555) -- 0:00:42
463500 -- (-502.603) (-501.056) [-502.447] (-504.156) * [-501.984] (-504.694) (-504.366) (-503.248) -- 0:00:42
464000 -- [-502.200] (-503.312) (-502.453) (-505.105) * (-502.319) [-502.632] (-506.170) (-500.558) -- 0:00:42
464500 -- [-501.594] (-501.806) (-503.350) (-502.035) * (-500.880) (-501.417) (-504.279) [-505.734] -- 0:00:42
465000 -- (-501.740) (-501.329) (-506.655) [-502.030] * (-500.892) (-501.957) (-502.930) [-503.420] -- 0:00:42
Average standard deviation of split frequencies: 0.013376
465500 -- (-506.648) [-501.542] (-501.198) (-501.314) * (-501.081) [-501.229] (-501.142) (-505.518) -- 0:00:42
466000 -- (-502.746) (-504.246) [-504.866] (-502.254) * [-503.476] (-501.450) (-502.502) (-501.997) -- 0:00:42
466500 -- [-502.289] (-501.365) (-500.756) (-505.125) * (-502.925) [-501.834] (-501.375) (-502.832) -- 0:00:42
467000 -- (-503.507) [-502.601] (-503.037) (-500.654) * (-501.776) [-503.093] (-501.809) (-505.792) -- 0:00:42
467500 -- [-501.023] (-503.141) (-505.128) (-501.884) * [-502.101] (-502.349) (-503.818) (-504.481) -- 0:00:43
468000 -- (-501.452) (-505.648) (-505.558) [-504.284] * (-506.058) (-502.995) (-501.618) [-502.896] -- 0:00:43
468500 -- (-502.114) (-505.260) (-504.992) [-504.177] * (-506.467) [-502.217] (-501.287) (-506.879) -- 0:00:43
469000 -- [-500.826] (-502.294) (-509.492) (-504.513) * [-503.066] (-503.729) (-501.409) (-500.884) -- 0:00:43
469500 -- [-502.284] (-501.567) (-502.162) (-502.657) * [-502.322] (-503.173) (-500.957) (-501.802) -- 0:00:42
470000 -- (-501.335) (-502.908) (-500.595) [-502.883] * (-502.760) [-506.118] (-501.112) (-502.405) -- 0:00:42
Average standard deviation of split frequencies: 0.014189
470500 -- [-502.097] (-505.633) (-502.884) (-501.741) * (-503.957) [-501.789] (-507.312) (-505.225) -- 0:00:42
471000 -- (-502.231) (-505.522) [-501.721] (-502.244) * (-502.878) (-501.526) (-502.403) [-503.959] -- 0:00:42
471500 -- [-505.424] (-503.696) (-501.827) (-503.015) * (-503.793) [-500.652] (-502.024) (-503.738) -- 0:00:42
472000 -- (-502.175) [-504.076] (-500.437) (-501.973) * (-504.548) (-504.570) [-506.201] (-502.773) -- 0:00:42
472500 -- (-502.515) [-501.223] (-504.472) (-503.274) * (-505.751) (-501.963) [-502.352] (-503.868) -- 0:00:42
473000 -- (-501.771) (-502.783) (-501.637) [-502.177] * [-505.461] (-507.132) (-506.109) (-504.235) -- 0:00:42
473500 -- [-503.231] (-507.034) (-501.867) (-502.443) * (-502.034) (-504.489) [-506.417] (-502.235) -- 0:00:42
474000 -- (-504.114) (-503.527) (-504.914) [-504.981] * [-501.759] (-507.517) (-503.142) (-503.755) -- 0:00:42
474500 -- [-502.011] (-505.871) (-509.342) (-502.066) * (-502.755) (-504.940) (-503.705) [-504.030] -- 0:00:42
475000 -- (-500.627) (-503.479) [-505.206] (-501.236) * (-504.829) [-503.058] (-502.501) (-502.398) -- 0:00:42
Average standard deviation of split frequencies: 0.013865
475500 -- (-503.393) [-501.436] (-501.802) (-501.363) * (-503.266) (-500.584) (-501.282) [-501.963] -- 0:00:41
476000 -- [-502.192] (-501.814) (-505.099) (-505.120) * (-502.632) (-501.380) (-504.677) [-507.429] -- 0:00:41
476500 -- (-501.845) [-501.360] (-501.697) (-502.833) * [-504.419] (-502.149) (-508.655) (-500.905) -- 0:00:41
477000 -- [-501.492] (-504.783) (-502.642) (-505.274) * (-504.204) (-502.812) (-508.057) [-505.710] -- 0:00:41
477500 -- (-503.116) (-502.614) [-502.501] (-508.315) * (-500.794) (-503.417) [-501.412] (-501.299) -- 0:00:41
478000 -- [-502.635] (-503.694) (-502.984) (-502.482) * (-501.915) (-501.706) [-503.101] (-503.878) -- 0:00:41
478500 -- [-505.696] (-502.624) (-503.647) (-502.054) * (-503.724) [-502.229] (-505.735) (-501.440) -- 0:00:41
479000 -- (-506.391) [-504.225] (-503.042) (-502.244) * (-503.265) (-502.845) [-503.492] (-500.737) -- 0:00:41
479500 -- [-502.162] (-502.115) (-500.491) (-501.355) * (-502.019) (-502.652) [-500.697] (-502.516) -- 0:00:41
480000 -- (-501.296) (-501.442) (-500.922) [-501.463] * (-501.510) (-501.983) [-501.169] (-502.479) -- 0:00:41
Average standard deviation of split frequencies: 0.013076
480500 -- (-501.445) (-503.984) [-501.270] (-502.611) * (-500.657) (-503.424) [-501.462] (-503.752) -- 0:00:42
481000 -- [-502.022] (-503.632) (-501.497) (-502.875) * [-501.182] (-502.862) (-502.052) (-501.034) -- 0:00:42
481500 -- (-501.783) (-505.780) [-502.047] (-502.597) * (-501.374) (-503.192) [-501.773] (-505.323) -- 0:00:41
482000 -- (-501.832) (-502.258) (-502.916) [-504.129] * [-505.455] (-501.002) (-502.167) (-506.722) -- 0:00:41
482500 -- (-500.780) (-503.364) (-503.560) [-505.443] * (-501.154) (-501.113) [-500.635] (-508.436) -- 0:00:41
483000 -- [-505.101] (-503.817) (-500.737) (-501.754) * (-506.275) (-502.615) [-503.980] (-501.685) -- 0:00:41
483500 -- (-503.112) [-503.144] (-502.231) (-502.385) * [-502.218] (-502.110) (-501.039) (-503.607) -- 0:00:41
484000 -- (-502.884) [-502.857] (-502.864) (-504.692) * (-501.561) (-504.458) [-502.926] (-504.017) -- 0:00:41
484500 -- [-503.332] (-501.917) (-504.299) (-507.243) * (-502.983) [-504.691] (-502.386) (-501.518) -- 0:00:41
485000 -- (-506.255) (-501.181) (-502.233) [-502.242] * (-502.604) (-500.593) [-502.365] (-501.321) -- 0:00:41
Average standard deviation of split frequencies: 0.012394
485500 -- (-504.381) [-501.084] (-500.685) (-501.059) * (-502.877) [-500.351] (-502.311) (-506.865) -- 0:00:41
486000 -- [-500.936] (-503.087) (-503.179) (-501.151) * [-504.477] (-501.209) (-503.878) (-501.703) -- 0:00:41
486500 -- [-503.712] (-503.111) (-503.927) (-500.921) * (-503.072) [-501.721] (-502.349) (-507.434) -- 0:00:41
487000 -- (-503.805) (-502.888) [-502.103] (-502.130) * [-510.280] (-502.106) (-503.914) (-503.756) -- 0:00:41
487500 -- [-503.060] (-502.707) (-501.341) (-502.429) * (-510.656) (-501.972) [-503.301] (-505.945) -- 0:00:41
488000 -- (-502.445) (-501.838) [-503.294] (-504.361) * [-504.666] (-503.507) (-500.911) (-503.654) -- 0:00:40
488500 -- (-502.158) (-501.362) [-502.107] (-503.127) * (-501.841) (-505.153) (-502.904) [-503.802] -- 0:00:40
489000 -- (-505.451) [-502.427] (-501.399) (-504.917) * (-501.454) [-505.970] (-509.918) (-503.490) -- 0:00:40
489500 -- [-501.890] (-502.841) (-503.229) (-504.405) * [-501.455] (-501.569) (-504.156) (-504.977) -- 0:00:40
490000 -- (-501.649) (-504.109) [-502.080] (-503.577) * (-505.670) (-500.683) [-503.408] (-500.871) -- 0:00:40
Average standard deviation of split frequencies: 0.012433
490500 -- [-501.188] (-506.173) (-502.419) (-507.527) * [-503.655] (-504.631) (-500.454) (-501.912) -- 0:00:40
491000 -- (-501.525) (-501.360) (-501.872) [-501.860] * (-502.221) (-507.171) [-502.218] (-503.404) -- 0:00:40
491500 -- (-500.966) (-501.977) (-503.963) [-502.021] * (-502.017) (-506.862) (-507.348) [-504.611] -- 0:00:40
492000 -- [-501.728] (-502.800) (-504.251) (-503.882) * (-500.582) [-500.840] (-506.279) (-500.915) -- 0:00:40
492500 -- (-501.347) (-502.653) [-500.948] (-503.368) * (-501.410) [-506.232] (-504.149) (-502.492) -- 0:00:40
493000 -- [-501.464] (-501.400) (-501.683) (-503.118) * (-501.532) (-501.759) (-502.536) [-502.107] -- 0:00:41
493500 -- [-502.523] (-508.832) (-502.717) (-502.675) * (-502.017) [-501.468] (-503.276) (-507.157) -- 0:00:41
494000 -- (-500.436) [-501.254] (-506.281) (-509.393) * (-501.947) (-501.880) (-503.698) [-505.194] -- 0:00:40
494500 -- [-506.321] (-509.662) (-501.914) (-502.056) * [-503.043] (-502.727) (-504.467) (-504.939) -- 0:00:40
495000 -- (-503.874) [-501.805] (-502.124) (-500.750) * (-501.048) [-503.886] (-500.592) (-502.919) -- 0:00:40
Average standard deviation of split frequencies: 0.012523
495500 -- (-504.492) [-503.659] (-502.626) (-501.038) * (-502.262) (-501.083) (-501.724) [-502.406] -- 0:00:40
496000 -- (-504.564) (-501.899) [-500.974] (-500.882) * (-500.605) (-501.612) (-500.925) [-502.385] -- 0:00:40
496500 -- (-501.721) (-500.858) (-501.577) [-505.077] * (-501.226) (-504.456) [-500.824] (-507.309) -- 0:00:40
497000 -- (-503.027) (-501.647) (-500.775) [-504.398] * [-502.136] (-506.529) (-503.285) (-505.726) -- 0:00:40
497500 -- (-503.436) [-501.164] (-503.040) (-502.381) * (-503.337) (-501.938) (-504.342) [-500.781] -- 0:00:40
498000 -- (-507.886) (-501.488) [-503.592] (-502.121) * (-500.658) (-501.760) (-503.857) [-502.164] -- 0:00:40
498500 -- (-506.203) (-501.954) (-501.446) [-501.252] * [-502.001] (-500.932) (-503.539) (-502.153) -- 0:00:40
499000 -- [-502.785] (-502.872) (-506.498) (-505.401) * (-503.646) (-501.197) (-501.635) [-500.425] -- 0:00:40
499500 -- [-501.982] (-504.476) (-502.168) (-506.801) * [-501.559] (-502.457) (-506.959) (-503.107) -- 0:00:40
500000 -- (-505.958) (-504.049) [-502.035] (-501.576) * (-501.765) (-500.954) [-501.268] (-505.535) -- 0:00:40
Average standard deviation of split frequencies: 0.012019
500500 -- (-501.535) (-502.079) (-502.851) [-501.306] * (-504.343) (-502.297) (-501.832) [-502.698] -- 0:00:39
501000 -- [-501.747] (-502.070) (-504.987) (-503.668) * (-501.895) [-500.429] (-503.100) (-503.368) -- 0:00:39
501500 -- [-501.217] (-502.436) (-502.238) (-502.934) * (-502.521) (-501.939) (-502.673) [-501.142] -- 0:00:39
502000 -- (-502.293) (-502.017) (-502.108) [-502.456] * (-504.275) [-501.768] (-504.170) (-503.122) -- 0:00:39
502500 -- (-504.381) (-503.488) (-501.186) [-501.257] * [-503.390] (-500.788) (-503.490) (-503.750) -- 0:00:39
503000 -- (-503.826) (-502.943) [-501.219] (-501.466) * (-501.497) (-500.688) [-504.146] (-503.419) -- 0:00:39
503500 -- (-505.013) (-502.958) (-501.402) [-507.021] * [-502.261] (-504.008) (-501.004) (-501.375) -- 0:00:39
504000 -- [-503.122] (-504.510) (-502.044) (-504.396) * (-501.161) [-502.817] (-504.064) (-501.484) -- 0:00:39
504500 -- (-501.227) (-502.662) [-501.287] (-502.403) * (-504.689) (-503.290) [-501.002] (-503.387) -- 0:00:39
505000 -- (-502.391) (-502.078) [-500.662] (-501.296) * (-502.046) (-506.397) [-501.306] (-504.163) -- 0:00:39
Average standard deviation of split frequencies: 0.012056
505500 -- [-502.923] (-504.195) (-503.092) (-501.584) * (-504.119) (-509.471) (-500.683) [-502.341] -- 0:00:39
506000 -- (-503.971) (-501.092) (-501.962) [-508.032] * (-502.027) (-505.903) (-503.224) [-500.976] -- 0:00:40
506500 -- [-500.786] (-503.377) (-502.479) (-500.930) * [-501.744] (-503.380) (-501.953) (-501.031) -- 0:00:39
507000 -- [-501.295] (-504.829) (-504.975) (-504.634) * (-503.567) (-504.473) (-500.869) [-502.081] -- 0:00:39
507500 -- (-501.902) (-506.473) [-501.059] (-504.171) * (-505.182) [-505.366] (-502.298) (-501.530) -- 0:00:39
508000 -- [-505.628] (-502.719) (-501.449) (-501.723) * [-503.964] (-505.484) (-504.747) (-504.111) -- 0:00:39
508500 -- [-502.870] (-504.181) (-500.945) (-503.556) * (-501.716) (-502.331) [-502.098] (-503.788) -- 0:00:39
509000 -- (-503.421) (-507.518) (-504.067) [-500.534] * (-502.568) (-503.884) (-501.417) [-502.675] -- 0:00:39
509500 -- (-502.196) (-504.467) [-501.391] (-500.534) * (-501.941) (-509.591) [-502.817] (-501.378) -- 0:00:39
510000 -- (-506.143) (-503.379) (-501.504) [-500.481] * (-501.862) (-502.250) (-500.910) [-501.378] -- 0:00:39
Average standard deviation of split frequencies: 0.011620
510500 -- (-501.291) (-505.576) (-501.145) [-500.610] * (-506.505) [-502.302] (-504.935) (-500.986) -- 0:00:39
511000 -- [-501.370] (-502.671) (-501.984) (-504.906) * (-505.052) (-506.785) (-503.899) [-502.074] -- 0:00:39
511500 -- (-502.022) (-500.830) (-502.449) [-502.805] * (-500.802) (-503.815) [-502.230] (-503.645) -- 0:00:39
512000 -- (-502.173) (-502.590) [-503.860] (-501.268) * (-503.267) [-504.273] (-501.097) (-502.025) -- 0:00:39
512500 -- (-509.104) (-501.929) (-501.238) [-503.904] * (-509.440) (-501.995) [-501.623] (-501.477) -- 0:00:39
513000 -- [-505.556] (-502.418) (-504.393) (-501.889) * (-504.398) (-502.528) (-505.206) [-502.132] -- 0:00:38
513500 -- [-501.838] (-504.932) (-504.197) (-502.369) * [-501.612] (-504.787) (-503.388) (-502.367) -- 0:00:38
514000 -- (-502.349) (-503.799) (-501.827) [-502.396] * (-505.771) (-503.780) (-502.702) [-500.982] -- 0:00:38
514500 -- [-500.707] (-504.121) (-503.330) (-501.653) * (-506.336) (-505.049) [-502.057] (-507.351) -- 0:00:38
515000 -- (-501.900) [-504.743] (-504.963) (-509.708) * (-508.582) (-505.202) (-505.320) [-501.381] -- 0:00:38
Average standard deviation of split frequencies: 0.010963
515500 -- (-505.358) (-503.303) [-503.077] (-502.363) * (-503.278) (-503.823) [-502.604] (-511.581) -- 0:00:38
516000 -- [-502.626] (-505.853) (-503.596) (-502.719) * (-506.899) (-505.145) (-503.450) [-500.473] -- 0:00:38
516500 -- (-501.851) (-508.152) (-502.411) [-503.619] * (-501.870) (-501.656) [-501.693] (-502.329) -- 0:00:38
517000 -- (-507.913) (-504.051) (-502.253) [-501.695] * [-501.538] (-504.173) (-501.503) (-501.154) -- 0:00:38
517500 -- [-505.189] (-504.147) (-504.913) (-501.179) * (-502.690) [-510.695] (-504.698) (-503.119) -- 0:00:38
518000 -- [-507.116] (-501.691) (-502.947) (-505.692) * (-503.242) (-507.319) (-501.194) [-503.293] -- 0:00:38
518500 -- (-500.781) (-503.122) (-503.317) [-505.574] * (-502.026) (-509.266) [-501.005] (-502.505) -- 0:00:38
519000 -- (-506.562) [-500.682] (-501.566) (-501.258) * (-500.810) (-504.075) (-500.844) [-502.205] -- 0:00:38
519500 -- [-502.337] (-508.300) (-500.731) (-503.341) * (-501.329) [-502.813] (-505.515) (-503.689) -- 0:00:38
520000 -- (-507.036) [-501.907] (-502.710) (-501.805) * (-504.736) (-502.497) [-504.849] (-503.249) -- 0:00:38
Average standard deviation of split frequencies: 0.010971
520500 -- (-500.833) (-501.225) [-503.843] (-502.791) * (-503.628) [-503.198] (-501.656) (-501.148) -- 0:00:38
521000 -- (-502.161) (-501.699) (-504.744) [-503.138] * [-501.121] (-502.888) (-503.108) (-503.636) -- 0:00:38
521500 -- (-505.072) [-502.972] (-504.271) (-503.716) * [-502.781] (-501.074) (-502.252) (-503.089) -- 0:00:38
522000 -- (-504.708) (-501.154) (-502.827) [-505.588] * (-500.913) (-502.990) (-502.822) [-501.104] -- 0:00:38
522500 -- (-501.029) (-500.796) (-503.092) [-503.109] * [-502.111] (-505.110) (-502.452) (-503.951) -- 0:00:38
523000 -- (-502.177) (-502.292) [-504.140] (-503.507) * (-503.404) (-500.981) (-508.847) [-500.852] -- 0:00:38
523500 -- [-502.403] (-503.924) (-501.650) (-501.762) * [-503.000] (-501.815) (-504.229) (-502.413) -- 0:00:38
524000 -- (-502.588) (-503.075) [-504.869] (-502.760) * (-502.637) (-502.639) (-503.743) [-500.502] -- 0:00:38
524500 -- (-503.528) [-502.194] (-502.396) (-501.766) * (-503.492) (-501.039) [-500.865] (-503.284) -- 0:00:38
525000 -- (-507.374) [-502.808] (-502.363) (-504.461) * (-504.875) [-502.639] (-503.224) (-505.688) -- 0:00:38
Average standard deviation of split frequencies: 0.010605
525500 -- (-500.902) (-501.067) [-502.298] (-502.236) * (-503.511) (-501.749) (-502.361) [-502.447] -- 0:00:37
526000 -- (-501.456) [-501.113] (-503.102) (-502.117) * [-502.052] (-500.842) (-502.234) (-502.849) -- 0:00:37
526500 -- (-506.666) (-502.555) [-503.794] (-504.502) * (-504.553) [-504.319] (-500.711) (-502.847) -- 0:00:37
527000 -- (-505.944) (-506.092) [-500.514] (-504.406) * (-502.432) (-502.184) [-500.771] (-501.246) -- 0:00:37
527500 -- (-505.348) [-506.481] (-500.578) (-504.972) * (-501.838) [-500.981] (-502.155) (-500.831) -- 0:00:37
528000 -- (-501.992) [-501.073] (-502.199) (-503.404) * (-503.987) (-501.800) (-501.317) [-501.602] -- 0:00:37
528500 -- [-502.332] (-500.802) (-502.741) (-501.189) * (-500.780) (-501.263) (-500.631) [-501.723] -- 0:00:37
529000 -- (-503.694) [-501.690] (-502.793) (-500.836) * (-502.588) (-500.882) [-505.476] (-506.417) -- 0:00:37
529500 -- [-501.090] (-503.158) (-504.307) (-502.360) * (-503.035) (-503.667) [-503.319] (-502.345) -- 0:00:37
530000 -- (-502.029) (-501.961) (-504.827) [-502.294] * (-502.316) (-501.192) (-501.173) [-504.400] -- 0:00:37
Average standard deviation of split frequencies: 0.010117
530500 -- (-503.972) (-504.243) [-506.815] (-501.433) * (-503.029) (-501.736) (-500.766) [-503.584] -- 0:00:37
531000 -- (-502.953) (-501.355) [-503.908] (-505.391) * [-501.381] (-502.804) (-500.356) (-500.787) -- 0:00:37
531500 -- (-502.388) (-504.248) [-504.386] (-504.630) * (-503.232) [-501.707] (-502.075) (-508.166) -- 0:00:37
532000 -- (-502.220) (-506.091) [-504.162] (-502.160) * (-502.838) (-501.213) [-502.640] (-502.200) -- 0:00:37
532500 -- (-502.511) (-503.307) (-501.607) [-503.893] * (-504.097) (-503.036) [-501.779] (-505.145) -- 0:00:37
533000 -- (-502.313) (-502.348) (-502.714) [-502.534] * [-501.840] (-502.644) (-508.137) (-501.054) -- 0:00:37
533500 -- (-506.026) (-502.356) (-506.443) [-503.042] * (-505.960) (-501.214) (-504.631) [-500.712] -- 0:00:37
534000 -- [-501.807] (-502.586) (-501.124) (-504.591) * [-505.645] (-502.104) (-502.533) (-500.833) -- 0:00:37
534500 -- (-501.056) (-502.033) [-502.409] (-504.548) * (-501.204) (-505.699) [-504.652] (-501.290) -- 0:00:37
535000 -- (-501.946) (-500.587) (-501.118) [-502.125] * [-502.326] (-504.470) (-501.440) (-500.315) -- 0:00:37
Average standard deviation of split frequencies: 0.010456
535500 -- [-502.482] (-500.604) (-504.878) (-501.782) * [-502.805] (-503.074) (-502.938) (-502.588) -- 0:00:37
536000 -- (-503.608) (-501.524) [-501.798] (-501.821) * [-501.893] (-502.594) (-502.060) (-500.963) -- 0:00:37
536500 -- (-505.074) (-502.207) (-505.336) [-505.014] * (-502.588) [-501.816] (-500.759) (-504.185) -- 0:00:37
537000 -- (-503.677) [-501.700] (-502.274) (-505.226) * (-501.680) (-504.390) [-500.945] (-505.119) -- 0:00:37
537500 -- (-502.147) (-504.666) [-500.960] (-503.240) * (-502.740) (-509.157) (-502.140) [-501.541] -- 0:00:37
538000 -- (-502.493) (-500.801) (-502.261) [-501.530] * [-501.498] (-503.130) (-502.621) (-503.182) -- 0:00:36
538500 -- [-503.118] (-502.418) (-503.837) (-501.108) * (-504.073) (-500.659) (-502.689) [-503.212] -- 0:00:36
539000 -- (-500.992) (-502.638) [-503.597] (-503.455) * [-501.916] (-502.512) (-502.420) (-503.593) -- 0:00:36
539500 -- (-502.133) (-504.219) (-507.137) [-505.718] * [-502.160] (-506.424) (-503.083) (-504.621) -- 0:00:36
540000 -- (-502.488) (-505.180) [-507.389] (-505.702) * [-500.306] (-500.557) (-508.336) (-503.763) -- 0:00:36
Average standard deviation of split frequencies: 0.010221
540500 -- (-503.662) (-500.825) (-505.759) [-501.925] * (-503.790) [-502.570] (-503.710) (-505.305) -- 0:00:36
541000 -- [-504.505] (-500.466) (-502.775) (-506.649) * (-501.768) [-501.829] (-502.804) (-501.290) -- 0:00:36
541500 -- [-502.384] (-501.340) (-507.726) (-501.502) * (-507.974) [-501.819] (-503.913) (-507.409) -- 0:00:36
542000 -- (-503.130) (-503.172) (-508.908) [-503.231] * (-504.491) [-502.970] (-502.902) (-500.642) -- 0:00:36
542500 -- [-503.415] (-501.444) (-502.514) (-503.002) * [-503.808] (-502.722) (-503.665) (-506.064) -- 0:00:36
543000 -- [-503.064] (-501.317) (-504.020) (-502.299) * [-501.890] (-503.144) (-501.067) (-504.452) -- 0:00:36
543500 -- (-502.005) (-504.188) (-503.832) [-501.546] * (-505.714) (-505.667) [-501.589] (-502.124) -- 0:00:36
544000 -- (-504.314) [-504.539] (-501.337) (-500.414) * (-502.394) [-502.313] (-505.433) (-502.124) -- 0:00:36
544500 -- (-501.939) (-506.669) (-501.539) [-502.537] * (-500.547) [-501.768] (-501.162) (-502.795) -- 0:00:36
545000 -- (-504.640) [-501.071] (-501.601) (-500.589) * (-501.394) [-507.511] (-504.023) (-504.866) -- 0:00:36
Average standard deviation of split frequencies: 0.009641
545500 -- [-502.471] (-500.435) (-501.111) (-501.642) * (-503.129) (-502.701) (-500.989) [-502.820] -- 0:00:36
546000 -- (-503.554) (-502.805) (-503.707) [-502.211] * [-503.474] (-502.985) (-502.348) (-503.579) -- 0:00:36
546500 -- (-502.302) (-505.802) [-502.540] (-501.753) * (-504.503) (-502.793) [-504.133] (-505.643) -- 0:00:36
547000 -- [-501.250] (-505.315) (-501.128) (-505.553) * (-503.180) (-503.151) [-505.740] (-505.076) -- 0:00:36
547500 -- [-502.861] (-501.335) (-501.187) (-502.710) * [-501.124] (-501.833) (-501.495) (-504.994) -- 0:00:36
548000 -- [-500.670] (-501.821) (-506.135) (-503.441) * (-502.606) (-502.608) (-506.367) [-501.236] -- 0:00:36
548500 -- [-503.919] (-501.238) (-503.916) (-501.624) * [-502.949] (-502.124) (-504.503) (-502.678) -- 0:00:36
549000 -- (-503.794) [-500.735] (-501.302) (-500.925) * [-504.127] (-502.095) (-503.195) (-502.865) -- 0:00:36
549500 -- (-502.342) [-501.119] (-502.433) (-500.963) * (-503.391) [-503.772] (-503.032) (-503.571) -- 0:00:36
550000 -- (-502.019) [-501.297] (-503.256) (-500.786) * (-503.192) (-503.317) (-502.746) [-502.360] -- 0:00:36
Average standard deviation of split frequencies: 0.010122
550500 -- (-500.503) (-504.904) (-503.087) [-501.482] * (-502.898) [-502.544] (-502.265) (-501.979) -- 0:00:35
551000 -- (-501.144) (-505.613) (-502.071) [-502.313] * (-503.444) [-503.219] (-501.159) (-502.921) -- 0:00:35
551500 -- (-503.448) (-503.317) (-502.629) [-501.326] * [-503.714] (-502.836) (-500.815) (-502.815) -- 0:00:35
552000 -- (-501.297) [-502.214] (-501.644) (-501.292) * (-503.753) (-504.509) [-505.308] (-507.262) -- 0:00:35
552500 -- (-503.274) (-501.690) [-504.890] (-502.649) * (-500.938) [-502.678] (-501.460) (-501.258) -- 0:00:35
553000 -- (-504.578) (-508.114) (-502.183) [-501.344] * (-502.101) (-502.520) (-500.893) [-501.568] -- 0:00:35
553500 -- [-504.976] (-501.657) (-502.270) (-501.185) * (-501.893) (-502.074) (-501.345) [-501.426] -- 0:00:35
554000 -- (-501.870) [-505.294] (-500.961) (-503.824) * (-502.412) [-501.239] (-501.086) (-501.002) -- 0:00:35
554500 -- (-505.077) (-503.313) (-502.586) [-501.493] * (-501.742) (-503.660) [-501.491] (-500.387) -- 0:00:35
555000 -- (-506.382) (-505.530) (-502.216) [-500.718] * (-502.711) (-502.974) [-502.249] (-502.822) -- 0:00:35
Average standard deviation of split frequencies: 0.010015
555500 -- [-502.049] (-502.026) (-503.550) (-501.661) * (-501.173) (-501.990) [-502.719] (-504.163) -- 0:00:35
556000 -- [-502.555] (-502.358) (-504.495) (-507.068) * (-501.081) (-503.590) (-501.557) [-503.261] -- 0:00:35
556500 -- (-501.559) (-504.057) (-506.674) [-504.469] * (-501.834) (-502.565) [-502.251] (-503.170) -- 0:00:35
557000 -- (-503.406) (-505.695) [-504.377] (-504.719) * [-501.705] (-501.932) (-504.632) (-502.759) -- 0:00:34
557500 -- [-502.461] (-502.559) (-504.213) (-506.559) * (-501.090) (-504.698) [-501.785] (-500.281) -- 0:00:35
558000 -- (-502.241) (-503.653) [-504.156] (-504.002) * (-501.456) (-503.572) (-501.448) [-501.710] -- 0:00:35
558500 -- (-504.332) (-501.082) (-502.006) [-502.961] * (-502.979) (-502.729) [-501.177] (-507.845) -- 0:00:35
559000 -- (-504.949) [-503.840] (-502.890) (-502.792) * (-501.961) (-502.371) [-501.137] (-507.352) -- 0:00:35
559500 -- (-502.561) (-507.052) [-503.171] (-502.572) * (-503.332) [-504.971] (-502.982) (-507.345) -- 0:00:35
560000 -- [-503.860] (-501.595) (-506.583) (-507.775) * (-504.404) [-503.265] (-500.714) (-504.679) -- 0:00:35
Average standard deviation of split frequencies: 0.010090
560500 -- (-506.800) (-502.636) (-502.142) [-502.811] * [-502.318] (-501.310) (-506.390) (-500.654) -- 0:00:35
561000 -- [-502.188] (-501.577) (-502.965) (-502.550) * (-504.206) (-501.084) (-507.282) [-502.376] -- 0:00:35
561500 -- (-500.907) (-503.913) [-504.575] (-504.083) * (-503.535) [-506.150] (-501.733) (-501.671) -- 0:00:35
562000 -- (-503.100) [-501.563] (-502.514) (-508.306) * (-504.897) [-502.439] (-501.903) (-503.043) -- 0:00:35
562500 -- [-503.587] (-504.952) (-503.867) (-505.288) * [-503.554] (-502.367) (-503.594) (-502.215) -- 0:00:35
563000 -- (-508.268) (-503.534) [-501.252] (-507.360) * (-502.613) [-504.303] (-502.415) (-502.194) -- 0:00:34
563500 -- [-504.420] (-504.166) (-502.917) (-503.416) * [-503.799] (-510.548) (-503.756) (-503.922) -- 0:00:34
564000 -- (-503.846) (-502.829) [-501.146] (-501.363) * (-502.377) (-502.539) [-503.017] (-504.655) -- 0:00:34
564500 -- (-503.862) (-504.983) (-501.443) [-501.180] * [-500.813] (-502.642) (-503.475) (-504.523) -- 0:00:34
565000 -- (-504.064) [-503.095] (-502.718) (-503.555) * (-505.997) [-501.596] (-501.596) (-501.921) -- 0:00:34
Average standard deviation of split frequencies: 0.010386
565500 -- (-501.149) (-500.511) (-500.841) [-500.721] * (-501.331) [-502.526] (-501.693) (-500.703) -- 0:00:34
566000 -- [-501.588] (-501.086) (-506.814) (-502.106) * (-501.172) (-503.780) (-502.557) [-503.078] -- 0:00:34
566500 -- (-502.603) (-507.093) (-504.803) [-504.998] * (-505.932) (-506.292) (-504.134) [-501.004] -- 0:00:34
567000 -- (-502.217) (-503.663) (-502.155) [-503.443] * (-503.839) (-505.021) (-503.199) [-500.750] -- 0:00:34
567500 -- (-501.753) (-504.463) (-503.030) [-503.229] * (-504.692) [-501.742] (-504.174) (-504.658) -- 0:00:34
568000 -- (-503.514) (-503.252) (-502.302) [-501.302] * (-501.899) [-500.658] (-505.280) (-507.419) -- 0:00:34
568500 -- (-501.749) (-503.520) (-503.263) [-502.653] * (-503.061) [-500.668] (-504.830) (-501.783) -- 0:00:34
569000 -- (-501.675) [-503.116] (-501.670) (-503.102) * (-501.062) [-501.125] (-502.232) (-501.154) -- 0:00:34
569500 -- (-505.124) (-503.883) (-502.934) [-502.309] * (-500.759) (-501.812) [-503.108] (-503.321) -- 0:00:34
570000 -- (-503.181) (-502.664) [-504.369] (-503.804) * [-500.773] (-507.183) (-505.925) (-508.267) -- 0:00:33
Average standard deviation of split frequencies: 0.010399
570500 -- (-503.289) [-502.121] (-504.512) (-503.393) * [-506.065] (-503.205) (-501.470) (-504.341) -- 0:00:34
571000 -- [-501.472] (-504.353) (-508.036) (-500.868) * (-502.447) [-503.566] (-500.408) (-502.888) -- 0:00:34
571500 -- (-501.736) [-501.816] (-503.929) (-503.326) * (-503.870) (-505.562) (-501.747) [-503.911] -- 0:00:34
572000 -- [-503.915] (-501.738) (-504.571) (-504.457) * [-501.032] (-502.851) (-502.459) (-500.899) -- 0:00:34
572500 -- [-503.801] (-502.284) (-504.216) (-502.723) * (-501.341) [-502.380] (-503.357) (-507.024) -- 0:00:34
573000 -- (-502.326) [-502.382] (-503.669) (-507.818) * (-502.267) (-502.379) (-501.013) [-501.257] -- 0:00:34
573500 -- (-503.424) (-500.856) [-502.618] (-504.738) * [-503.072] (-504.791) (-501.535) (-503.094) -- 0:00:34
574000 -- (-502.565) (-502.213) (-502.643) [-503.285] * (-503.803) (-500.667) [-503.393] (-505.727) -- 0:00:34
574500 -- (-502.908) (-501.230) [-502.950] (-501.755) * (-501.271) (-502.736) (-501.768) [-507.334] -- 0:00:34
575000 -- (-501.531) [-506.184] (-502.720) (-504.990) * [-500.600] (-501.810) (-501.510) (-506.217) -- 0:00:34
Average standard deviation of split frequencies: 0.010013
575500 -- [-501.638] (-501.576) (-500.484) (-501.712) * (-502.052) [-501.465] (-506.741) (-506.850) -- 0:00:33
576000 -- [-503.645] (-505.123) (-500.496) (-505.659) * (-504.585) (-505.553) (-503.894) [-505.293] -- 0:00:33
576500 -- [-503.892] (-503.381) (-502.223) (-503.782) * [-503.681] (-506.560) (-502.372) (-503.079) -- 0:00:33
577000 -- (-504.558) [-503.271] (-501.717) (-500.784) * (-506.341) [-502.464] (-503.713) (-501.457) -- 0:00:33
577500 -- (-501.922) (-504.082) [-503.940] (-502.165) * [-503.830] (-501.953) (-507.763) (-504.501) -- 0:00:33
578000 -- (-502.231) (-502.004) [-502.235] (-503.837) * [-504.160] (-502.141) (-509.023) (-503.102) -- 0:00:33
578500 -- [-504.731] (-506.116) (-501.265) (-501.248) * (-503.771) (-502.533) [-503.174] (-501.561) -- 0:00:33
579000 -- (-504.218) [-501.615] (-501.096) (-501.748) * (-502.197) (-503.363) (-502.776) [-501.027] -- 0:00:33
579500 -- (-503.769) [-502.463] (-505.508) (-505.160) * (-503.533) [-504.416] (-502.765) (-501.789) -- 0:00:33
580000 -- (-503.477) (-506.652) (-504.409) [-500.849] * (-501.364) (-501.727) [-500.933] (-502.511) -- 0:00:33
Average standard deviation of split frequencies: 0.010220
580500 -- (-501.810) (-503.392) (-501.919) [-500.467] * [-501.283] (-501.617) (-501.899) (-501.305) -- 0:00:33
581000 -- [-503.710] (-502.173) (-503.140) (-501.956) * (-502.263) (-503.017) [-501.881] (-507.146) -- 0:00:33
581500 -- (-504.412) [-500.803] (-503.954) (-508.567) * (-505.785) [-501.056] (-501.307) (-502.641) -- 0:00:33
582000 -- [-504.481] (-502.065) (-503.679) (-503.639) * (-502.657) [-503.018] (-503.256) (-503.597) -- 0:00:33
582500 -- [-502.044] (-504.314) (-510.261) (-502.199) * (-505.459) [-501.125] (-501.973) (-501.241) -- 0:00:32
583000 -- [-501.691] (-501.639) (-501.341) (-501.656) * [-504.759] (-504.424) (-503.750) (-503.238) -- 0:00:33
583500 -- (-501.802) (-501.391) (-505.181) [-503.997] * (-502.650) [-505.239] (-502.926) (-503.554) -- 0:00:33
584000 -- (-503.629) (-505.639) (-501.776) [-503.582] * (-501.597) (-501.833) [-502.871] (-504.149) -- 0:00:33
584500 -- (-508.663) (-501.443) [-504.059] (-502.562) * (-502.758) (-504.407) [-501.763] (-503.330) -- 0:00:33
585000 -- (-503.059) [-502.264] (-505.599) (-502.455) * (-501.912) (-502.404) (-503.145) [-501.651] -- 0:00:33
Average standard deviation of split frequencies: 0.010268
585500 -- (-501.171) [-502.951] (-506.850) (-502.017) * (-501.685) (-502.094) [-501.220] (-502.386) -- 0:00:33
586000 -- [-500.839] (-502.697) (-503.830) (-504.455) * [-501.100] (-504.197) (-503.936) (-501.864) -- 0:00:33
586500 -- (-502.596) [-501.107] (-501.495) (-507.354) * [-501.212] (-502.914) (-502.832) (-500.594) -- 0:00:33
587000 -- (-502.417) (-500.667) (-502.278) [-504.362] * [-503.935] (-502.079) (-506.492) (-502.830) -- 0:00:33
587500 -- (-504.408) (-501.358) [-501.669] (-503.168) * (-503.082) (-501.465) (-504.439) [-501.740] -- 0:00:33
588000 -- [-503.734] (-501.733) (-506.555) (-502.712) * (-502.341) [-502.768] (-501.158) (-501.786) -- 0:00:32
588500 -- (-503.098) (-506.366) [-503.698] (-504.763) * (-502.637) (-504.869) [-502.332] (-502.602) -- 0:00:32
589000 -- [-502.505] (-502.250) (-501.850) (-502.927) * [-503.397] (-501.817) (-504.492) (-505.151) -- 0:00:32
589500 -- (-501.935) (-502.255) [-502.126] (-505.786) * (-502.511) (-501.174) [-505.696] (-503.061) -- 0:00:32
590000 -- (-503.447) (-502.163) (-503.838) [-501.554] * (-501.018) [-500.951] (-513.181) (-501.314) -- 0:00:32
Average standard deviation of split frequencies: 0.010234
590500 -- (-502.047) (-501.491) (-503.114) [-501.799] * (-504.464) (-503.710) [-502.670] (-503.278) -- 0:00:32
591000 -- (-503.630) [-501.965] (-501.709) (-501.678) * (-504.175) [-502.394] (-501.292) (-503.777) -- 0:00:32
591500 -- (-503.083) (-500.746) [-501.172] (-502.494) * (-502.533) (-507.529) (-500.491) [-503.893] -- 0:00:32
592000 -- (-506.107) [-501.536] (-501.469) (-501.268) * (-503.415) (-501.839) (-503.512) [-502.335] -- 0:00:32
592500 -- (-508.974) [-502.234] (-500.964) (-503.182) * [-503.393] (-501.193) (-502.505) (-502.197) -- 0:00:32
593000 -- (-501.009) (-502.374) [-504.311] (-504.529) * (-503.744) (-503.935) [-506.261] (-503.186) -- 0:00:32
593500 -- (-505.838) (-502.582) (-505.249) [-504.333] * (-501.679) (-504.494) (-501.384) [-500.617] -- 0:00:32
594000 -- (-501.930) [-502.477] (-501.392) (-502.744) * [-502.827] (-503.115) (-503.413) (-501.611) -- 0:00:32
594500 -- (-500.909) (-503.815) (-502.235) [-502.017] * (-501.524) (-504.086) (-501.591) [-503.137] -- 0:00:32
595000 -- [-502.569] (-506.754) (-501.996) (-501.748) * (-507.088) (-506.023) (-504.052) [-500.654] -- 0:00:31
Average standard deviation of split frequencies: 0.010050
595500 -- [-502.535] (-502.707) (-501.072) (-501.295) * (-503.375) [-501.294] (-500.979) (-500.467) -- 0:00:31
596000 -- (-504.207) (-502.860) [-501.235] (-503.708) * [-502.447] (-501.453) (-503.310) (-504.908) -- 0:00:32
596500 -- [-503.519] (-500.926) (-503.274) (-508.922) * (-504.063) (-503.287) (-501.818) [-502.325] -- 0:00:32
597000 -- (-502.388) (-501.074) (-502.750) [-502.299] * [-501.776] (-500.947) (-504.040) (-501.788) -- 0:00:32
597500 -- (-502.600) (-503.559) (-501.406) [-503.225] * (-503.120) [-504.276] (-505.025) (-503.438) -- 0:00:32
598000 -- (-506.509) (-503.404) [-501.172] (-502.451) * (-501.441) (-504.199) [-502.134] (-506.355) -- 0:00:32
598500 -- (-502.528) (-503.860) [-503.016] (-501.064) * (-502.669) (-501.787) [-500.420] (-500.843) -- 0:00:32
599000 -- (-502.787) [-502.441] (-502.467) (-501.856) * [-501.536] (-502.252) (-503.713) (-501.590) -- 0:00:32
599500 -- [-507.177] (-503.148) (-504.795) (-501.361) * (-501.849) (-501.035) [-502.803] (-502.364) -- 0:00:32
600000 -- [-504.351] (-504.619) (-501.775) (-503.129) * (-506.409) (-505.028) [-502.312] (-502.466) -- 0:00:32
Average standard deviation of split frequencies: 0.010387
600500 -- [-503.962] (-505.792) (-506.562) (-506.981) * [-501.285] (-500.974) (-504.974) (-501.226) -- 0:00:31
601000 -- [-502.162] (-506.333) (-502.359) (-504.427) * (-500.632) (-502.198) [-501.847] (-501.762) -- 0:00:31
601500 -- (-501.180) [-503.627] (-502.129) (-502.772) * (-500.964) [-501.305] (-501.163) (-503.906) -- 0:00:31
602000 -- (-501.580) (-506.928) (-500.752) [-502.383] * (-502.141) (-501.258) [-503.084] (-500.765) -- 0:00:31
602500 -- (-503.438) (-501.672) (-501.158) [-508.115] * (-501.012) [-507.176] (-502.201) (-504.576) -- 0:00:31
603000 -- (-504.520) [-503.532] (-500.533) (-506.805) * (-504.145) (-502.763) [-502.847] (-504.408) -- 0:00:31
603500 -- (-506.223) [-501.806] (-502.377) (-501.275) * (-504.935) (-504.309) (-504.085) [-502.336] -- 0:00:31
604000 -- [-502.623] (-503.090) (-500.875) (-505.106) * [-501.473] (-510.565) (-504.152) (-502.763) -- 0:00:31
604500 -- (-506.297) [-503.836] (-501.199) (-501.527) * [-504.481] (-508.440) (-501.689) (-502.866) -- 0:00:31
605000 -- [-503.408] (-501.557) (-503.531) (-504.059) * (-504.957) (-501.557) [-503.122] (-503.976) -- 0:00:31
Average standard deviation of split frequencies: 0.010753
605500 -- (-505.538) (-502.114) [-501.415] (-505.980) * (-502.909) [-504.838] (-503.123) (-504.269) -- 0:00:31
606000 -- [-501.611] (-503.572) (-504.983) (-501.894) * (-503.345) [-503.447] (-503.254) (-503.268) -- 0:00:31
606500 -- (-502.024) [-503.489] (-502.877) (-505.038) * (-506.188) (-502.306) (-503.281) [-504.040] -- 0:00:31
607000 -- [-501.487] (-504.793) (-504.255) (-505.161) * [-502.188] (-501.307) (-503.603) (-501.040) -- 0:00:31
607500 -- (-505.735) (-501.366) (-505.743) [-504.128] * (-502.657) [-504.720] (-505.993) (-506.139) -- 0:00:31
608000 -- [-501.631] (-501.957) (-505.777) (-502.240) * (-503.735) (-503.589) (-506.066) [-503.048] -- 0:00:30
608500 -- [-502.203] (-500.965) (-502.650) (-502.008) * (-500.982) (-507.791) (-504.594) [-501.445] -- 0:00:30
609000 -- (-501.869) (-500.902) (-502.655) [-501.230] * (-502.695) (-505.588) [-503.633] (-500.920) -- 0:00:31
609500 -- [-501.939] (-500.838) (-501.367) (-502.100) * (-501.641) (-504.475) [-503.004] (-503.077) -- 0:00:31
610000 -- (-502.495) [-503.130] (-501.099) (-501.048) * (-501.405) (-502.490) (-506.014) [-505.868] -- 0:00:31
Average standard deviation of split frequencies: 0.010081
610500 -- [-503.999] (-503.814) (-505.296) (-501.261) * (-501.260) [-501.780] (-502.194) (-502.382) -- 0:00:31
611000 -- (-502.435) [-503.097] (-506.929) (-502.508) * (-505.491) (-504.961) (-502.172) [-501.343] -- 0:00:31
611500 -- (-503.677) (-501.624) [-501.812] (-503.386) * (-500.861) (-501.499) [-502.100] (-505.563) -- 0:00:31
612000 -- [-505.219] (-501.691) (-502.749) (-503.185) * (-502.161) (-504.801) [-501.604] (-501.637) -- 0:00:31
612500 -- (-502.936) [-501.944] (-501.900) (-503.591) * [-502.889] (-502.030) (-502.238) (-503.048) -- 0:00:31
613000 -- (-505.480) [-505.338] (-504.131) (-503.109) * [-510.000] (-501.728) (-506.371) (-505.695) -- 0:00:30
613500 -- (-505.953) (-502.663) (-500.378) [-504.312] * (-504.107) (-502.346) (-503.818) [-501.528] -- 0:00:30
614000 -- (-504.878) [-501.127] (-501.638) (-502.068) * (-504.714) [-503.296] (-502.828) (-507.131) -- 0:00:30
614500 -- (-503.547) (-503.147) [-503.227] (-502.461) * (-501.987) (-500.822) (-503.328) [-502.876] -- 0:00:30
615000 -- (-501.135) [-503.900] (-503.360) (-501.720) * (-501.379) (-501.080) [-504.796] (-501.859) -- 0:00:30
Average standard deviation of split frequencies: 0.009279
615500 -- [-502.585] (-504.940) (-502.593) (-501.415) * (-501.016) (-505.716) (-504.579) [-501.658] -- 0:00:30
616000 -- [-500.848] (-503.050) (-504.995) (-506.212) * (-502.476) (-511.002) (-505.548) [-502.770] -- 0:00:30
616500 -- (-502.347) [-505.311] (-503.149) (-504.043) * [-502.712] (-501.839) (-503.082) (-502.571) -- 0:00:30
617000 -- [-502.035] (-508.289) (-504.265) (-503.736) * (-502.243) (-501.402) [-503.371] (-503.416) -- 0:00:30
617500 -- (-502.646) (-503.152) (-504.033) [-502.563] * (-501.746) (-507.059) (-501.106) [-502.172] -- 0:00:30
618000 -- (-502.065) (-502.922) [-501.342] (-506.711) * (-503.563) (-503.107) (-500.485) [-501.031] -- 0:00:30
618500 -- [-502.118] (-505.151) (-503.479) (-504.262) * (-503.270) (-502.945) [-501.846] (-504.033) -- 0:00:30
619000 -- (-504.525) (-505.111) [-501.235] (-501.784) * (-500.992) (-503.781) [-501.301] (-505.959) -- 0:00:30
619500 -- (-502.430) (-502.211) [-504.919] (-502.749) * (-505.613) (-503.147) (-501.998) [-504.091] -- 0:00:30
620000 -- (-502.017) (-502.938) (-504.028) [-502.633] * [-503.132] (-503.786) (-500.987) (-501.483) -- 0:00:30
Average standard deviation of split frequencies: 0.009874
620500 -- [-505.908] (-500.969) (-502.249) (-502.966) * (-505.088) [-502.790] (-501.858) (-501.612) -- 0:00:29
621000 -- [-503.743] (-501.371) (-501.336) (-503.218) * (-501.929) [-501.313] (-501.080) (-503.901) -- 0:00:29
621500 -- (-502.925) [-503.893] (-505.048) (-504.928) * (-501.757) [-501.560] (-502.312) (-509.624) -- 0:00:30
622000 -- (-502.364) [-502.722] (-504.636) (-501.820) * (-504.510) (-502.957) [-503.109] (-502.458) -- 0:00:30
622500 -- (-501.511) (-505.517) [-503.566] (-502.852) * (-501.977) [-501.880] (-501.796) (-503.571) -- 0:00:30
623000 -- (-502.520) (-502.510) [-501.197] (-503.967) * [-501.236] (-507.995) (-501.691) (-501.278) -- 0:00:30
623500 -- [-501.545] (-501.622) (-502.066) (-501.737) * (-502.708) [-505.841] (-501.453) (-500.849) -- 0:00:30
624000 -- (-507.372) [-504.278] (-505.730) (-502.158) * (-503.323) (-505.688) [-501.750] (-502.331) -- 0:00:30
624500 -- (-502.886) (-504.826) (-509.503) [-501.842] * (-502.025) (-500.922) (-503.031) [-502.420] -- 0:00:30
625000 -- (-502.208) (-504.041) [-502.090] (-500.994) * [-504.672] (-501.423) (-503.719) (-501.794) -- 0:00:30
Average standard deviation of split frequencies: 0.009922
625500 -- (-502.826) (-502.365) [-501.563] (-502.096) * (-501.964) (-502.068) (-503.994) [-502.156] -- 0:00:29
626000 -- [-502.156] (-502.250) (-501.942) (-502.341) * (-505.517) [-506.727] (-509.940) (-502.839) -- 0:00:29
626500 -- (-503.837) (-504.473) [-502.565] (-504.955) * (-507.675) (-503.085) [-503.233] (-502.595) -- 0:00:29
627000 -- (-503.041) [-502.894] (-501.825) (-503.751) * (-504.517) [-503.966] (-500.907) (-503.199) -- 0:00:29
627500 -- (-501.664) [-504.043] (-502.877) (-506.809) * (-501.576) (-508.278) [-501.057] (-504.461) -- 0:00:29
628000 -- (-501.212) (-503.871) [-503.442] (-510.432) * (-501.893) [-504.217] (-503.430) (-501.301) -- 0:00:29
628500 -- (-500.794) [-501.391] (-500.747) (-503.500) * [-505.185] (-502.677) (-504.075) (-503.569) -- 0:00:29
629000 -- (-501.080) (-504.705) [-504.466] (-502.068) * [-503.670] (-504.118) (-502.491) (-504.093) -- 0:00:29
629500 -- (-504.740) [-501.831] (-503.230) (-502.663) * (-500.850) (-504.291) [-502.255] (-504.376) -- 0:00:29
630000 -- (-501.887) (-502.725) (-506.329) [-503.426] * (-501.944) (-501.854) [-501.699] (-504.875) -- 0:00:29
Average standard deviation of split frequencies: 0.010245
630500 -- (-503.058) (-505.428) [-502.264] (-502.386) * [-502.604] (-504.022) (-501.318) (-503.257) -- 0:00:29
631000 -- (-501.711) (-503.626) [-502.575] (-503.040) * [-504.075] (-503.272) (-503.894) (-500.376) -- 0:00:29
631500 -- [-503.095] (-503.252) (-504.051) (-503.318) * (-501.776) [-502.193] (-502.990) (-501.650) -- 0:00:29
632000 -- (-502.570) (-508.547) [-504.207] (-504.180) * [-503.737] (-501.052) (-502.302) (-503.090) -- 0:00:29
632500 -- (-501.472) [-502.687] (-503.026) (-504.847) * (-504.232) [-502.931] (-501.252) (-501.545) -- 0:00:29
633000 -- [-501.497] (-501.602) (-500.963) (-502.834) * (-502.948) (-507.340) (-502.029) [-501.103] -- 0:00:28
633500 -- [-503.280] (-501.477) (-502.874) (-502.691) * (-502.296) (-500.630) (-500.948) [-504.576] -- 0:00:28
634000 -- (-507.293) (-502.489) (-501.183) [-505.630] * (-504.601) (-502.503) (-500.939) [-501.639] -- 0:00:28
634500 -- (-505.381) (-503.351) [-506.418] (-501.795) * [-500.990] (-501.693) (-502.233) (-502.610) -- 0:00:29
635000 -- [-505.316] (-503.676) (-502.158) (-501.191) * (-504.243) (-502.724) (-502.482) [-502.633] -- 0:00:29
Average standard deviation of split frequencies: 0.009766
635500 -- (-506.968) (-507.344) [-502.081] (-500.648) * (-504.645) (-501.472) (-504.826) [-503.239] -- 0:00:29
636000 -- (-505.240) [-500.743] (-501.666) (-500.873) * (-503.202) (-501.686) (-502.928) [-503.768] -- 0:00:29
636500 -- [-500.851] (-501.705) (-502.160) (-503.211) * (-501.374) (-501.537) (-501.919) [-502.970] -- 0:00:29
637000 -- (-503.066) [-501.972] (-503.953) (-502.173) * (-503.053) (-502.855) (-504.465) [-504.421] -- 0:00:29
637500 -- (-501.809) (-503.803) [-503.466] (-500.954) * (-510.490) [-503.130] (-502.337) (-504.835) -- 0:00:29
638000 -- (-504.274) [-502.731] (-503.337) (-503.646) * [-505.546] (-502.139) (-501.734) (-503.108) -- 0:00:28
638500 -- (-504.213) (-503.500) (-501.782) [-502.293] * [-503.158] (-503.018) (-502.443) (-501.018) -- 0:00:28
639000 -- (-504.222) [-501.797] (-502.102) (-502.111) * (-501.035) (-501.608) [-503.709] (-501.403) -- 0:00:28
639500 -- (-503.909) (-502.682) [-501.733] (-505.132) * (-503.840) (-501.539) [-501.313] (-501.378) -- 0:00:28
640000 -- (-501.670) (-501.672) [-502.510] (-500.589) * (-501.208) (-503.441) [-503.014] (-504.074) -- 0:00:28
Average standard deviation of split frequencies: 0.009912
640500 -- (-504.571) (-502.091) [-501.772] (-502.743) * (-502.930) (-508.896) [-504.160] (-502.400) -- 0:00:28
641000 -- (-504.411) [-508.581] (-501.259) (-506.373) * [-504.963] (-504.452) (-503.150) (-502.451) -- 0:00:28
641500 -- (-503.811) (-504.280) (-503.146) [-504.275] * (-501.625) [-501.650] (-501.531) (-502.184) -- 0:00:28
642000 -- [-502.720] (-508.754) (-500.561) (-503.663) * (-502.466) (-505.454) [-501.747] (-505.075) -- 0:00:28
642500 -- [-502.936] (-502.344) (-500.573) (-503.625) * (-503.201) [-501.342] (-502.354) (-505.846) -- 0:00:28
643000 -- (-502.324) (-504.284) (-502.112) [-501.560] * (-501.676) [-503.336] (-506.325) (-502.664) -- 0:00:28
643500 -- (-503.422) [-502.104] (-500.754) (-504.080) * (-505.068) (-502.758) (-503.595) [-502.576] -- 0:00:28
644000 -- (-504.971) (-501.386) [-501.397] (-503.399) * [-504.217] (-504.456) (-501.166) (-500.505) -- 0:00:28
644500 -- (-502.619) (-502.555) (-500.865) [-503.639] * (-500.742) (-503.135) [-503.341] (-501.118) -- 0:00:28
645000 -- (-503.207) (-506.947) [-501.308] (-502.952) * (-502.145) [-504.072] (-503.934) (-505.192) -- 0:00:28
Average standard deviation of split frequencies: 0.009658
645500 -- (-506.027) (-505.675) [-501.814] (-501.931) * [-503.734] (-507.885) (-504.436) (-503.901) -- 0:00:28
646000 -- [-506.327] (-503.379) (-502.498) (-503.067) * (-503.261) [-502.571] (-502.156) (-504.149) -- 0:00:27
646500 -- (-506.094) [-500.858] (-500.791) (-500.731) * (-503.904) (-503.448) (-502.658) [-502.679] -- 0:00:27
647000 -- [-501.051] (-501.254) (-503.079) (-501.519) * (-502.620) (-505.663) [-502.178] (-505.253) -- 0:00:27
647500 -- (-506.394) [-503.440] (-502.098) (-502.766) * (-504.887) (-502.111) (-504.158) [-502.075] -- 0:00:28
648000 -- (-502.096) [-501.639] (-501.620) (-501.870) * (-505.745) [-503.806] (-503.818) (-502.773) -- 0:00:28
648500 -- (-502.413) (-507.034) [-502.342] (-504.340) * (-505.550) (-510.507) (-500.685) [-504.073] -- 0:00:28
649000 -- [-502.718] (-501.985) (-501.633) (-503.050) * (-502.373) (-504.160) [-501.988] (-506.644) -- 0:00:28
649500 -- (-503.640) (-504.641) [-500.861] (-503.039) * [-501.726] (-501.490) (-502.104) (-501.190) -- 0:00:28
650000 -- (-502.850) (-500.907) [-503.277] (-508.201) * (-502.289) (-502.707) [-500.565] (-501.829) -- 0:00:28
Average standard deviation of split frequencies: 0.009333
650500 -- (-502.255) (-500.994) [-501.581] (-501.407) * [-502.471] (-504.372) (-501.322) (-502.172) -- 0:00:27
651000 -- (-504.912) (-502.339) (-503.074) [-502.166] * (-502.522) (-501.850) [-502.332] (-502.922) -- 0:00:27
651500 -- (-503.884) (-501.911) (-501.211) [-502.932] * (-504.364) [-504.046] (-500.644) (-502.438) -- 0:00:27
652000 -- (-504.255) [-501.138] (-501.146) (-505.416) * (-503.105) (-502.120) (-503.999) [-501.043] -- 0:00:27
652500 -- (-501.425) [-502.251] (-501.065) (-503.318) * [-500.984] (-504.202) (-502.874) (-501.447) -- 0:00:27
653000 -- (-501.857) (-503.254) [-501.187] (-502.725) * (-501.833) (-503.724) (-501.546) [-501.304] -- 0:00:27
653500 -- [-501.709] (-501.990) (-503.168) (-503.227) * (-500.530) (-506.223) (-501.418) [-502.031] -- 0:00:27
654000 -- (-501.137) (-504.585) [-502.068] (-502.008) * (-506.395) [-504.147] (-501.338) (-502.438) -- 0:00:27
654500 -- [-507.273] (-501.019) (-501.528) (-501.986) * (-502.751) (-508.658) [-500.473] (-502.569) -- 0:00:27
655000 -- (-505.320) (-504.950) [-503.051] (-504.514) * (-503.181) (-504.531) (-502.475) [-501.199] -- 0:00:27
Average standard deviation of split frequencies: 0.009469
655500 -- (-501.643) (-504.351) [-504.073] (-501.926) * (-504.017) [-505.219] (-502.297) (-502.094) -- 0:00:27
656000 -- (-502.614) (-502.300) (-503.794) [-503.556] * (-502.965) [-500.926] (-503.655) (-505.287) -- 0:00:27
656500 -- (-501.813) (-506.025) (-502.638) [-501.531] * (-503.068) (-503.161) [-502.032] (-503.742) -- 0:00:27
657000 -- (-504.314) (-509.412) [-502.273] (-501.769) * (-501.740) [-501.738] (-504.831) (-502.777) -- 0:00:27
657500 -- (-503.150) (-504.182) [-502.793] (-502.465) * (-501.049) [-503.338] (-504.958) (-503.758) -- 0:00:27
658000 -- (-501.348) (-503.085) (-503.630) [-505.601] * (-503.415) (-500.931) [-501.915] (-501.415) -- 0:00:27
658500 -- (-506.819) [-502.546] (-503.816) (-509.364) * (-501.594) [-502.197] (-501.852) (-502.942) -- 0:00:26
659000 -- (-501.438) (-506.855) [-501.214] (-504.118) * (-501.196) (-502.535) (-502.023) [-504.187] -- 0:00:26
659500 -- (-500.601) [-502.246] (-500.974) (-506.695) * (-503.279) [-501.676] (-503.979) (-506.252) -- 0:00:26
660000 -- (-503.931) [-501.144] (-502.503) (-501.321) * (-502.585) (-505.721) (-507.828) [-502.371] -- 0:00:27
Average standard deviation of split frequencies: 0.008898
660500 -- (-503.442) [-501.542] (-504.030) (-501.337) * [-502.971] (-501.518) (-505.422) (-502.630) -- 0:00:27
661000 -- [-501.761] (-504.806) (-507.427) (-500.946) * (-502.511) (-504.890) (-505.174) [-503.639] -- 0:00:27
661500 -- (-501.761) (-507.606) (-503.435) [-500.612] * (-500.405) (-502.172) (-503.364) [-503.051] -- 0:00:27
662000 -- (-503.060) (-504.326) [-504.086] (-505.407) * (-502.830) (-502.833) (-504.036) [-503.655] -- 0:00:27
662500 -- (-502.083) [-501.140] (-505.562) (-501.730) * (-501.611) (-501.759) [-501.450] (-501.732) -- 0:00:27
663000 -- (-504.446) (-501.729) (-508.964) [-503.398] * [-502.353] (-502.493) (-503.497) (-501.288) -- 0:00:26
663500 -- (-503.052) (-502.543) (-503.826) [-501.926] * [-504.129] (-502.699) (-501.056) (-502.342) -- 0:00:26
664000 -- [-503.325] (-505.585) (-501.740) (-501.050) * (-503.734) (-503.124) (-501.998) [-502.664] -- 0:00:26
664500 -- (-510.916) (-503.369) [-502.815] (-502.612) * (-500.750) (-502.265) [-501.166] (-504.530) -- 0:00:26
665000 -- (-503.556) [-503.180] (-503.119) (-500.482) * (-501.975) [-500.854] (-502.901) (-503.495) -- 0:00:26
Average standard deviation of split frequencies: 0.008702
665500 -- [-504.297] (-501.385) (-504.466) (-500.537) * (-501.594) [-504.673] (-502.727) (-503.320) -- 0:00:26
666000 -- (-501.326) (-503.026) [-504.126] (-501.071) * [-501.377] (-502.197) (-502.128) (-501.689) -- 0:00:26
666500 -- (-501.135) [-501.247] (-500.843) (-501.462) * (-502.421) (-502.409) (-501.785) [-506.925] -- 0:00:26
667000 -- (-505.693) [-504.073] (-506.337) (-503.936) * (-504.322) [-502.208] (-505.200) (-501.907) -- 0:00:26
667500 -- [-508.107] (-504.249) (-504.492) (-502.469) * (-502.349) (-504.856) (-502.448) [-505.075] -- 0:00:26
668000 -- (-509.190) [-506.212] (-503.185) (-503.245) * (-502.797) [-502.532] (-504.886) (-505.970) -- 0:00:26
668500 -- (-508.631) (-501.499) (-502.881) [-502.274] * (-504.875) [-503.528] (-503.388) (-505.636) -- 0:00:26
669000 -- (-506.874) [-504.615] (-503.537) (-502.068) * [-504.403] (-506.268) (-502.121) (-503.230) -- 0:00:26
669500 -- [-504.183] (-503.244) (-504.156) (-504.002) * (-504.479) (-504.297) (-501.916) [-502.878] -- 0:00:26
670000 -- (-501.529) [-502.463] (-501.826) (-502.345) * [-504.324] (-502.415) (-501.274) (-504.646) -- 0:00:26
Average standard deviation of split frequencies: 0.008559
670500 -- (-502.359) (-501.983) [-505.704] (-504.436) * (-501.940) [-501.075] (-501.526) (-503.378) -- 0:00:26
671000 -- [-501.142] (-505.324) (-502.843) (-501.383) * (-502.737) [-502.756] (-500.993) (-502.939) -- 0:00:25
671500 -- (-502.603) (-505.812) (-504.839) [-500.994] * (-503.447) (-503.561) (-503.671) [-501.108] -- 0:00:25
672000 -- (-502.577) (-503.992) (-502.132) [-502.638] * (-503.134) (-501.916) (-502.728) [-503.693] -- 0:00:25
672500 -- (-504.487) (-507.253) (-502.528) [-504.135] * (-503.104) [-503.882] (-507.151) (-503.668) -- 0:00:25
673000 -- [-502.103] (-501.696) (-505.000) (-504.721) * [-505.448] (-503.796) (-503.012) (-503.535) -- 0:00:26
673500 -- (-502.327) [-503.062] (-504.415) (-502.327) * (-504.212) [-501.599] (-501.845) (-505.493) -- 0:00:26
674000 -- [-501.904] (-505.629) (-503.295) (-501.125) * (-501.338) (-501.939) [-501.646] (-506.786) -- 0:00:26
674500 -- [-503.564] (-502.002) (-503.843) (-503.734) * [-504.733] (-501.734) (-508.184) (-505.053) -- 0:00:26
675000 -- [-501.046] (-503.547) (-501.802) (-511.735) * (-502.197) (-502.266) [-504.787] (-502.310) -- 0:00:26
Average standard deviation of split frequencies: 0.008614
675500 -- (-501.897) (-504.863) [-501.416] (-504.972) * [-501.135] (-504.346) (-506.458) (-502.942) -- 0:00:25
676000 -- (-502.771) [-502.180] (-501.252) (-506.123) * (-501.245) (-504.756) (-503.088) [-501.874] -- 0:00:25
676500 -- (-501.349) [-501.984] (-501.929) (-502.631) * (-503.239) (-503.723) [-502.724] (-503.054) -- 0:00:25
677000 -- (-502.207) (-502.134) (-500.770) [-501.689] * (-502.395) [-505.419] (-503.495) (-502.479) -- 0:00:25
677500 -- (-504.387) (-505.322) [-501.379] (-503.616) * (-508.383) (-502.407) [-505.233] (-504.147) -- 0:00:25
678000 -- [-501.687] (-508.302) (-504.149) (-505.049) * (-507.398) [-503.053] (-506.031) (-502.701) -- 0:00:25
678500 -- (-503.823) [-501.173] (-504.971) (-503.750) * (-502.419) (-501.709) [-503.158] (-501.516) -- 0:00:25
679000 -- (-503.980) (-505.546) (-507.414) [-500.667] * [-503.857] (-501.960) (-503.001) (-503.706) -- 0:00:25
679500 -- (-503.195) [-503.710] (-502.975) (-500.669) * [-504.089] (-504.281) (-504.082) (-502.577) -- 0:00:25
680000 -- [-506.814] (-504.897) (-505.694) (-500.564) * [-506.013] (-504.985) (-505.292) (-510.240) -- 0:00:25
Average standard deviation of split frequencies: 0.009329
680500 -- (-505.746) [-503.452] (-505.449) (-505.417) * (-501.200) (-504.451) (-504.056) [-503.199] -- 0:00:25
681000 -- (-505.155) (-503.234) [-508.042] (-504.885) * (-507.572) (-502.378) [-503.323] (-503.950) -- 0:00:25
681500 -- (-503.535) (-501.743) (-504.834) [-503.247] * [-505.300] (-505.465) (-501.747) (-503.331) -- 0:00:25
682000 -- (-502.317) (-505.915) (-501.392) [-503.634] * (-505.411) [-501.541] (-501.473) (-501.540) -- 0:00:25
682500 -- (-502.270) (-502.830) [-501.480] (-506.346) * (-502.990) (-501.924) (-501.291) [-502.942] -- 0:00:25
683000 -- [-503.630] (-503.487) (-500.620) (-503.480) * [-501.625] (-501.307) (-502.997) (-505.862) -- 0:00:25
683500 -- (-502.256) [-504.658] (-501.017) (-504.976) * (-502.216) [-502.522] (-501.329) (-504.919) -- 0:00:25
684000 -- (-503.005) (-501.900) (-503.300) [-503.752] * [-502.645] (-502.916) (-503.250) (-503.101) -- 0:00:24
684500 -- (-501.566) [-501.698] (-506.624) (-503.894) * (-502.834) [-501.055] (-503.133) (-503.785) -- 0:00:24
685000 -- (-505.197) (-501.111) [-502.528] (-503.601) * (-501.270) (-500.798) (-504.395) [-504.368] -- 0:00:24
Average standard deviation of split frequencies: 0.009418
685500 -- (-505.830) (-502.040) [-500.934] (-509.137) * (-503.240) (-500.579) [-502.454] (-501.896) -- 0:00:24
686000 -- (-500.922) (-502.301) (-503.163) [-503.917] * (-501.192) (-502.820) [-504.480] (-502.271) -- 0:00:25
686500 -- (-504.470) (-504.129) [-503.830] (-503.420) * [-504.236] (-506.792) (-502.361) (-502.509) -- 0:00:25
687000 -- (-502.924) (-502.913) (-503.182) [-500.993] * (-502.162) (-508.749) [-502.801] (-502.159) -- 0:00:25
687500 -- (-503.626) (-501.998) (-501.611) [-502.298] * (-502.423) (-504.865) (-503.923) [-501.021] -- 0:00:25
688000 -- [-501.711] (-501.106) (-502.059) (-501.293) * (-502.086) (-502.240) (-506.142) [-502.598] -- 0:00:24
688500 -- [-501.291] (-503.985) (-502.691) (-501.359) * (-502.440) (-501.425) (-500.974) [-500.696] -- 0:00:24
689000 -- [-503.827] (-503.394) (-502.278) (-501.954) * (-505.175) [-500.630] (-503.049) (-503.079) -- 0:00:24
689500 -- (-503.102) (-506.036) [-503.089] (-505.503) * [-501.066] (-505.230) (-505.200) (-503.885) -- 0:00:24
690000 -- (-503.366) (-504.682) (-507.605) [-501.946] * [-501.278] (-502.651) (-503.140) (-503.794) -- 0:00:24
Average standard deviation of split frequencies: 0.009475
690500 -- (-502.063) (-502.869) (-504.820) [-500.830] * (-502.890) (-502.568) (-501.687) [-502.899] -- 0:00:24
691000 -- (-501.494) (-504.377) (-503.826) [-501.269] * [-500.567] (-503.538) (-502.225) (-504.969) -- 0:00:24
691500 -- [-505.156] (-505.886) (-502.508) (-502.899) * [-501.601] (-504.192) (-503.532) (-505.291) -- 0:00:24
692000 -- (-507.668) (-507.838) (-501.632) [-501.576] * [-505.431] (-507.752) (-504.249) (-508.289) -- 0:00:24
692500 -- (-503.761) (-506.404) (-502.362) [-502.775] * [-504.464] (-505.807) (-503.442) (-507.221) -- 0:00:24
693000 -- (-502.858) (-502.877) (-501.901) [-503.076] * (-503.713) (-504.123) (-500.504) [-501.289] -- 0:00:24
693500 -- (-502.149) (-501.091) (-503.383) [-503.499] * [-502.570] (-503.875) (-503.376) (-503.138) -- 0:00:24
694000 -- (-501.187) (-504.132) (-504.740) [-506.528] * (-502.007) [-501.662] (-503.721) (-502.077) -- 0:00:24
694500 -- (-500.667) [-501.223] (-501.599) (-506.278) * (-502.190) (-503.564) [-501.621] (-500.407) -- 0:00:24
695000 -- (-502.848) (-502.663) (-503.829) [-500.775] * (-501.027) [-502.125] (-502.879) (-501.903) -- 0:00:24
Average standard deviation of split frequencies: 0.008678
695500 -- (-503.221) (-504.116) (-503.381) [-506.038] * (-502.455) [-502.260] (-501.377) (-500.541) -- 0:00:24
696000 -- [-502.907] (-503.062) (-502.492) (-501.421) * (-505.523) (-502.796) [-501.932] (-504.066) -- 0:00:24
696500 -- [-500.635] (-503.129) (-502.122) (-502.137) * (-501.629) (-506.411) [-502.406] (-502.881) -- 0:00:23
697000 -- (-502.975) (-501.712) (-506.812) [-501.357] * (-500.989) [-503.651] (-502.938) (-502.285) -- 0:00:23
697500 -- (-504.248) (-501.081) (-501.356) [-501.957] * (-505.624) [-503.791] (-500.391) (-501.298) -- 0:00:23
698000 -- (-501.597) (-500.793) (-501.227) [-500.801] * (-502.951) (-500.772) (-501.586) [-504.242] -- 0:00:23
698500 -- (-501.689) [-501.700] (-504.346) (-501.400) * [-504.657] (-501.711) (-502.008) (-505.420) -- 0:00:24
699000 -- (-502.863) [-501.800] (-502.467) (-502.184) * [-501.151] (-504.091) (-502.398) (-502.384) -- 0:00:24
699500 -- (-503.188) [-501.857] (-503.766) (-504.015) * [-503.420] (-501.110) (-502.960) (-504.884) -- 0:00:24
700000 -- (-504.382) (-502.792) (-502.678) [-502.805] * [-501.573] (-502.579) (-505.343) (-505.569) -- 0:00:24
Average standard deviation of split frequencies: 0.008410
700500 -- [-503.045] (-502.590) (-502.407) (-503.947) * (-503.111) [-501.577] (-501.832) (-502.819) -- 0:00:23
701000 -- (-502.690) (-503.183) [-500.566] (-503.827) * (-505.055) [-503.542] (-503.307) (-501.609) -- 0:00:23
701500 -- (-503.232) (-501.298) [-500.796] (-501.237) * (-503.675) (-502.548) [-504.483] (-502.219) -- 0:00:23
702000 -- (-502.691) (-501.132) (-503.063) [-504.782] * (-503.097) (-502.078) (-509.678) [-505.075] -- 0:00:23
702500 -- (-500.342) (-504.521) (-502.818) [-501.553] * (-502.553) (-501.915) [-501.723] (-501.441) -- 0:00:23
703000 -- (-501.569) (-509.033) [-504.630] (-501.388) * (-502.105) (-502.084) (-502.874) [-504.333] -- 0:00:23
703500 -- (-501.688) (-500.896) (-502.197) [-502.580] * (-502.743) [-500.971] (-506.152) (-504.189) -- 0:00:23
704000 -- (-504.595) [-502.331] (-503.386) (-502.788) * (-505.957) (-502.865) (-501.279) [-502.076] -- 0:00:23
704500 -- (-501.559) (-504.185) (-501.615) [-502.853] * (-502.968) (-503.453) [-501.450] (-502.918) -- 0:00:23
705000 -- (-503.131) (-504.341) [-501.835] (-503.410) * [-501.566] (-501.807) (-507.839) (-504.208) -- 0:00:23
Average standard deviation of split frequencies: 0.008388
705500 -- (-501.497) (-503.817) [-501.057] (-503.247) * [-501.882] (-501.254) (-501.186) (-507.831) -- 0:00:23
706000 -- (-501.501) (-503.196) (-503.797) [-502.647] * (-505.796) (-501.847) [-501.339] (-506.403) -- 0:00:23
706500 -- (-502.182) (-503.888) [-503.944] (-505.923) * (-506.469) (-502.429) [-501.749] (-510.675) -- 0:00:23
707000 -- (-502.396) (-503.934) (-507.276) [-502.538] * [-502.050] (-505.958) (-501.493) (-502.316) -- 0:00:23
707500 -- (-503.609) (-502.515) [-502.595] (-501.419) * (-501.011) (-506.381) (-503.036) [-502.179] -- 0:00:23
708000 -- [-502.222] (-502.462) (-505.266) (-501.253) * (-501.811) (-501.246) (-504.799) [-502.719] -- 0:00:23
708500 -- (-503.506) (-500.667) [-502.093] (-502.197) * (-509.110) (-501.908) (-504.277) [-501.836] -- 0:00:23
709000 -- (-502.271) [-501.901] (-502.631) (-501.484) * (-504.055) (-501.270) (-502.429) [-503.446] -- 0:00:22
709500 -- (-502.563) (-502.500) [-504.298] (-503.290) * (-509.073) (-500.879) [-500.932] (-506.435) -- 0:00:22
710000 -- (-504.317) (-502.174) (-502.207) [-503.416] * (-506.381) (-503.091) [-502.722] (-504.432) -- 0:00:22
Average standard deviation of split frequencies: 0.008375
710500 -- (-500.614) [-501.495] (-502.089) (-501.177) * (-504.876) (-502.551) (-501.799) [-501.201] -- 0:00:22
711000 -- (-501.370) (-502.454) [-502.985] (-506.166) * (-504.790) [-505.204] (-504.115) (-501.170) -- 0:00:22
711500 -- (-503.451) (-501.717) [-506.475] (-501.521) * [-501.175] (-505.081) (-501.584) (-508.541) -- 0:00:23
712000 -- (-503.772) (-506.303) [-502.552] (-503.855) * [-501.230] (-501.465) (-502.766) (-502.870) -- 0:00:23
712500 -- [-504.296] (-502.196) (-502.223) (-501.900) * (-503.530) (-503.293) (-504.617) [-502.780] -- 0:00:23
713000 -- [-505.763] (-503.161) (-503.224) (-502.225) * (-503.040) (-501.535) (-505.206) [-503.918] -- 0:00:22
713500 -- (-502.657) (-502.681) (-502.101) [-501.020] * (-502.566) [-502.472] (-502.533) (-501.491) -- 0:00:22
714000 -- (-501.015) (-501.887) [-504.246] (-503.042) * [-504.385] (-503.797) (-502.675) (-504.892) -- 0:00:22
714500 -- (-503.440) (-503.597) (-500.847) [-503.805] * (-503.853) (-501.292) (-503.531) [-501.408] -- 0:00:22
715000 -- [-501.611] (-501.900) (-501.105) (-501.535) * (-507.119) (-506.434) (-505.982) [-502.184] -- 0:00:22
Average standard deviation of split frequencies: 0.008753
715500 -- (-501.089) [-501.704] (-501.362) (-502.145) * (-505.302) (-503.687) [-502.241] (-505.424) -- 0:00:22
716000 -- (-503.865) (-503.256) [-503.633] (-504.256) * (-501.556) (-502.391) (-502.320) [-505.277] -- 0:00:22
716500 -- (-502.904) (-501.985) (-502.680) [-502.706] * (-501.555) (-501.289) (-505.451) [-501.026] -- 0:00:22
717000 -- (-502.705) [-502.350] (-500.748) (-501.627) * [-501.243] (-504.386) (-501.962) (-501.372) -- 0:00:22
717500 -- (-502.250) [-504.944] (-501.940) (-500.713) * (-503.132) [-502.832] (-501.508) (-502.366) -- 0:00:22
718000 -- [-502.005] (-506.187) (-503.003) (-500.461) * (-502.983) (-502.304) (-501.863) [-501.100] -- 0:00:22
718500 -- [-501.164] (-503.740) (-502.922) (-500.696) * (-501.187) (-505.308) (-500.935) [-504.873] -- 0:00:22
719000 -- (-503.232) [-501.170] (-504.719) (-501.580) * (-507.891) [-500.660] (-502.656) (-503.088) -- 0:00:22
719500 -- [-501.685] (-501.972) (-503.667) (-500.996) * (-501.433) (-503.941) [-500.859] (-501.918) -- 0:00:22
720000 -- (-501.521) (-507.935) (-502.924) [-500.616] * [-501.392] (-510.022) (-504.093) (-501.871) -- 0:00:22
Average standard deviation of split frequencies: 0.008544
720500 -- [-500.604] (-502.655) (-501.754) (-503.566) * (-501.400) [-502.755] (-503.548) (-502.965) -- 0:00:22
721000 -- (-500.504) (-504.474) (-502.283) [-501.842] * (-506.310) [-501.241] (-504.744) (-503.050) -- 0:00:22
721500 -- (-503.227) [-500.762] (-501.186) (-503.988) * (-506.223) (-503.239) [-502.853] (-502.418) -- 0:00:22
722000 -- (-502.934) [-500.511] (-503.389) (-504.316) * [-503.654] (-503.719) (-503.990) (-501.393) -- 0:00:21
722500 -- [-502.817] (-502.147) (-505.435) (-504.986) * [-501.985] (-500.755) (-501.578) (-501.019) -- 0:00:21
723000 -- (-502.009) (-503.012) [-507.868] (-503.787) * (-503.195) (-501.906) (-503.432) [-502.396] -- 0:00:21
723500 -- [-503.382] (-502.126) (-506.343) (-505.295) * (-502.834) (-504.166) [-503.744] (-500.810) -- 0:00:21
724000 -- [-503.133] (-502.923) (-504.595) (-503.025) * (-502.962) (-501.624) (-500.942) [-502.892] -- 0:00:21
724500 -- (-503.855) (-507.894) [-504.390] (-502.290) * [-501.063] (-502.269) (-508.865) (-500.647) -- 0:00:22
725000 -- [-501.370] (-506.091) (-500.562) (-502.237) * (-502.278) (-502.166) (-504.893) [-502.611] -- 0:00:22
Average standard deviation of split frequencies: 0.008747
725500 -- (-505.561) [-503.899] (-505.140) (-502.070) * [-503.726] (-502.479) (-504.903) (-502.339) -- 0:00:21
726000 -- (-502.935) (-503.527) (-503.065) [-500.740] * (-501.194) (-502.798) (-505.411) [-501.303] -- 0:00:21
726500 -- (-504.363) (-504.971) (-503.189) [-503.979] * (-501.624) [-503.110] (-503.631) (-501.503) -- 0:00:21
727000 -- (-504.098) [-501.525] (-503.909) (-503.567) * (-505.291) (-502.500) [-502.290] (-500.622) -- 0:00:21
727500 -- (-503.532) [-502.105] (-501.461) (-516.075) * (-507.884) (-502.881) [-502.878] (-501.929) -- 0:00:21
728000 -- (-501.376) [-502.188] (-505.676) (-507.697) * (-503.356) (-505.613) (-504.708) [-503.433] -- 0:00:21
728500 -- (-502.508) [-502.430] (-506.681) (-502.255) * (-501.644) (-503.211) (-501.131) [-500.663] -- 0:00:21
729000 -- [-501.386] (-502.290) (-502.082) (-502.104) * (-502.179) [-500.935] (-504.643) (-501.311) -- 0:00:21
729500 -- (-502.024) (-502.484) (-502.642) [-505.838] * (-501.867) (-503.322) (-513.493) [-502.083] -- 0:00:21
730000 -- (-509.893) (-501.651) (-506.736) [-506.349] * [-501.801] (-501.843) (-501.814) (-505.713) -- 0:00:21
Average standard deviation of split frequencies: 0.008024
730500 -- (-509.605) [-504.145] (-503.032) (-507.367) * (-501.465) (-501.203) [-502.036] (-501.744) -- 0:00:21
731000 -- (-506.022) [-502.235] (-501.277) (-502.859) * [-502.303] (-501.869) (-501.937) (-502.532) -- 0:00:21
731500 -- (-505.115) [-502.263] (-502.784) (-506.782) * [-501.086] (-502.571) (-503.048) (-502.510) -- 0:00:21
732000 -- (-504.568) [-501.096] (-502.172) (-502.526) * (-501.557) [-503.467] (-504.785) (-501.384) -- 0:00:21
732500 -- (-504.427) [-501.199] (-501.611) (-503.750) * (-501.451) (-507.775) (-502.249) [-500.844] -- 0:00:21
733000 -- (-502.906) (-502.784) [-504.720] (-503.536) * (-502.195) (-504.504) [-501.776] (-500.443) -- 0:00:21
733500 -- (-501.756) [-502.708] (-504.600) (-503.372) * [-503.013] (-506.282) (-502.633) (-500.765) -- 0:00:21
734000 -- (-502.545) (-504.960) [-502.401] (-504.350) * (-501.585) (-506.074) [-502.283] (-504.902) -- 0:00:21
734500 -- (-501.127) [-503.343] (-501.244) (-503.877) * (-503.553) (-503.771) (-502.094) [-502.122] -- 0:00:20
735000 -- (-501.606) (-503.179) (-501.381) [-504.539] * [-502.176] (-504.296) (-506.247) (-503.064) -- 0:00:20
Average standard deviation of split frequencies: 0.008086
735500 -- (-501.752) [-501.645] (-506.196) (-502.428) * [-503.437] (-504.471) (-502.841) (-500.906) -- 0:00:20
736000 -- (-504.575) [-500.519] (-503.785) (-504.722) * (-504.510) [-502.996] (-501.461) (-503.019) -- 0:00:20
736500 -- (-503.705) (-503.718) (-505.267) [-502.776] * (-503.402) (-507.035) (-503.272) [-502.241] -- 0:00:20
737000 -- (-504.368) [-502.070] (-507.579) (-503.735) * (-503.611) (-502.528) [-502.129] (-501.598) -- 0:00:21
737500 -- (-506.342) (-503.651) (-503.669) [-501.418] * (-504.431) [-501.977] (-500.941) (-503.184) -- 0:00:21
738000 -- (-502.162) [-500.946] (-501.818) (-503.874) * (-500.758) (-503.668) (-500.746) [-502.113] -- 0:00:20
738500 -- (-505.193) (-501.977) [-506.709] (-507.002) * (-503.052) (-502.738) (-500.442) [-502.153] -- 0:00:20
739000 -- (-502.918) (-504.984) (-501.587) [-501.521] * (-501.643) (-503.099) (-501.695) [-507.073] -- 0:00:20
739500 -- [-503.381] (-504.997) (-505.698) (-503.086) * (-505.282) [-506.548] (-503.152) (-507.673) -- 0:00:20
740000 -- [-501.177] (-504.419) (-503.353) (-503.431) * [-506.259] (-502.099) (-503.598) (-504.756) -- 0:00:20
Average standard deviation of split frequencies: 0.008513
740500 -- (-501.063) (-503.336) [-503.172] (-501.480) * (-502.663) [-500.804] (-504.011) (-502.737) -- 0:00:20
741000 -- (-503.103) (-500.934) [-504.149] (-501.031) * (-504.640) [-502.047] (-502.904) (-503.008) -- 0:00:20
741500 -- (-503.608) (-503.103) [-501.895] (-501.544) * (-502.809) (-502.785) [-501.208] (-501.957) -- 0:00:20
742000 -- (-503.964) (-508.677) (-500.928) [-502.230] * (-501.110) (-506.077) [-502.979] (-504.094) -- 0:00:20
742500 -- [-503.177] (-502.154) (-502.571) (-504.912) * [-505.002] (-502.765) (-502.349) (-507.197) -- 0:00:20
743000 -- (-502.570) (-502.332) (-503.732) [-504.580] * [-504.049] (-504.799) (-503.463) (-501.331) -- 0:00:20
743500 -- (-501.857) (-502.610) (-504.878) [-502.975] * (-502.059) (-503.755) [-502.310] (-501.114) -- 0:00:20
744000 -- (-507.129) [-504.396] (-505.628) (-504.999) * (-503.225) (-502.143) [-503.917] (-500.612) -- 0:00:20
744500 -- (-502.898) (-504.943) (-503.485) [-502.461] * [-503.431] (-502.229) (-502.754) (-506.177) -- 0:00:20
745000 -- (-508.831) (-501.689) [-501.216] (-504.049) * (-506.720) (-503.439) [-504.712] (-502.084) -- 0:00:20
Average standard deviation of split frequencies: 0.008570
745500 -- (-504.614) (-502.459) (-501.304) [-505.204] * [-502.226] (-500.805) (-503.694) (-500.952) -- 0:00:20
746000 -- [-501.050] (-506.990) (-505.396) (-502.112) * [-501.543] (-505.194) (-500.774) (-504.914) -- 0:00:20
746500 -- [-501.907] (-502.686) (-501.157) (-506.983) * (-502.567) (-500.834) [-500.956] (-501.640) -- 0:00:20
747000 -- (-506.020) [-506.712] (-504.027) (-500.746) * (-502.502) (-503.079) (-500.442) [-501.701] -- 0:00:19
747500 -- (-500.925) (-505.137) (-505.069) [-503.325] * (-503.247) [-502.581] (-504.563) (-505.114) -- 0:00:19
748000 -- (-500.883) [-501.264] (-501.941) (-506.562) * (-503.429) [-500.960] (-503.998) (-504.305) -- 0:00:19
748500 -- (-503.556) (-502.611) (-507.475) [-502.101] * (-502.166) [-502.116] (-504.079) (-501.964) -- 0:00:19
749000 -- (-505.242) (-506.471) (-506.068) [-501.954] * (-503.008) [-501.764] (-503.391) (-503.385) -- 0:00:19
749500 -- (-502.032) [-501.822] (-503.657) (-501.892) * (-502.892) (-500.905) [-506.953] (-502.100) -- 0:00:19
750000 -- (-503.197) [-501.307] (-505.138) (-504.588) * [-504.213] (-503.493) (-501.724) (-502.352) -- 0:00:20
Average standard deviation of split frequencies: 0.007968
750500 -- (-500.524) (-504.120) [-501.133] (-501.540) * (-505.466) (-503.637) (-500.564) [-500.997] -- 0:00:19
751000 -- (-501.136) (-503.962) [-501.341] (-500.905) * (-503.857) (-502.357) (-503.382) [-501.158] -- 0:00:19
751500 -- (-501.101) (-504.202) (-501.905) [-501.212] * (-503.507) (-501.982) [-501.054] (-501.568) -- 0:00:19
752000 -- (-501.598) (-502.666) [-500.914] (-502.481) * (-502.693) (-502.837) [-502.502] (-506.967) -- 0:00:19
752500 -- (-501.461) (-502.789) (-503.238) [-500.526] * (-504.676) (-501.953) [-501.713] (-507.785) -- 0:00:19
753000 -- [-503.935] (-501.117) (-504.250) (-500.609) * (-503.961) [-503.051] (-505.119) (-503.212) -- 0:00:19
753500 -- (-501.801) (-501.949) (-505.821) [-501.714] * (-502.425) [-501.239] (-503.120) (-504.374) -- 0:00:19
754000 -- [-501.160] (-505.359) (-502.712) (-504.794) * [-505.249] (-502.136) (-503.711) (-503.716) -- 0:00:19
754500 -- (-502.565) (-503.837) (-506.494) [-501.932] * (-505.048) [-501.293] (-503.105) (-505.663) -- 0:00:19
755000 -- (-502.244) [-504.222] (-506.908) (-502.421) * (-502.231) [-502.088] (-502.800) (-506.677) -- 0:00:19
Average standard deviation of split frequencies: 0.007911
755500 -- (-501.706) (-502.051) [-504.251] (-508.028) * [-506.891] (-501.390) (-503.439) (-502.052) -- 0:00:19
756000 -- [-501.779] (-502.284) (-502.204) (-502.739) * (-501.162) [-501.748] (-502.009) (-501.516) -- 0:00:19
756500 -- [-503.416] (-502.617) (-504.387) (-502.467) * [-500.739] (-506.574) (-501.463) (-504.059) -- 0:00:19
757000 -- (-502.515) [-503.083] (-512.969) (-502.228) * (-502.482) (-506.787) [-503.341] (-504.560) -- 0:00:19
757500 -- (-504.164) (-510.814) (-504.803) [-502.666] * (-503.282) [-500.686] (-506.962) (-504.410) -- 0:00:19
758000 -- (-503.590) (-501.809) (-503.356) [-502.998] * [-501.245] (-502.477) (-505.284) (-506.167) -- 0:00:19
758500 -- [-503.354] (-501.220) (-502.383) (-504.402) * (-503.733) (-509.025) (-502.945) [-504.184] -- 0:00:19
759000 -- (-507.483) (-501.036) (-501.500) [-502.923] * (-502.621) [-503.115] (-508.665) (-504.041) -- 0:00:19
759500 -- (-503.378) (-502.896) (-504.809) [-503.979] * [-500.751] (-505.049) (-508.582) (-502.213) -- 0:00:18
760000 -- (-501.013) (-502.613) (-506.869) [-504.037] * (-501.966) [-502.504] (-502.493) (-501.358) -- 0:00:18
Average standard deviation of split frequencies: 0.007785
760500 -- (-500.832) [-501.779] (-504.675) (-507.011) * (-501.379) [-506.923] (-501.830) (-511.399) -- 0:00:18
761000 -- [-503.492] (-504.516) (-501.514) (-503.682) * [-502.964] (-504.445) (-502.657) (-504.836) -- 0:00:18
761500 -- (-502.545) (-502.063) [-502.128] (-502.434) * (-502.085) (-503.421) [-500.597] (-502.306) -- 0:00:18
762000 -- (-505.222) [-504.843] (-505.335) (-501.074) * [-501.389] (-503.850) (-503.607) (-501.899) -- 0:00:18
762500 -- (-501.995) (-501.796) (-501.129) [-501.152] * (-501.198) [-502.178] (-501.192) (-501.933) -- 0:00:18
763000 -- (-502.009) (-504.791) [-504.206] (-504.816) * (-501.186) [-504.682] (-501.310) (-502.694) -- 0:00:18
763500 -- [-501.080] (-503.242) (-502.660) (-503.440) * (-502.039) (-502.724) [-501.012] (-503.646) -- 0:00:18
764000 -- (-501.492) (-504.143) (-501.972) [-504.018] * (-501.321) [-501.403] (-501.763) (-504.370) -- 0:00:18
764500 -- (-503.004) (-502.521) (-501.576) [-502.400] * [-500.819] (-504.328) (-502.173) (-503.136) -- 0:00:18
765000 -- (-504.255) (-501.754) [-502.713] (-503.493) * (-501.072) (-504.647) (-506.443) [-501.560] -- 0:00:18
Average standard deviation of split frequencies: 0.007770
765500 -- (-500.889) [-504.512] (-501.905) (-504.046) * [-501.909] (-504.325) (-506.261) (-501.344) -- 0:00:18
766000 -- [-500.388] (-501.566) (-502.634) (-500.999) * (-505.028) (-503.428) (-504.430) [-503.249] -- 0:00:18
766500 -- (-500.356) (-502.213) (-501.636) [-502.398] * (-503.389) (-504.626) [-501.675] (-503.384) -- 0:00:18
767000 -- [-500.544] (-502.974) (-505.486) (-503.049) * (-502.942) (-501.026) (-504.739) [-504.318] -- 0:00:18
767500 -- (-501.766) (-503.349) (-504.880) [-503.447] * (-502.171) (-501.836) (-501.760) [-502.649] -- 0:00:18
768000 -- (-501.082) [-501.444] (-503.174) (-502.349) * (-502.147) (-505.032) (-501.648) [-503.196] -- 0:00:18
768500 -- (-502.606) (-500.714) [-507.570] (-501.908) * (-504.738) (-502.817) (-502.766) [-502.004] -- 0:00:18
769000 -- (-501.346) (-502.442) (-501.307) [-506.189] * (-504.399) (-502.741) [-500.675] (-504.194) -- 0:00:18
769500 -- [-501.672] (-504.443) (-502.016) (-505.665) * [-502.146] (-502.221) (-501.594) (-503.350) -- 0:00:18
770000 -- [-502.440] (-503.974) (-503.208) (-501.740) * (-503.745) (-505.383) (-500.563) [-500.948] -- 0:00:18
Average standard deviation of split frequencies: 0.008105
770500 -- (-504.534) [-502.609] (-502.257) (-502.661) * (-502.745) (-502.329) (-502.248) [-503.029] -- 0:00:18
771000 -- (-502.652) [-502.157] (-503.638) (-501.321) * (-501.773) (-502.898) [-503.277] (-507.079) -- 0:00:18
771500 -- (-502.019) [-502.507] (-503.711) (-502.473) * (-500.572) (-503.345) (-503.021) [-503.292] -- 0:00:18
772000 -- (-502.024) [-502.662] (-505.030) (-504.213) * (-500.354) [-502.472] (-500.968) (-501.792) -- 0:00:18
772500 -- (-500.922) (-502.908) [-503.273] (-501.151) * (-501.257) (-500.831) [-501.249] (-500.698) -- 0:00:17
773000 -- (-501.645) (-502.297) [-501.466] (-501.701) * (-502.821) (-503.652) (-503.051) [-503.263] -- 0:00:17
773500 -- (-506.451) (-502.945) (-500.546) [-501.967] * (-503.835) (-500.572) [-504.827] (-502.868) -- 0:00:17
774000 -- (-503.100) (-502.064) (-501.097) [-502.007] * [-501.702] (-504.754) (-502.911) (-502.172) -- 0:00:17
774500 -- (-504.661) [-504.897] (-502.424) (-502.149) * (-503.624) (-505.721) [-506.035] (-501.762) -- 0:00:17
775000 -- (-504.002) (-502.645) [-503.092] (-503.474) * (-505.778) [-504.247] (-504.847) (-501.340) -- 0:00:17
Average standard deviation of split frequencies: 0.008087
775500 -- [-502.396] (-501.416) (-501.844) (-505.455) * (-505.114) (-505.653) (-503.938) [-501.982] -- 0:00:17
776000 -- (-501.620) (-501.184) [-502.402] (-502.646) * (-506.666) (-505.004) (-501.504) [-502.108] -- 0:00:17
776500 -- [-501.590] (-507.480) (-502.312) (-502.366) * (-502.697) (-507.991) [-503.726] (-501.980) -- 0:00:17
777000 -- (-502.960) (-505.534) [-502.393] (-506.255) * (-500.952) [-502.961] (-501.939) (-511.754) -- 0:00:17
777500 -- [-501.584] (-504.748) (-501.325) (-506.790) * (-500.952) (-502.113) [-503.892] (-507.635) -- 0:00:17
778000 -- [-502.127] (-503.691) (-504.073) (-504.677) * (-502.653) (-502.525) [-501.234] (-504.466) -- 0:00:17
778500 -- [-503.153] (-503.852) (-501.889) (-502.274) * (-503.306) (-502.805) (-503.145) [-501.905] -- 0:00:17
779000 -- (-505.442) (-502.014) [-501.763] (-506.265) * (-501.693) (-505.898) [-500.360] (-501.304) -- 0:00:17
779500 -- (-502.040) (-501.909) (-501.674) [-502.211] * (-501.464) (-504.651) (-500.567) [-502.867] -- 0:00:17
780000 -- (-506.367) (-501.471) [-502.528] (-502.964) * (-505.748) [-506.306] (-503.413) (-503.847) -- 0:00:17
Average standard deviation of split frequencies: 0.008227
780500 -- (-504.549) [-501.307] (-507.606) (-501.148) * (-501.420) [-504.227] (-504.744) (-506.595) -- 0:00:17
781000 -- (-501.402) (-501.344) (-502.367) [-501.139] * (-501.208) (-502.102) [-501.115] (-501.829) -- 0:00:17
781500 -- (-501.581) (-504.892) [-502.205] (-501.203) * [-501.467] (-504.221) (-502.377) (-503.466) -- 0:00:17
782000 -- (-502.919) (-501.907) [-500.811] (-501.099) * (-505.391) (-504.457) (-505.219) [-503.592] -- 0:00:17
782500 -- (-502.142) (-501.641) [-502.952] (-501.007) * (-501.756) [-505.494] (-502.982) (-506.114) -- 0:00:17
783000 -- (-506.857) (-500.728) [-501.362] (-505.847) * (-501.440) (-503.969) (-503.846) [-501.130] -- 0:00:17
783500 -- [-501.042] (-506.638) (-503.739) (-503.456) * (-502.687) [-501.736] (-506.602) (-500.661) -- 0:00:17
784000 -- (-500.932) (-505.428) (-510.086) [-501.334] * (-506.592) (-504.170) (-502.443) [-501.942] -- 0:00:17
784500 -- [-502.802] (-508.755) (-503.113) (-505.376) * [-503.198] (-506.852) (-504.368) (-500.574) -- 0:00:17
785000 -- (-504.808) (-503.071) (-501.639) [-501.629] * (-504.449) [-500.522] (-501.852) (-504.994) -- 0:00:16
Average standard deviation of split frequencies: 0.008022
785500 -- (-502.738) (-503.069) [-503.862] (-503.559) * [-501.557] (-501.730) (-508.430) (-504.310) -- 0:00:16
786000 -- (-502.717) (-505.692) [-501.808] (-502.978) * (-500.610) [-506.051] (-504.490) (-505.608) -- 0:00:16
786500 -- (-501.864) [-503.219] (-503.336) (-503.262) * (-506.413) (-503.852) (-508.572) [-501.363] -- 0:00:16
787000 -- (-502.355) (-502.682) [-502.839] (-502.518) * (-509.115) [-505.638] (-501.655) (-501.900) -- 0:00:16
787500 -- [-503.713] (-502.228) (-504.946) (-501.205) * [-504.931] (-505.250) (-501.543) (-502.992) -- 0:00:16
788000 -- (-503.040) (-503.636) (-500.709) [-502.456] * [-507.320] (-503.727) (-501.545) (-504.500) -- 0:00:16
788500 -- (-502.547) [-502.823] (-505.108) (-508.954) * (-502.583) (-504.555) (-501.423) [-502.308] -- 0:00:16
789000 -- (-504.326) [-500.848] (-504.909) (-505.807) * [-508.788] (-501.430) (-501.773) (-506.636) -- 0:00:16
789500 -- (-501.684) (-501.164) [-501.619] (-507.508) * [-503.159] (-507.670) (-500.918) (-506.896) -- 0:00:16
790000 -- (-502.593) [-504.016] (-502.791) (-502.547) * (-503.551) [-504.146] (-503.134) (-506.618) -- 0:00:16
Average standard deviation of split frequencies: 0.007713
790500 -- (-501.522) (-504.539) (-502.187) [-501.480] * (-502.254) [-500.804] (-502.094) (-507.720) -- 0:00:16
791000 -- [-503.673] (-502.571) (-505.052) (-500.381) * [-502.997] (-504.540) (-502.780) (-502.806) -- 0:00:16
791500 -- (-501.867) (-501.746) [-504.374] (-502.337) * (-501.020) [-503.171] (-505.725) (-502.030) -- 0:00:16
792000 -- [-503.478] (-506.530) (-503.910) (-505.515) * (-506.719) (-502.807) [-504.040] (-500.561) -- 0:00:16
792500 -- (-501.678) (-506.343) (-502.185) [-509.474] * (-508.479) (-507.163) (-501.837) [-502.552] -- 0:00:16
793000 -- (-502.411) (-503.098) (-504.158) [-502.478] * (-502.437) (-506.925) [-504.637] (-507.766) -- 0:00:16
793500 -- (-503.909) (-502.798) (-503.071) [-503.995] * [-501.393] (-501.068) (-503.435) (-507.894) -- 0:00:16
794000 -- (-502.957) (-503.650) [-501.508] (-503.565) * [-503.790] (-500.899) (-501.402) (-503.821) -- 0:00:16
794500 -- (-509.602) [-502.263] (-505.626) (-502.228) * (-502.522) [-505.347] (-503.408) (-502.788) -- 0:00:16
795000 -- (-501.020) [-503.683] (-500.949) (-501.892) * (-505.652) (-505.140) [-502.471] (-505.259) -- 0:00:16
Average standard deviation of split frequencies: 0.007995
795500 -- [-502.202] (-506.321) (-505.390) (-503.106) * [-503.917] (-503.296) (-503.039) (-505.130) -- 0:00:16
796000 -- (-501.996) (-506.498) [-501.233] (-501.805) * [-501.886] (-502.191) (-500.802) (-502.152) -- 0:00:16
796500 -- [-503.594] (-503.210) (-502.972) (-503.674) * (-502.995) (-502.433) (-503.626) [-503.509] -- 0:00:16
797000 -- [-503.601] (-505.935) (-508.573) (-501.609) * (-504.168) (-501.746) [-504.168] (-501.482) -- 0:00:16
797500 -- [-505.239] (-504.885) (-502.649) (-515.171) * (-503.218) (-502.162) (-504.338) [-502.351] -- 0:00:15
798000 -- (-502.892) (-502.591) [-503.847] (-502.932) * (-504.174) [-502.159] (-500.810) (-505.835) -- 0:00:15
798500 -- (-505.607) [-502.225] (-506.871) (-502.670) * [-502.911] (-502.500) (-503.749) (-500.749) -- 0:00:15
799000 -- (-500.820) (-501.412) (-504.631) [-501.987] * (-501.840) (-503.385) (-502.606) [-502.243] -- 0:00:15
799500 -- (-503.441) (-508.755) [-502.569] (-503.149) * (-505.503) (-504.379) (-502.860) [-501.524] -- 0:00:15
800000 -- (-504.624) (-504.462) [-502.429] (-501.129) * (-503.447) (-501.649) (-504.698) [-505.754] -- 0:00:15
Average standard deviation of split frequencies: 0.008132
800500 -- (-501.589) [-504.541] (-505.339) (-503.781) * [-501.063] (-501.731) (-503.431) (-504.938) -- 0:00:15
801000 -- [-503.352] (-503.099) (-504.601) (-502.081) * (-500.673) [-501.132] (-502.855) (-503.051) -- 0:00:15
801500 -- (-505.211) (-502.494) (-504.971) [-501.887] * [-500.684] (-502.329) (-501.475) (-501.792) -- 0:00:15
802000 -- (-504.352) (-501.943) (-502.591) [-502.066] * (-501.271) [-502.264] (-503.856) (-501.641) -- 0:00:15
802500 -- (-502.291) (-502.846) (-503.152) [-505.838] * (-505.478) (-502.403) (-506.360) [-501.035] -- 0:00:15
803000 -- (-505.083) (-503.628) (-501.473) [-503.144] * (-511.241) (-501.479) (-503.827) [-504.283] -- 0:00:15
803500 -- (-501.983) (-502.774) (-505.720) [-501.888] * (-506.177) (-503.653) [-500.633] (-502.587) -- 0:00:15
804000 -- (-502.272) [-502.389] (-501.256) (-504.067) * (-501.245) [-501.684] (-501.757) (-501.456) -- 0:00:15
804500 -- (-503.560) [-501.768] (-504.461) (-508.964) * (-503.288) [-500.723] (-506.300) (-500.468) -- 0:00:15
805000 -- [-501.814] (-504.473) (-506.068) (-509.453) * (-501.158) [-500.475] (-505.040) (-500.316) -- 0:00:15
Average standard deviation of split frequencies: 0.007969
805500 -- (-502.690) (-502.930) (-504.740) [-504.936] * (-501.256) (-502.294) (-502.617) [-501.047] -- 0:00:15
806000 -- (-504.333) (-502.085) [-501.067] (-503.745) * (-501.313) [-507.672] (-503.925) (-501.201) -- 0:00:15
806500 -- [-502.754] (-502.211) (-502.561) (-506.385) * (-504.021) (-505.263) [-503.399] (-502.361) -- 0:00:15
807000 -- [-501.250] (-501.237) (-502.808) (-506.108) * [-503.543] (-502.639) (-505.037) (-503.728) -- 0:00:15
807500 -- [-501.711] (-504.896) (-501.122) (-503.178) * [-507.323] (-501.782) (-501.190) (-500.754) -- 0:00:15
808000 -- (-502.065) [-507.978] (-501.549) (-502.634) * (-501.340) (-503.960) [-501.287] (-501.741) -- 0:00:15
808500 -- (-503.478) (-503.186) (-501.696) [-504.200] * [-503.824] (-505.729) (-505.881) (-505.850) -- 0:00:15
809000 -- (-504.440) (-505.348) (-506.320) [-501.553] * [-503.148] (-504.751) (-501.725) (-508.666) -- 0:00:15
809500 -- (-502.548) (-507.396) (-506.646) [-501.678] * (-504.331) (-503.515) [-501.861] (-502.503) -- 0:00:15
810000 -- (-500.901) [-500.885] (-503.688) (-500.666) * [-501.061] (-502.759) (-502.523) (-503.913) -- 0:00:15
Average standard deviation of split frequencies: 0.008286
810500 -- [-501.647] (-501.463) (-501.985) (-500.756) * [-501.808] (-501.672) (-502.437) (-506.983) -- 0:00:14
811000 -- (-501.258) [-500.857] (-501.304) (-502.194) * (-501.369) [-504.272] (-502.971) (-502.649) -- 0:00:14
811500 -- (-502.042) (-501.901) [-507.146] (-500.916) * (-503.146) [-507.267] (-506.128) (-505.202) -- 0:00:14
812000 -- [-504.623] (-505.144) (-502.682) (-502.497) * [-502.460] (-505.834) (-507.124) (-503.888) -- 0:00:14
812500 -- (-500.420) (-502.077) (-501.962) [-501.451] * (-503.105) (-505.808) [-501.963] (-505.980) -- 0:00:14
813000 -- (-505.548) (-502.546) [-502.946] (-506.021) * (-502.013) (-504.477) [-503.915] (-503.123) -- 0:00:14
813500 -- [-502.943] (-501.342) (-503.248) (-500.953) * [-501.879] (-504.891) (-506.578) (-501.230) -- 0:00:14
814000 -- (-502.082) (-504.562) (-503.208) [-501.162] * [-501.221] (-503.052) (-504.628) (-503.601) -- 0:00:14
814500 -- (-505.570) [-505.898] (-503.478) (-501.320) * [-501.763] (-505.640) (-507.309) (-502.566) -- 0:00:14
815000 -- (-506.323) [-501.078] (-501.091) (-504.126) * (-506.372) (-501.956) (-504.173) [-501.634] -- 0:00:14
Average standard deviation of split frequencies: 0.008629
815500 -- (-503.937) (-502.317) (-504.392) [-501.341] * (-503.240) (-502.111) [-502.933] (-502.136) -- 0:00:14
816000 -- (-504.111) [-502.453] (-505.297) (-502.414) * (-501.505) (-503.983) [-502.529] (-506.504) -- 0:00:14
816500 -- (-501.240) (-503.628) (-501.705) [-503.650] * (-502.993) (-502.219) (-501.466) [-506.709] -- 0:00:14
817000 -- [-501.772] (-501.873) (-503.108) (-500.503) * (-503.186) (-502.399) [-501.960] (-502.844) -- 0:00:14
817500 -- (-502.168) (-500.797) [-503.071] (-502.809) * (-502.968) (-503.680) (-507.386) [-502.800] -- 0:00:14
818000 -- (-501.544) (-501.178) (-503.161) [-500.479] * (-504.396) (-504.549) (-502.413) [-503.347] -- 0:00:14
818500 -- (-501.629) (-507.941) [-502.908] (-501.048) * (-503.117) (-509.493) (-501.747) [-501.644] -- 0:00:14
819000 -- (-503.173) (-503.564) [-503.008] (-501.517) * (-501.395) [-507.294] (-502.382) (-504.283) -- 0:00:14
819500 -- (-501.827) [-500.921] (-508.054) (-503.103) * (-501.018) (-501.832) [-501.181] (-501.285) -- 0:00:14
820000 -- [-502.891] (-500.504) (-501.893) (-503.095) * (-502.284) (-502.204) (-501.560) [-501.255] -- 0:00:14
Average standard deviation of split frequencies: 0.008042
820500 -- (-507.762) (-502.214) (-503.148) [-501.912] * (-504.556) (-501.608) [-501.651] (-501.378) -- 0:00:14
821000 -- (-502.922) (-500.911) [-505.264] (-505.116) * (-502.979) [-505.030] (-502.533) (-503.424) -- 0:00:14
821500 -- [-503.161] (-501.113) (-504.356) (-502.584) * (-508.258) [-503.153] (-505.266) (-505.199) -- 0:00:14
822000 -- (-501.449) (-502.440) (-505.296) [-502.517] * (-508.254) (-502.987) (-503.225) [-505.153] -- 0:00:14
822500 -- [-501.846] (-501.064) (-502.838) (-502.315) * (-500.832) (-501.425) (-503.674) [-508.509] -- 0:00:14
823000 -- (-502.708) [-500.958] (-501.617) (-501.666) * (-501.799) (-508.260) (-502.636) [-504.610] -- 0:00:13
823500 -- [-502.106] (-502.214) (-505.484) (-501.620) * (-510.897) [-506.641] (-502.278) (-501.433) -- 0:00:13
824000 -- (-502.205) (-501.838) [-500.827] (-501.473) * [-502.975] (-503.677) (-502.346) (-502.166) -- 0:00:13
824500 -- [-503.406] (-501.388) (-501.967) (-501.417) * (-502.537) (-502.101) [-504.719] (-502.705) -- 0:00:13
825000 -- (-503.663) [-502.178] (-504.372) (-502.567) * (-504.411) [-501.907] (-500.697) (-504.380) -- 0:00:13
Average standard deviation of split frequencies: 0.007633
825500 -- (-503.933) [-501.452] (-504.356) (-502.332) * (-503.834) [-502.925] (-502.083) (-503.443) -- 0:00:13
826000 -- (-504.606) (-502.532) [-501.127] (-505.342) * (-502.900) (-502.300) (-501.842) [-500.453] -- 0:00:13
826500 -- (-501.546) (-502.287) [-504.120] (-502.671) * (-501.062) (-502.616) (-505.583) [-502.556] -- 0:00:13
827000 -- (-501.464) [-501.337] (-500.779) (-503.450) * (-505.898) (-504.298) [-502.412] (-503.103) -- 0:00:13
827500 -- (-502.559) (-505.860) (-503.719) [-503.435] * (-502.599) (-501.750) [-503.345] (-501.603) -- 0:00:13
828000 -- [-502.771] (-501.683) (-503.893) (-502.780) * (-503.750) [-503.524] (-505.663) (-503.939) -- 0:00:13
828500 -- [-501.936] (-502.650) (-501.651) (-502.509) * (-501.587) (-503.999) [-500.920] (-502.632) -- 0:00:13
829000 -- [-501.544] (-502.534) (-503.117) (-502.514) * (-503.550) (-504.449) (-502.802) [-500.882] -- 0:00:13
829500 -- (-504.024) (-502.324) [-502.474] (-501.648) * (-503.276) (-501.049) (-504.853) [-500.798] -- 0:00:13
830000 -- (-503.145) (-507.084) [-503.773] (-503.855) * (-503.828) (-502.725) (-502.231) [-500.489] -- 0:00:13
Average standard deviation of split frequencies: 0.007590
830500 -- (-501.868) (-509.512) (-502.096) [-502.004] * (-505.648) (-503.925) (-503.220) [-501.621] -- 0:00:13
831000 -- (-502.507) (-504.438) (-501.280) [-503.361] * [-501.595] (-501.532) (-504.441) (-501.621) -- 0:00:13
831500 -- [-501.227] (-502.183) (-503.252) (-501.840) * (-506.671) (-502.425) (-504.353) [-500.953] -- 0:00:13
832000 -- (-501.025) (-502.272) [-502.641] (-501.362) * (-502.605) (-504.707) [-503.815] (-502.851) -- 0:00:13
832500 -- [-504.461] (-502.387) (-502.906) (-500.823) * [-503.270] (-504.220) (-510.899) (-503.630) -- 0:00:13
833000 -- (-504.492) (-501.333) (-501.807) [-502.677] * (-502.121) [-503.787] (-502.251) (-506.564) -- 0:00:13
833500 -- (-503.088) (-502.482) [-503.349] (-501.226) * [-504.491] (-502.743) (-501.525) (-505.502) -- 0:00:13
834000 -- (-503.679) [-504.555] (-501.429) (-501.463) * (-504.161) [-502.753] (-503.856) (-509.078) -- 0:00:13
834500 -- (-502.136) (-504.168) [-503.285] (-503.990) * [-501.343] (-502.837) (-502.066) (-503.595) -- 0:00:13
835000 -- [-502.337] (-505.891) (-503.278) (-503.550) * (-502.528) (-505.042) (-502.361) [-504.180] -- 0:00:13
Average standard deviation of split frequencies: 0.007577
835500 -- (-504.153) [-504.320] (-504.366) (-501.788) * [-502.681] (-504.283) (-501.555) (-506.529) -- 0:00:12
836000 -- (-503.127) (-502.991) (-502.457) [-502.292] * [-501.084] (-504.959) (-502.807) (-501.769) -- 0:00:12
836500 -- (-502.490) [-502.795] (-500.624) (-503.814) * (-507.692) [-501.336] (-503.808) (-502.377) -- 0:00:12
837000 -- [-502.595] (-507.308) (-501.066) (-502.770) * (-502.033) (-503.807) (-502.926) [-503.380] -- 0:00:12
837500 -- [-501.783] (-502.457) (-501.852) (-503.731) * (-503.081) (-502.547) (-504.422) [-502.653] -- 0:00:12
838000 -- (-504.325) [-502.273] (-500.318) (-504.596) * (-501.735) (-502.064) (-503.734) [-504.598] -- 0:00:12
838500 -- (-504.283) (-503.531) (-500.649) [-503.091] * [-500.642] (-503.255) (-505.172) (-501.749) -- 0:00:12
839000 -- [-505.589] (-505.730) (-501.705) (-503.751) * (-503.791) [-501.151] (-505.484) (-503.030) -- 0:00:12
839500 -- [-506.318] (-507.508) (-501.722) (-502.280) * (-501.210) (-504.921) [-501.378] (-503.824) -- 0:00:12
840000 -- (-507.238) (-504.687) (-501.463) [-501.543] * (-500.972) (-501.756) [-501.144] (-501.506) -- 0:00:12
Average standard deviation of split frequencies: 0.007395
840500 -- (-504.205) (-502.111) (-503.463) [-501.922] * (-502.869) [-504.286] (-501.050) (-505.037) -- 0:00:12
841000 -- [-503.213] (-502.868) (-508.043) (-506.755) * (-504.701) [-503.032] (-500.752) (-504.893) -- 0:00:12
841500 -- (-506.135) (-502.677) [-504.504] (-501.900) * [-508.774] (-506.228) (-501.582) (-501.163) -- 0:00:12
842000 -- (-503.061) (-506.431) (-503.677) [-501.112] * (-502.333) (-504.145) (-505.763) [-502.660] -- 0:00:12
842500 -- (-503.123) (-503.879) (-506.240) [-502.667] * (-503.131) (-502.024) [-504.630] (-502.592) -- 0:00:12
843000 -- (-503.857) (-505.371) (-504.573) [-503.610] * (-505.191) (-502.966) [-504.355] (-505.352) -- 0:00:12
843500 -- [-502.056] (-501.990) (-502.611) (-503.941) * (-501.781) [-501.680] (-503.671) (-507.911) -- 0:00:12
844000 -- (-503.696) (-501.311) [-502.297] (-502.284) * (-505.133) [-506.979] (-502.876) (-501.403) -- 0:00:12
844500 -- (-504.416) (-506.615) (-508.901) [-503.239] * (-502.685) [-502.738] (-503.061) (-503.351) -- 0:00:12
845000 -- [-503.896] (-507.481) (-506.263) (-501.718) * (-500.705) (-505.257) [-501.465] (-501.404) -- 0:00:12
Average standard deviation of split frequencies: 0.007662
845500 -- [-501.443] (-502.886) (-501.034) (-502.301) * (-501.453) [-500.676] (-503.096) (-501.407) -- 0:00:12
846000 -- (-506.635) (-500.524) (-500.673) [-501.370] * (-502.663) (-502.118) (-504.818) [-502.496] -- 0:00:12
846500 -- [-503.333] (-500.629) (-502.103) (-502.044) * (-504.616) (-507.856) [-505.315] (-502.978) -- 0:00:12
847000 -- [-506.352] (-501.795) (-503.477) (-501.997) * (-501.180) (-501.804) (-505.465) [-501.258] -- 0:00:12
847500 -- (-501.743) [-504.261] (-502.560) (-503.565) * (-502.329) [-503.117] (-505.965) (-502.503) -- 0:00:12
848000 -- [-501.233] (-502.569) (-504.045) (-506.127) * [-503.520] (-503.887) (-506.163) (-501.917) -- 0:00:12
848500 -- (-503.546) (-501.683) (-503.914) [-506.019] * [-501.714] (-502.619) (-502.054) (-501.816) -- 0:00:11
849000 -- (-503.976) (-501.729) (-502.831) [-502.442] * (-502.906) [-500.687] (-502.359) (-506.222) -- 0:00:11
849500 -- (-513.154) (-504.050) [-501.775] (-504.172) * (-502.169) [-501.122] (-501.842) (-502.610) -- 0:00:11
850000 -- (-502.520) (-505.605) [-500.955] (-503.329) * (-503.496) [-502.223] (-503.800) (-508.962) -- 0:00:11
Average standard deviation of split frequencies: 0.007585
850500 -- [-503.921] (-504.136) (-502.900) (-503.194) * (-502.956) (-504.096) [-502.390] (-503.061) -- 0:00:11
851000 -- [-500.923] (-506.029) (-501.002) (-502.814) * (-500.348) (-503.642) [-503.721] (-500.963) -- 0:00:11
851500 -- [-504.004] (-507.219) (-503.748) (-504.085) * (-500.348) (-500.790) (-502.063) [-504.821] -- 0:00:11
852000 -- [-503.907] (-502.870) (-504.474) (-503.478) * (-503.449) (-502.389) [-505.599] (-502.452) -- 0:00:11
852500 -- (-504.450) [-501.432] (-503.757) (-505.036) * [-503.131] (-504.118) (-501.559) (-502.527) -- 0:00:11
853000 -- (-501.860) [-502.111] (-506.663) (-501.387) * [-503.026] (-502.917) (-501.744) (-505.498) -- 0:00:11
853500 -- (-504.423) (-504.239) (-503.549) [-503.784] * [-501.721] (-503.605) (-505.318) (-504.688) -- 0:00:11
854000 -- (-506.276) [-504.792] (-501.971) (-502.935) * (-502.687) [-503.435] (-503.343) (-503.161) -- 0:00:11
854500 -- (-503.867) (-501.755) [-503.227] (-501.861) * (-506.682) (-501.928) (-507.822) [-501.649] -- 0:00:11
855000 -- (-505.857) (-501.989) [-502.159] (-502.875) * (-506.415) [-500.808] (-506.675) (-503.061) -- 0:00:11
Average standard deviation of split frequencies: 0.006792
855500 -- (-502.739) (-504.263) (-503.560) [-500.910] * (-512.141) [-502.524] (-505.061) (-501.708) -- 0:00:11
856000 -- (-502.713) (-502.044) (-502.509) [-500.876] * [-505.941] (-501.449) (-502.244) (-504.290) -- 0:00:11
856500 -- (-504.961) (-505.761) (-504.312) [-502.355] * (-502.356) (-503.263) [-502.041] (-503.032) -- 0:00:11
857000 -- (-502.454) (-502.088) (-501.625) [-503.353] * (-505.042) [-502.618] (-505.187) (-506.551) -- 0:00:11
857500 -- (-503.123) [-501.779] (-503.511) (-507.568) * (-500.915) (-505.007) [-501.282] (-504.356) -- 0:00:11
858000 -- (-501.124) (-502.350) (-501.177) [-504.304] * (-501.756) [-505.531] (-510.312) (-501.406) -- 0:00:11
858500 -- (-506.629) (-502.532) [-503.899] (-503.974) * (-500.991) (-502.830) (-503.675) [-504.174] -- 0:00:11
859000 -- (-502.875) (-501.707) (-504.599) [-502.637] * [-501.269] (-501.865) (-503.764) (-502.007) -- 0:00:11
859500 -- [-501.648] (-501.588) (-504.496) (-504.103) * (-500.946) [-500.878] (-502.001) (-500.343) -- 0:00:11
860000 -- [-501.688] (-503.584) (-503.544) (-505.210) * (-504.140) (-500.696) [-502.363] (-502.441) -- 0:00:11
Average standard deviation of split frequencies: 0.007559
860500 -- [-500.687] (-504.730) (-503.996) (-505.850) * [-501.980] (-502.614) (-506.929) (-501.514) -- 0:00:11
861000 -- (-501.110) (-505.796) (-502.970) [-502.061] * (-501.936) (-503.214) (-501.102) [-502.750] -- 0:00:10
861500 -- [-503.019] (-504.644) (-503.405) (-503.623) * (-503.913) (-504.040) [-500.523] (-501.785) -- 0:00:10
862000 -- (-501.798) (-504.362) (-503.552) [-501.707] * (-500.760) (-504.315) (-500.624) [-503.672] -- 0:00:10
862500 -- (-502.356) (-504.350) [-501.964] (-500.979) * (-502.888) (-503.792) [-503.310] (-501.496) -- 0:00:10
863000 -- (-501.676) (-507.303) [-502.820] (-500.500) * [-503.837] (-502.184) (-501.766) (-500.520) -- 0:00:10
863500 -- (-501.161) (-502.460) (-506.604) [-501.926] * (-504.602) (-503.228) [-502.693] (-505.225) -- 0:00:10
864000 -- (-503.164) (-502.596) (-503.553) [-505.068] * (-500.762) (-502.656) [-502.774] (-501.712) -- 0:00:10
864500 -- [-501.656] (-506.136) (-508.924) (-506.020) * [-502.900] (-503.034) (-503.940) (-502.227) -- 0:00:10
865000 -- (-503.007) [-502.154] (-505.117) (-502.470) * (-500.704) (-502.373) [-501.441] (-502.344) -- 0:00:10
Average standard deviation of split frequencies: 0.007185
865500 -- [-502.354] (-500.448) (-504.023) (-501.307) * [-500.508] (-502.851) (-503.295) (-501.543) -- 0:00:10
866000 -- (-501.744) (-501.959) [-501.338] (-503.698) * (-502.032) (-502.872) (-502.499) [-501.387] -- 0:00:10
866500 -- (-506.924) [-501.917] (-501.438) (-501.613) * (-502.199) (-503.812) (-501.456) [-501.609] -- 0:00:10
867000 -- (-503.107) (-506.431) (-501.902) [-501.682] * [-502.051] (-507.827) (-501.272) (-502.596) -- 0:00:10
867500 -- (-500.974) (-504.607) [-502.650] (-506.560) * (-509.690) (-502.886) (-501.683) [-512.248] -- 0:00:10
868000 -- (-503.997) (-503.586) [-503.046] (-504.506) * (-507.008) (-502.663) (-500.568) [-501.093] -- 0:00:10
868500 -- (-507.095) [-501.979] (-505.486) (-501.760) * (-508.581) (-505.384) [-503.134] (-503.568) -- 0:00:10
869000 -- (-502.577) (-502.857) [-506.008] (-500.427) * (-501.024) [-500.325] (-506.169) (-503.468) -- 0:00:10
869500 -- [-501.620] (-504.125) (-503.613) (-506.183) * (-501.550) (-505.344) [-506.302] (-502.274) -- 0:00:10
870000 -- (-503.615) (-502.261) [-504.537] (-502.358) * [-501.470] (-502.949) (-503.160) (-502.272) -- 0:00:10
Average standard deviation of split frequencies: 0.007616
870500 -- (-503.300) (-502.359) (-503.743) [-501.948] * (-502.498) [-501.108] (-502.770) (-500.543) -- 0:00:10
871000 -- [-501.267] (-502.032) (-504.470) (-502.320) * (-504.378) [-503.444] (-504.479) (-500.631) -- 0:00:10
871500 -- [-501.622] (-504.464) (-502.737) (-503.811) * (-502.699) [-502.308] (-504.543) (-500.949) -- 0:00:10
872000 -- (-501.363) (-501.956) [-500.667] (-502.744) * [-502.249] (-502.657) (-507.385) (-501.253) -- 0:00:10
872500 -- [-504.049] (-501.213) (-500.805) (-501.875) * [-502.209] (-502.471) (-507.751) (-502.971) -- 0:00:10
873000 -- (-507.253) [-502.732] (-504.907) (-501.307) * (-502.473) [-503.281] (-505.027) (-504.301) -- 0:00:10
873500 -- (-507.721) [-502.191] (-502.361) (-501.253) * (-504.069) [-502.019] (-502.853) (-502.738) -- 0:00:09
874000 -- (-502.768) [-502.189] (-504.498) (-500.258) * (-504.125) (-501.512) (-501.661) [-503.488] -- 0:00:09
874500 -- [-502.021] (-502.184) (-501.262) (-500.863) * [-503.455] (-504.564) (-501.256) (-502.425) -- 0:00:09
875000 -- [-504.563] (-506.130) (-500.902) (-501.684) * (-503.689) (-503.763) [-501.580] (-504.835) -- 0:00:09
Average standard deviation of split frequencies: 0.007749
875500 -- (-511.050) (-506.179) [-500.400] (-502.087) * (-501.911) (-503.052) [-504.406] (-503.142) -- 0:00:09
876000 -- (-505.225) (-500.987) [-501.786] (-504.812) * (-501.851) [-503.284] (-503.317) (-501.001) -- 0:00:09
876500 -- [-505.290] (-501.060) (-505.001) (-502.470) * (-504.647) [-503.420] (-503.902) (-500.893) -- 0:00:09
877000 -- [-502.104] (-502.674) (-504.280) (-503.518) * (-503.753) (-501.934) [-502.245] (-502.178) -- 0:00:09
877500 -- (-506.119) (-502.816) (-501.199) [-503.129] * (-503.530) (-501.491) [-503.035] (-506.363) -- 0:00:09
878000 -- (-504.400) (-503.663) [-502.279] (-501.399) * (-503.796) (-500.954) [-502.832] (-507.119) -- 0:00:09
878500 -- (-507.122) (-502.530) [-501.227] (-501.471) * (-507.990) (-502.822) [-502.533] (-504.404) -- 0:00:09
879000 -- [-503.399] (-503.110) (-500.798) (-502.996) * (-503.230) [-501.106] (-503.964) (-505.111) -- 0:00:09
879500 -- (-501.546) (-503.103) (-502.187) [-501.164] * (-501.947) (-501.296) [-500.929] (-506.709) -- 0:00:09
880000 -- [-505.011] (-504.518) (-501.815) (-501.359) * [-502.448] (-502.361) (-501.461) (-505.020) -- 0:00:09
Average standard deviation of split frequencies: 0.007601
880500 -- (-500.627) (-500.830) [-501.475] (-503.950) * (-503.768) (-504.889) (-501.866) [-502.372] -- 0:00:09
881000 -- (-504.446) (-500.647) (-501.192) [-503.600] * (-501.072) (-503.560) (-501.886) [-502.503] -- 0:00:09
881500 -- (-500.398) [-502.273] (-501.955) (-500.560) * (-500.531) (-503.546) [-501.233] (-505.128) -- 0:00:09
882000 -- [-501.767] (-503.456) (-501.693) (-501.186) * (-502.539) [-503.756] (-501.583) (-502.542) -- 0:00:09
882500 -- [-502.346] (-502.766) (-504.879) (-500.966) * (-502.664) [-503.263] (-504.701) (-505.080) -- 0:00:09
883000 -- (-505.208) [-501.877] (-503.277) (-501.429) * (-506.713) (-502.229) (-503.357) [-502.880] -- 0:00:09
883500 -- (-501.336) (-501.862) [-501.948] (-501.197) * (-507.645) (-503.822) (-503.834) [-500.662] -- 0:00:09
884000 -- (-502.655) [-502.545] (-501.210) (-501.802) * (-503.834) [-502.044] (-504.228) (-502.664) -- 0:00:09
884500 -- (-501.681) [-504.084] (-501.052) (-505.565) * [-501.957] (-503.105) (-502.526) (-503.193) -- 0:00:09
885000 -- (-500.516) [-501.231] (-501.232) (-502.193) * [-501.472] (-501.635) (-504.211) (-502.746) -- 0:00:09
Average standard deviation of split frequencies: 0.007697
885500 -- [-502.864] (-507.710) (-500.954) (-501.435) * (-503.000) (-506.559) (-503.168) [-503.022] -- 0:00:09
886000 -- (-508.946) [-502.099] (-500.664) (-503.407) * (-506.482) (-507.594) [-501.386] (-501.373) -- 0:00:09
886500 -- (-504.583) [-502.214] (-502.141) (-503.811) * [-502.481] (-505.422) (-501.380) (-501.721) -- 0:00:08
887000 -- [-502.064] (-502.043) (-501.372) (-502.750) * (-505.089) (-501.190) [-503.859] (-504.476) -- 0:00:08
887500 -- (-503.959) [-502.349] (-505.267) (-502.368) * (-505.769) [-503.100] (-509.253) (-502.892) -- 0:00:08
888000 -- (-503.349) [-502.628] (-502.891) (-502.657) * (-506.986) (-504.516) (-509.447) [-502.902] -- 0:00:08
888500 -- (-501.938) (-501.157) (-506.335) [-505.135] * [-508.685] (-503.245) (-503.776) (-501.929) -- 0:00:08
889000 -- (-505.417) (-502.505) (-505.148) [-502.462] * (-501.461) (-506.401) [-501.637] (-509.623) -- 0:00:08
889500 -- (-504.458) (-502.615) (-503.403) [-501.575] * [-501.150] (-503.345) (-506.237) (-503.449) -- 0:00:08
890000 -- (-508.238) (-502.504) [-502.616] (-502.591) * [-503.581] (-505.743) (-509.833) (-501.204) -- 0:00:08
Average standard deviation of split frequencies: 0.007833
890500 -- (-506.481) [-502.850] (-500.882) (-501.070) * (-502.600) (-502.802) (-501.897) [-502.663] -- 0:00:08
891000 -- (-501.210) [-502.898] (-504.991) (-501.088) * (-504.795) (-501.351) [-505.937] (-501.227) -- 0:00:08
891500 -- (-502.268) (-502.409) [-501.658] (-502.701) * (-505.110) (-503.588) (-502.037) [-502.094] -- 0:00:08
892000 -- (-508.306) (-503.343) (-503.696) [-501.855] * [-504.448] (-503.097) (-506.640) (-502.917) -- 0:00:08
892500 -- [-503.504] (-503.341) (-501.503) (-502.371) * [-506.362] (-500.753) (-503.526) (-500.554) -- 0:00:08
893000 -- (-501.348) (-502.618) [-505.386] (-503.008) * (-501.150) (-506.098) [-502.575] (-502.421) -- 0:00:08
893500 -- (-502.519) [-501.175] (-502.101) (-503.179) * [-501.502] (-502.801) (-503.815) (-503.524) -- 0:00:08
894000 -- (-502.984) (-501.271) [-503.608] (-505.758) * (-503.409) [-504.713] (-501.356) (-503.073) -- 0:00:08
894500 -- [-501.821] (-501.177) (-502.557) (-503.332) * (-502.601) (-503.851) (-503.318) [-500.846] -- 0:00:08
895000 -- (-504.528) [-504.181] (-502.810) (-502.794) * (-504.314) [-509.444] (-503.041) (-501.935) -- 0:00:08
Average standard deviation of split frequencies: 0.008313
895500 -- [-502.827] (-501.638) (-503.273) (-501.455) * [-505.295] (-501.942) (-508.603) (-501.309) -- 0:00:08
896000 -- [-506.768] (-501.698) (-501.776) (-501.091) * [-504.761] (-502.334) (-504.602) (-502.444) -- 0:00:08
896500 -- [-505.169] (-502.328) (-501.801) (-500.869) * (-500.624) [-501.068] (-504.555) (-502.400) -- 0:00:08
897000 -- (-503.777) (-503.225) [-505.575] (-501.009) * (-503.644) [-501.169] (-504.967) (-501.663) -- 0:00:08
897500 -- (-505.116) (-501.995) [-502.674] (-501.997) * (-506.251) (-501.504) (-505.862) [-502.053] -- 0:00:08
898000 -- [-507.827] (-507.656) (-501.996) (-501.453) * (-505.980) [-502.786] (-505.611) (-501.747) -- 0:00:08
898500 -- (-505.200) (-504.407) [-506.089] (-501.756) * (-511.431) (-505.463) (-502.885) [-501.385] -- 0:00:08
899000 -- [-501.570] (-501.397) (-507.602) (-507.022) * (-504.136) (-502.321) (-503.037) [-500.779] -- 0:00:07
899500 -- (-501.966) [-503.092] (-503.117) (-501.202) * (-507.450) [-505.797] (-504.215) (-503.733) -- 0:00:07
900000 -- (-502.657) (-503.032) [-502.047] (-501.097) * (-505.430) [-504.302] (-501.754) (-502.941) -- 0:00:07
Average standard deviation of split frequencies: 0.008374
900500 -- (-506.576) (-503.087) [-501.710] (-502.236) * [-502.474] (-503.206) (-501.692) (-504.562) -- 0:00:07
901000 -- (-502.338) (-502.254) [-501.431] (-500.915) * (-502.289) (-504.183) [-501.529] (-503.356) -- 0:00:07
901500 -- (-502.838) (-511.209) [-503.016] (-503.392) * (-501.805) (-504.180) (-502.149) [-502.185] -- 0:00:07
902000 -- [-501.124] (-502.565) (-504.721) (-501.641) * [-500.662] (-504.713) (-500.740) (-503.006) -- 0:00:07
902500 -- (-502.058) (-502.371) (-503.500) [-501.489] * (-500.447) (-503.216) [-500.574] (-502.965) -- 0:00:07
903000 -- (-501.565) (-504.527) (-510.951) [-502.727] * [-501.288] (-502.566) (-500.797) (-503.892) -- 0:00:07
903500 -- (-506.866) (-502.793) (-501.932) [-503.526] * [-502.792] (-501.358) (-502.082) (-501.450) -- 0:00:07
904000 -- (-504.578) [-501.529] (-505.100) (-500.872) * [-502.253] (-502.636) (-504.238) (-501.822) -- 0:00:07
904500 -- [-502.600] (-503.443) (-502.866) (-501.873) * (-501.309) [-502.035] (-503.561) (-503.445) -- 0:00:07
905000 -- (-505.382) (-501.966) [-501.936] (-501.624) * (-503.564) (-503.944) (-506.011) [-501.390] -- 0:00:07
Average standard deviation of split frequencies: 0.007978
905500 -- (-503.213) [-501.292] (-501.086) (-501.616) * (-506.044) [-501.400] (-501.932) (-503.726) -- 0:00:07
906000 -- (-502.228) [-501.144] (-501.569) (-503.172) * [-503.166] (-504.949) (-501.610) (-502.385) -- 0:00:07
906500 -- (-509.304) [-501.487] (-503.141) (-501.989) * [-501.416] (-501.568) (-504.709) (-503.618) -- 0:00:07
907000 -- (-504.177) (-500.768) [-502.989] (-511.995) * (-503.524) (-510.845) [-501.617] (-503.167) -- 0:00:07
907500 -- (-503.772) (-501.174) [-501.449] (-506.863) * (-506.655) [-500.922] (-501.762) (-502.097) -- 0:00:07
908000 -- (-503.160) (-503.533) (-508.451) [-501.743] * [-504.025] (-506.881) (-500.677) (-500.897) -- 0:00:07
908500 -- [-503.718] (-503.003) (-503.156) (-502.396) * (-505.035) [-502.443] (-500.827) (-503.182) -- 0:00:07
909000 -- (-503.085) [-503.880] (-502.173) (-502.669) * [-503.876] (-501.095) (-501.016) (-506.397) -- 0:00:07
909500 -- (-501.703) [-500.265] (-505.525) (-501.474) * (-500.975) [-506.028] (-502.406) (-502.376) -- 0:00:07
910000 -- [-503.337] (-504.783) (-507.010) (-502.748) * (-503.516) (-506.838) [-502.250] (-503.021) -- 0:00:07
Average standard deviation of split frequencies: 0.008248
910500 -- (-501.819) (-501.245) (-502.415) [-501.279] * [-503.733] (-503.185) (-507.057) (-503.321) -- 0:00:07
911000 -- (-502.387) (-504.953) [-502.470] (-503.763) * [-501.419] (-501.061) (-502.769) (-507.748) -- 0:00:07
911500 -- [-502.432] (-501.054) (-503.718) (-506.111) * (-504.343) (-501.073) (-508.864) [-501.927] -- 0:00:06
912000 -- [-509.832] (-501.491) (-503.769) (-506.066) * (-505.541) [-501.757] (-505.572) (-501.729) -- 0:00:06
912500 -- (-504.184) (-501.566) [-502.486] (-501.855) * [-503.940] (-502.678) (-503.888) (-502.691) -- 0:00:06
913000 -- (-504.667) (-505.889) (-502.060) [-501.365] * (-503.984) [-503.376] (-504.526) (-501.407) -- 0:00:06
913500 -- (-507.050) (-505.063) [-502.367] (-503.368) * (-502.204) (-501.373) [-500.775] (-503.772) -- 0:00:06
914000 -- (-509.365) (-504.686) [-502.272] (-504.872) * [-500.953] (-501.023) (-503.370) (-505.187) -- 0:00:06
914500 -- (-504.418) (-508.095) (-501.790) [-503.576] * (-501.169) (-501.876) (-505.100) [-502.283] -- 0:00:06
915000 -- (-500.607) [-507.021] (-501.641) (-504.858) * (-504.821) (-500.747) (-510.655) [-501.502] -- 0:00:06
Average standard deviation of split frequencies: 0.007925
915500 -- (-507.285) (-503.172) (-503.977) [-501.835] * (-503.596) [-503.562] (-503.868) (-501.246) -- 0:00:06
916000 -- [-502.002] (-508.976) (-501.382) (-502.448) * (-501.899) (-503.220) (-502.907) [-501.861] -- 0:00:06
916500 -- (-502.476) (-505.287) (-502.641) [-502.620] * (-504.016) [-505.049] (-504.439) (-505.861) -- 0:00:06
917000 -- (-504.672) (-503.179) [-501.208] (-502.499) * (-504.421) [-501.266] (-503.303) (-501.909) -- 0:00:06
917500 -- (-506.831) (-503.858) (-501.740) [-503.734] * (-501.939) (-502.769) [-501.981] (-504.181) -- 0:00:06
918000 -- (-501.730) (-505.275) [-502.017] (-501.369) * [-501.229] (-501.925) (-501.429) (-504.872) -- 0:00:06
918500 -- (-505.209) (-502.743) (-503.039) [-501.951] * (-501.583) (-502.341) [-503.129] (-505.789) -- 0:00:06
919000 -- (-509.105) (-505.973) (-502.578) [-500.521] * (-502.370) (-503.101) (-501.627) [-501.034] -- 0:00:06
919500 -- (-504.015) (-509.758) (-501.517) [-501.059] * (-502.282) (-502.407) (-503.379) [-501.119] -- 0:00:06
920000 -- (-507.278) (-507.164) [-501.075] (-500.993) * (-506.050) (-504.711) [-501.632] (-503.658) -- 0:00:06
Average standard deviation of split frequencies: 0.008192
920500 -- (-502.262) [-501.937] (-501.424) (-501.767) * (-504.511) (-501.505) [-503.358] (-506.697) -- 0:00:06
921000 -- (-503.839) (-501.610) (-503.741) [-502.237] * [-502.161] (-501.503) (-508.768) (-504.174) -- 0:00:06
921500 -- (-503.112) (-501.131) (-505.176) [-503.258] * (-503.122) (-501.020) (-504.859) [-501.712] -- 0:00:06
922000 -- [-501.493] (-503.585) (-504.305) (-504.729) * (-502.114) [-501.999] (-502.507) (-503.172) -- 0:00:06
922500 -- [-504.213] (-500.676) (-504.802) (-501.132) * (-503.790) (-502.744) (-504.296) [-500.890] -- 0:00:06
923000 -- (-501.380) (-502.427) [-500.447] (-503.949) * (-503.490) (-503.420) [-501.733] (-502.279) -- 0:00:06
923500 -- (-503.216) (-502.497) [-501.759] (-502.496) * (-502.281) (-500.360) (-502.049) [-502.629] -- 0:00:06
924000 -- (-501.951) (-502.818) [-503.610] (-501.474) * (-504.678) [-503.762] (-503.411) (-500.775) -- 0:00:06
924500 -- (-501.908) [-502.720] (-503.837) (-504.140) * (-502.098) [-502.222] (-503.148) (-500.743) -- 0:00:05
925000 -- (-502.661) (-504.143) (-501.277) [-503.729] * (-502.636) (-501.956) (-501.936) [-501.093] -- 0:00:05
Average standard deviation of split frequencies: 0.007942
925500 -- (-504.349) (-504.299) [-503.972] (-504.033) * [-503.758] (-501.133) (-501.504) (-502.027) -- 0:00:05
926000 -- (-502.392) (-509.454) [-500.886] (-502.676) * (-506.223) [-501.771] (-504.269) (-502.744) -- 0:00:05
926500 -- (-501.600) [-501.971] (-502.696) (-500.507) * (-501.972) (-502.912) (-502.414) [-503.821] -- 0:00:05
927000 -- (-503.719) (-503.891) (-502.160) [-501.835] * [-501.053] (-503.732) (-504.496) (-501.964) -- 0:00:05
927500 -- [-501.000] (-503.738) (-502.738) (-501.485) * (-501.557) [-501.990] (-502.324) (-502.958) -- 0:00:05
928000 -- (-500.996) [-502.728] (-504.525) (-501.693) * (-502.218) (-503.606) [-500.666] (-501.437) -- 0:00:05
928500 -- (-502.196) [-501.739] (-501.730) (-502.061) * [-501.801] (-501.740) (-500.809) (-506.158) -- 0:00:05
929000 -- (-502.730) [-501.593] (-501.524) (-501.518) * (-509.055) (-502.582) (-503.229) [-503.790] -- 0:00:05
929500 -- (-504.147) (-505.361) [-501.813] (-501.488) * (-503.657) (-501.835) [-501.903] (-501.263) -- 0:00:05
930000 -- [-502.127] (-503.208) (-501.172) (-501.045) * (-506.131) (-501.347) (-502.767) [-501.542] -- 0:00:05
Average standard deviation of split frequencies: 0.008375
930500 -- (-501.954) (-503.990) [-501.881] (-503.617) * (-503.312) (-502.328) (-502.883) [-502.604] -- 0:00:05
931000 -- (-502.312) (-505.241) [-500.971] (-500.624) * (-504.909) (-500.635) [-502.751] (-501.993) -- 0:00:05
931500 -- (-501.379) (-503.251) (-502.750) [-503.493] * (-502.394) (-501.506) [-500.933] (-501.886) -- 0:00:05
932000 -- (-502.262) (-500.875) (-507.215) [-503.678] * (-500.926) [-502.217] (-502.651) (-501.713) -- 0:00:05
932500 -- (-504.560) [-504.610] (-506.823) (-501.903) * (-502.413) [-503.340] (-503.355) (-500.648) -- 0:00:05
933000 -- (-502.925) [-503.378] (-502.632) (-501.862) * (-504.026) [-501.268] (-503.159) (-501.160) -- 0:00:05
933500 -- [-505.934] (-504.395) (-501.767) (-505.139) * (-504.779) (-502.355) [-502.332] (-504.875) -- 0:00:05
934000 -- [-502.328] (-503.676) (-502.526) (-509.286) * [-505.549] (-503.070) (-502.008) (-503.943) -- 0:00:05
934500 -- (-504.178) [-502.059] (-500.987) (-501.497) * (-504.195) (-503.733) (-504.672) [-508.875] -- 0:00:05
935000 -- (-501.796) (-501.701) (-502.550) [-502.031] * (-503.858) [-504.076] (-504.708) (-502.327) -- 0:00:05
Average standard deviation of split frequencies: 0.008719
935500 -- (-504.556) (-501.241) [-504.061] (-501.265) * [-504.113] (-504.958) (-507.496) (-502.657) -- 0:00:05
936000 -- (-504.745) (-505.185) [-502.128] (-502.439) * (-502.227) (-503.008) (-502.365) [-503.076] -- 0:00:05
936500 -- (-500.826) (-502.536) (-501.135) [-503.911] * (-501.628) [-503.245] (-502.670) (-509.386) -- 0:00:05
937000 -- [-500.583] (-502.219) (-500.973) (-502.407) * (-505.481) [-503.805] (-504.358) (-501.647) -- 0:00:04
937500 -- (-502.853) (-502.148) [-501.980] (-504.247) * [-501.984] (-504.096) (-503.626) (-501.560) -- 0:00:04
938000 -- [-502.002] (-501.420) (-501.508) (-502.805) * (-501.002) [-501.446] (-501.060) (-501.898) -- 0:00:04
938500 -- [-503.611] (-504.640) (-502.375) (-501.643) * (-501.874) (-503.605) (-501.638) [-502.932] -- 0:00:04
939000 -- (-504.864) (-506.238) (-502.890) [-501.670] * (-502.819) (-502.735) (-505.034) [-504.251] -- 0:00:04
939500 -- [-506.356] (-505.026) (-501.685) (-502.945) * (-502.707) (-502.399) (-503.218) [-501.809] -- 0:00:04
940000 -- (-502.477) (-501.992) (-502.132) [-503.055] * (-501.620) [-502.650] (-504.685) (-503.058) -- 0:00:04
Average standard deviation of split frequencies: 0.008419
940500 -- (-501.960) (-502.686) (-502.541) [-501.809] * (-501.888) (-503.069) (-504.784) [-500.740] -- 0:00:04
941000 -- [-501.591] (-502.668) (-503.520) (-503.295) * (-505.156) (-501.506) (-507.290) [-501.437] -- 0:00:04
941500 -- [-502.051] (-502.573) (-504.228) (-502.567) * [-502.373] (-502.033) (-507.834) (-501.290) -- 0:00:04
942000 -- (-503.805) (-504.342) [-501.971] (-505.178) * (-501.498) [-501.919] (-503.879) (-502.106) -- 0:00:04
942500 -- (-501.833) (-504.069) (-504.803) [-502.344] * (-504.428) (-502.423) (-504.138) [-500.557] -- 0:00:04
943000 -- (-502.426) (-502.393) [-501.391] (-501.256) * [-502.209] (-501.350) (-501.840) (-501.234) -- 0:00:04
943500 -- (-504.631) (-501.831) [-501.316] (-502.785) * (-500.656) (-504.291) [-502.297] (-504.691) -- 0:00:04
944000 -- (-503.384) (-503.345) (-501.772) [-502.538] * (-501.356) (-501.569) (-502.754) [-504.433] -- 0:00:04
944500 -- (-502.175) (-502.982) [-502.537] (-502.497) * (-505.157) (-501.782) [-502.480] (-501.119) -- 0:00:04
945000 -- [-504.748] (-511.521) (-505.069) (-502.552) * (-500.881) (-505.065) (-505.390) [-502.449] -- 0:00:04
Average standard deviation of split frequencies: 0.009321
945500 -- (-502.650) (-501.016) [-504.015] (-502.196) * (-502.091) [-500.790] (-503.242) (-504.864) -- 0:00:04
946000 -- (-502.917) (-500.946) (-501.074) [-501.155] * [-501.966] (-504.273) (-502.915) (-502.006) -- 0:00:04
946500 -- (-504.281) [-501.309] (-503.057) (-503.099) * (-504.836) [-501.382] (-502.550) (-501.525) -- 0:00:04
947000 -- (-504.381) (-502.941) [-502.838] (-501.317) * (-501.484) (-503.470) (-500.752) [-502.199] -- 0:00:04
947500 -- [-502.275] (-505.940) (-501.897) (-501.594) * (-503.043) (-506.191) [-501.245] (-501.596) -- 0:00:04
948000 -- (-502.403) (-505.551) (-504.476) [-501.335] * (-501.701) [-502.355] (-506.345) (-502.619) -- 0:00:04
948500 -- (-503.852) (-502.705) [-501.526] (-507.656) * (-502.149) (-504.463) [-503.294] (-501.207) -- 0:00:04
949000 -- (-502.938) (-503.293) (-503.382) [-502.939] * (-503.197) (-503.462) (-502.936) [-505.366] -- 0:00:04
949500 -- (-502.022) (-503.112) [-504.225] (-501.701) * (-501.615) [-501.379] (-501.627) (-502.923) -- 0:00:03
950000 -- (-503.011) (-503.415) [-501.129] (-502.157) * (-502.644) [-500.883] (-506.338) (-503.118) -- 0:00:03
Average standard deviation of split frequencies: 0.009684
950500 -- (-501.912) [-503.186] (-501.366) (-501.919) * (-501.642) (-502.675) (-503.553) [-502.174] -- 0:00:03
951000 -- (-502.153) (-503.616) (-501.106) [-502.602] * (-502.269) [-502.470] (-502.096) (-502.158) -- 0:00:03
951500 -- (-504.811) (-500.952) [-502.219] (-504.323) * (-501.824) (-501.026) [-504.920] (-502.204) -- 0:00:03
952000 -- (-502.910) (-501.166) (-504.158) [-505.355] * (-501.711) (-501.920) (-503.788) [-500.756] -- 0:00:03
952500 -- (-502.238) (-501.058) (-504.231) [-501.268] * (-504.336) (-502.720) [-503.098] (-501.039) -- 0:00:03
953000 -- (-502.151) [-501.743] (-502.082) (-503.690) * [-501.644] (-504.002) (-501.834) (-500.641) -- 0:00:03
953500 -- [-503.203] (-502.519) (-502.284) (-503.343) * (-505.508) (-501.949) (-502.047) [-500.873] -- 0:00:03
954000 -- (-501.872) (-500.716) (-505.144) [-501.448] * (-503.479) [-502.979] (-502.134) (-504.879) -- 0:00:03
954500 -- [-504.891] (-501.217) (-503.483) (-503.001) * (-501.538) [-504.157] (-502.726) (-501.222) -- 0:00:03
955000 -- (-503.454) [-502.251] (-504.307) (-502.512) * (-503.287) (-502.651) (-502.800) [-501.066] -- 0:00:03
Average standard deviation of split frequencies: 0.009514
955500 -- (-501.988) [-502.627] (-502.759) (-501.894) * (-503.066) (-503.559) [-500.889] (-506.531) -- 0:00:03
956000 -- (-502.494) [-504.680] (-502.930) (-510.722) * (-503.359) [-502.623] (-505.571) (-504.444) -- 0:00:03
956500 -- [-502.629] (-501.191) (-502.073) (-503.998) * (-502.658) [-501.769] (-503.357) (-504.303) -- 0:00:03
957000 -- [-502.060] (-500.905) (-502.484) (-504.219) * (-502.690) (-501.910) [-502.836] (-507.509) -- 0:00:03
957500 -- (-502.922) [-504.028] (-503.189) (-502.744) * (-502.194) (-502.689) [-503.327] (-504.156) -- 0:00:03
958000 -- (-502.142) (-502.045) (-502.232) [-501.797] * (-501.646) (-504.716) [-504.739] (-501.878) -- 0:00:03
958500 -- (-501.778) (-505.212) (-501.944) [-502.799] * (-503.861) (-503.616) [-501.817] (-505.098) -- 0:00:03
959000 -- [-502.831] (-507.823) (-502.069) (-501.993) * (-501.777) [-503.014] (-501.223) (-502.210) -- 0:00:03
959500 -- [-502.713] (-503.720) (-501.237) (-503.410) * [-502.282] (-504.714) (-501.266) (-503.350) -- 0:00:03
960000 -- [-502.416] (-502.409) (-503.606) (-502.914) * (-503.171) (-502.520) [-502.404] (-505.302) -- 0:00:03
Average standard deviation of split frequencies: 0.009092
960500 -- (-501.654) [-501.907] (-502.111) (-501.658) * (-507.756) (-504.081) (-505.335) [-503.455] -- 0:00:03
961000 -- (-500.374) (-503.199) (-501.762) [-502.224] * (-502.433) [-500.766] (-502.752) (-503.477) -- 0:00:03
961500 -- [-501.142] (-504.134) (-501.619) (-501.681) * (-501.186) [-501.405] (-503.904) (-506.278) -- 0:00:03
962000 -- [-502.968] (-501.243) (-502.538) (-503.923) * (-502.586) (-502.998) (-507.982) [-503.059] -- 0:00:03
962500 -- (-501.258) [-501.250] (-504.896) (-504.035) * [-503.760] (-502.549) (-503.400) (-502.838) -- 0:00:02
963000 -- (-501.647) [-501.943] (-501.712) (-502.062) * [-502.108] (-501.920) (-503.963) (-503.057) -- 0:00:02
963500 -- (-501.830) [-500.806] (-505.655) (-501.588) * (-501.461) [-500.916] (-504.354) (-502.468) -- 0:00:02
964000 -- (-501.140) (-502.636) (-501.379) [-501.810] * [-506.603] (-501.270) (-501.221) (-501.807) -- 0:00:02
964500 -- (-505.338) (-502.353) (-506.578) [-502.873] * (-503.871) (-503.050) [-501.359] (-503.119) -- 0:00:02
965000 -- (-501.854) (-504.805) (-505.947) [-501.334] * (-503.504) (-501.193) (-507.217) [-502.932] -- 0:00:02
Average standard deviation of split frequencies: 0.009100
965500 -- (-502.057) (-502.113) [-505.088] (-502.503) * (-501.363) (-502.984) (-503.532) [-503.642] -- 0:00:02
966000 -- (-501.546) (-502.105) (-502.098) [-500.330] * (-503.092) (-501.828) (-503.071) [-502.715] -- 0:00:02
966500 -- (-501.294) (-503.292) [-502.215] (-501.621) * [-500.983] (-503.582) (-502.255) (-504.056) -- 0:00:02
967000 -- [-500.909] (-501.478) (-502.011) (-503.518) * (-504.583) [-503.752] (-502.399) (-505.922) -- 0:00:02
967500 -- (-502.859) [-502.895] (-505.954) (-505.337) * (-504.603) (-502.559) [-501.410] (-502.922) -- 0:00:02
968000 -- [-501.560] (-501.903) (-502.709) (-504.129) * [-503.275] (-501.708) (-501.300) (-501.226) -- 0:00:02
968500 -- (-504.247) [-503.309] (-501.587) (-502.257) * (-501.218) [-501.998] (-501.933) (-501.560) -- 0:00:02
969000 -- [-503.322] (-501.938) (-503.717) (-501.976) * (-500.742) [-502.148] (-503.199) (-503.940) -- 0:00:02
969500 -- (-502.843) (-501.562) [-502.169] (-503.833) * [-500.465] (-500.705) (-503.593) (-503.186) -- 0:00:02
970000 -- (-501.022) (-502.879) [-501.230] (-503.760) * (-500.837) (-501.955) (-501.255) [-502.016] -- 0:00:02
Average standard deviation of split frequencies: 0.009284
970500 -- (-502.237) [-500.698] (-506.642) (-503.532) * (-504.754) [-502.741] (-502.402) (-502.451) -- 0:00:02
971000 -- (-503.478) [-501.655] (-503.070) (-503.196) * [-504.896] (-503.154) (-503.316) (-500.476) -- 0:00:02
971500 -- (-501.467) [-502.262] (-504.326) (-503.621) * (-504.543) (-502.682) (-503.860) [-503.559] -- 0:00:02
972000 -- (-502.176) (-505.805) [-503.559] (-502.559) * (-502.407) [-503.104] (-507.318) (-502.214) -- 0:00:02
972500 -- (-502.126) (-501.627) (-504.049) [-502.507] * (-502.450) (-509.302) [-502.335] (-503.362) -- 0:00:02
973000 -- (-501.660) [-502.145] (-506.110) (-508.962) * (-501.927) (-502.426) (-503.037) [-500.423] -- 0:00:02
973500 -- (-503.465) (-502.570) (-502.609) [-505.080] * (-502.210) (-501.327) [-501.101] (-501.411) -- 0:00:02
974000 -- (-502.892) [-503.339] (-504.831) (-503.949) * (-503.160) (-501.430) [-500.737] (-502.385) -- 0:00:02
974500 -- [-502.690] (-505.251) (-506.003) (-505.601) * (-502.475) (-500.801) (-501.470) [-503.881] -- 0:00:02
975000 -- [-501.596] (-500.936) (-503.189) (-501.962) * (-502.186) (-503.419) (-500.845) [-502.183] -- 0:00:01
Average standard deviation of split frequencies: 0.009205
975500 -- (-505.730) (-502.037) [-504.549] (-501.185) * [-502.411] (-501.052) (-502.295) (-504.213) -- 0:00:01
976000 -- [-503.437] (-501.544) (-504.315) (-503.102) * (-507.622) (-503.360) [-505.257] (-502.357) -- 0:00:01
976500 -- [-502.353] (-501.374) (-504.711) (-502.395) * (-502.430) (-504.421) [-501.063] (-503.616) -- 0:00:01
977000 -- (-502.792) (-502.112) (-506.849) [-501.858] * (-503.392) (-500.853) [-501.208] (-504.085) -- 0:00:01
977500 -- (-504.232) (-501.079) (-507.063) [-501.846] * (-502.538) (-501.824) [-501.324] (-504.488) -- 0:00:01
978000 -- (-502.529) (-501.302) (-501.097) [-503.124] * (-501.940) (-503.035) (-500.825) [-505.111] -- 0:00:01
978500 -- [-501.638] (-501.621) (-501.350) (-501.233) * [-503.605] (-502.323) (-502.349) (-501.918) -- 0:00:01
979000 -- [-502.716] (-505.674) (-502.451) (-504.602) * [-509.233] (-503.365) (-504.375) (-501.463) -- 0:00:01
979500 -- (-504.511) (-502.648) (-502.017) [-502.153] * (-504.142) [-502.777] (-506.474) (-503.704) -- 0:00:01
980000 -- (-503.305) [-503.294] (-501.440) (-504.042) * (-506.799) [-501.002] (-505.832) (-502.977) -- 0:00:01
Average standard deviation of split frequencies: 0.009416
980500 -- (-503.652) [-501.611] (-501.392) (-506.279) * (-507.052) (-502.838) [-503.243] (-502.147) -- 0:00:01
981000 -- [-501.951] (-504.568) (-501.307) (-501.405) * [-503.317] (-500.901) (-503.290) (-505.689) -- 0:00:01
981500 -- [-502.316] (-502.034) (-503.826) (-507.191) * (-502.770) (-501.299) (-503.188) [-503.237] -- 0:00:01
982000 -- (-503.255) [-503.299] (-502.073) (-503.893) * (-502.290) (-502.002) [-501.558] (-502.021) -- 0:00:01
982500 -- (-507.319) [-502.250] (-508.433) (-504.154) * (-505.323) [-502.103] (-502.964) (-501.942) -- 0:00:01
983000 -- [-502.539] (-502.613) (-513.935) (-504.076) * (-501.971) (-502.966) (-505.122) [-504.061] -- 0:00:01
983500 -- (-504.255) (-501.747) [-503.056] (-500.552) * (-504.275) (-506.363) (-504.094) [-502.594] -- 0:00:01
984000 -- (-504.487) [-503.929] (-504.151) (-501.243) * (-503.795) (-501.086) [-503.088] (-502.277) -- 0:00:01
984500 -- [-502.233] (-508.593) (-501.941) (-501.599) * (-501.639) (-507.220) (-502.316) [-501.241] -- 0:00:01
985000 -- (-501.955) (-502.778) (-503.654) [-502.647] * [-505.445] (-501.733) (-503.098) (-502.327) -- 0:00:01
Average standard deviation of split frequencies: 0.009309
985500 -- (-506.696) (-502.315) (-505.495) [-502.833] * (-501.073) [-502.504] (-501.125) (-501.258) -- 0:00:01
986000 -- (-501.224) (-507.490) [-501.634] (-502.915) * [-501.948] (-502.102) (-502.313) (-501.814) -- 0:00:01
986500 -- (-503.712) [-502.452] (-503.637) (-505.715) * (-501.776) (-500.576) [-501.794] (-505.824) -- 0:00:01
987000 -- (-504.100) [-503.492] (-503.292) (-502.314) * (-501.949) [-500.496] (-500.849) (-502.234) -- 0:00:01
987500 -- [-504.457] (-502.048) (-500.670) (-501.180) * (-502.607) (-500.757) (-501.147) [-506.637] -- 0:00:00
988000 -- (-504.108) [-503.214] (-500.794) (-500.554) * (-502.898) (-502.372) (-502.061) [-502.470] -- 0:00:00
988500 -- (-507.605) [-503.358] (-505.687) (-502.690) * (-502.870) (-502.724) [-501.623] (-501.755) -- 0:00:00
989000 -- [-503.062] (-503.286) (-502.001) (-503.024) * (-504.591) [-503.647] (-500.905) (-503.144) -- 0:00:00
989500 -- (-504.818) (-503.905) [-501.987] (-501.630) * (-503.423) (-501.740) (-502.961) [-502.908] -- 0:00:00
990000 -- (-506.899) (-502.328) (-503.766) [-502.417] * (-501.798) [-503.894] (-503.340) (-503.423) -- 0:00:00
Average standard deviation of split frequencies: 0.008922
990500 -- (-504.958) [-505.367] (-502.381) (-509.393) * (-508.067) (-503.140) (-501.521) [-503.320] -- 0:00:00
991000 -- (-508.963) (-503.975) [-502.153] (-508.077) * (-502.847) (-503.869) (-503.610) [-501.416] -- 0:00:00
991500 -- (-501.545) (-504.238) (-503.155) [-501.240] * [-502.637] (-501.521) (-506.090) (-501.975) -- 0:00:00
992000 -- (-500.757) [-502.143] (-502.554) (-502.242) * (-509.467) (-503.698) [-502.089] (-502.767) -- 0:00:00
992500 -- [-501.758] (-501.929) (-504.435) (-501.643) * (-503.014) (-501.598) [-501.705] (-502.292) -- 0:00:00
993000 -- (-503.117) (-500.561) [-504.200] (-504.255) * (-503.068) [-503.925] (-503.767) (-502.359) -- 0:00:00
993500 -- (-504.743) (-501.559) (-501.518) [-502.650] * (-502.228) [-503.904] (-501.937) (-502.827) -- 0:00:00
994000 -- (-502.734) [-502.535] (-505.839) (-501.891) * (-504.497) [-501.798] (-502.958) (-502.266) -- 0:00:00
994500 -- [-502.299] (-502.833) (-503.563) (-501.889) * (-501.770) [-501.798] (-501.007) (-501.934) -- 0:00:00
995000 -- (-501.921) (-507.579) (-502.604) [-502.946] * (-501.830) (-501.713) [-503.885] (-501.869) -- 0:00:00
Average standard deviation of split frequencies: 0.008667
995500 -- (-501.237) (-501.806) [-503.166] (-507.521) * [-505.588] (-501.820) (-503.505) (-503.715) -- 0:00:00
996000 -- [-503.739] (-501.506) (-502.393) (-502.901) * [-501.468] (-502.593) (-501.443) (-508.065) -- 0:00:00
996500 -- (-508.077) [-502.014] (-502.433) (-508.099) * [-501.983] (-505.280) (-502.614) (-503.506) -- 0:00:00
997000 -- (-503.668) (-501.845) [-501.450] (-503.695) * (-504.514) (-504.496) (-504.607) [-503.594] -- 0:00:00
997500 -- (-504.605) (-506.483) [-500.578] (-502.351) * (-503.913) (-507.750) (-502.405) [-501.750] -- 0:00:00
998000 -- (-504.004) [-503.437] (-502.116) (-506.798) * [-502.482] (-506.207) (-502.366) (-502.065) -- 0:00:00
998500 -- (-505.444) [-501.436] (-501.154) (-506.551) * [-502.636] (-502.039) (-502.875) (-500.640) -- 0:00:00
999000 -- (-500.544) (-505.850) [-500.600] (-502.370) * [-500.594] (-501.988) (-501.948) (-505.907) -- 0:00:00
999500 -- (-501.104) (-503.434) [-502.405] (-504.099) * [-502.150] (-500.932) (-501.617) (-507.692) -- 0:00:00
1000000 -- (-502.893) (-510.737) [-503.096] (-503.626) * (-504.029) (-503.412) [-505.225] (-503.771) -- 0:00:00
Average standard deviation of split frequencies: 0.008862
Analysis completed in 1 mins 19 seconds
Analysis used 78.16 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -500.25
Likelihood of best state for "cold" chain of run 2 was -500.25
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 79 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.7 % ( 34 %) Dirichlet(Pi{all})
36.4 % ( 27 %) Slider(Pi{all})
78.7 % ( 43 %) Multiplier(Alpha{1,2})
77.7 % ( 55 %) Multiplier(Alpha{3})
25.2 % ( 28 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 60 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.3 % ( 96 %) Nodeslider(V{all})
30.7 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.9 % ( 27 %) Dirichlet(Pi{all})
35.3 % ( 27 %) Slider(Pi{all})
78.4 % ( 49 %) Multiplier(Alpha{1,2})
77.2 % ( 53 %) Multiplier(Alpha{3})
24.9 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 95 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167038 0.82 0.67
3 | 166140 166507 0.84
4 | 167225 166270 166820
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166849 0.82 0.67
3 | 166515 166581 0.84
4 | 167073 166365 166617
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -502.11
| 1 2 2 1 |
| 2 12 2 2 2 2 1 |
| 12 * 2 2 22 21 2 |
| 1 22 1 1 1 2 2 1 12 1 |
| 1 * 2 22 1 12 1 1 1 2 |
| 2 1 22 1 1 1 1 11|
|1 2 2 1 * 1 111 1 |
| *2 2 1 12 1 1 1 12 2 22 |
| 1 1 1 2 1 1 21 1 2 2 22|
| 2 21 |
|2 1 1 2 2 2 1 |
| 22 2 1 |
| 1 1 |
| 1 2 |
| 1 2 2 * |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -503.49
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -502.00 -505.03
2 -501.91 -505.71
--------------------------------------
TOTAL -501.96 -505.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893050 0.089124 0.350626 1.475254 0.856800 1501.00 1501.00 1.001
r(A<->C){all} 0.176069 0.022756 0.000175 0.485162 0.133619 167.59 214.70 1.002
r(A<->G){all} 0.159537 0.019200 0.000150 0.442904 0.119356 183.22 218.52 1.000
r(A<->T){all} 0.162394 0.019755 0.000239 0.445840 0.124047 176.74 213.20 1.000
r(C<->G){all} 0.164313 0.019169 0.000049 0.440118 0.127171 180.12 234.41 1.003
r(C<->T){all} 0.177145 0.020497 0.000021 0.468158 0.141718 190.41 287.34 1.004
r(G<->T){all} 0.160542 0.017399 0.000068 0.424030 0.128895 196.09 214.44 1.002
pi(A){all} 0.223900 0.000458 0.183823 0.265957 0.223112 1270.87 1385.93 1.000
pi(C){all} 0.289586 0.000533 0.247082 0.336924 0.289138 837.90 998.80 1.000
pi(G){all} 0.303019 0.000562 0.255875 0.349882 0.303087 1010.53 1255.77 1.001
pi(T){all} 0.183495 0.000396 0.147292 0.224578 0.183333 1053.31 1190.82 1.000
alpha{1,2} 0.432761 0.240901 0.000103 1.464271 0.253398 1312.84 1331.48 1.000
alpha{3} 0.449303 0.228757 0.000109 1.455813 0.284373 1164.78 1288.67 1.000
pinvar{all} 0.995724 0.000026 0.986306 0.999997 0.997331 1238.98 1303.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ...**.
9 -- ....**
10 -- .*...*
11 -- .****.
12 -- .*.*..
13 -- .*.***
14 -- .**...
15 -- ..*.*.
16 -- ..*..*
17 -- .***.*
18 -- ...*.*
19 -- .**.**
20 -- ..****
21 -- .*..*.
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 468 0.155896 0.002827 0.153897 0.157895 2
8 450 0.149900 0.010364 0.142572 0.157229 2
9 445 0.148235 0.017430 0.135909 0.160560 2
10 440 0.146569 0.006595 0.141905 0.151233 2
11 440 0.146569 0.006595 0.141905 0.151233 2
12 439 0.146236 0.007066 0.141239 0.151233 2
13 438 0.145903 0.003769 0.143238 0.148568 2
14 438 0.145903 0.009422 0.139241 0.152565 2
15 420 0.139907 0.000000 0.139907 0.139907 2
16 419 0.139574 0.008951 0.133245 0.145903 2
17 418 0.139241 0.001884 0.137908 0.140573 2
18 418 0.139241 0.016017 0.127915 0.150566 2
19 417 0.138907 0.011777 0.130580 0.147235 2
20 412 0.137242 0.011306 0.129247 0.145237 2
21 411 0.136909 0.005182 0.133245 0.140573 2
22 258 0.085943 0.022612 0.069953 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100494 0.010282 0.000028 0.292760 0.068858 1.000 2
length{all}[2] 0.099554 0.009773 0.000006 0.298124 0.070147 1.001 2
length{all}[3] 0.097630 0.009495 0.000289 0.294342 0.068497 1.000 2
length{all}[4] 0.096314 0.009314 0.000037 0.287444 0.065803 1.000 2
length{all}[5] 0.099459 0.009281 0.000078 0.289674 0.071473 1.001 2
length{all}[6] 0.096560 0.009229 0.000029 0.289450 0.067934 1.000 2
length{all}[7] 0.102454 0.011413 0.000069 0.302443 0.071035 0.999 2
length{all}[8] 0.108377 0.011611 0.000122 0.315470 0.073636 1.009 2
length{all}[9] 0.102174 0.011434 0.000223 0.326505 0.070410 1.000 2
length{all}[10] 0.095833 0.010161 0.000103 0.293468 0.061987 1.000 2
length{all}[11] 0.101229 0.010916 0.000416 0.315048 0.068264 1.000 2
length{all}[12] 0.100069 0.011070 0.000053 0.305578 0.064964 0.999 2
length{all}[13] 0.090187 0.007480 0.000034 0.252277 0.063278 0.998 2
length{all}[14] 0.101419 0.011936 0.000076 0.290621 0.065563 0.998 2
length{all}[15] 0.097233 0.008893 0.000089 0.277292 0.067295 1.002 2
length{all}[16] 0.102786 0.009972 0.000171 0.298891 0.073027 0.999 2
length{all}[17] 0.109079 0.012334 0.000129 0.340008 0.073479 1.004 2
length{all}[18] 0.102589 0.009343 0.000556 0.280140 0.074086 0.998 2
length{all}[19] 0.105367 0.011455 0.000616 0.332469 0.075556 0.999 2
length{all}[20] 0.094907 0.007862 0.000104 0.289295 0.065453 0.999 2
length{all}[21] 0.100869 0.009144 0.000084 0.290683 0.068713 0.998 2
length{all}[22] 0.112000 0.013569 0.000786 0.331581 0.076364 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008862
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 393
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
27 ambiguity characters in seq. 1
54 ambiguity characters in seq. 2
27 ambiguity characters in seq. 3
27 ambiguity characters in seq. 4
27 ambiguity characters in seq. 5
27 ambiguity characters in seq. 6
18 sites are removed. 1 2 3 4 5 6 7 8 9 123 124 125 126 127 128 129 130 131
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 113 / 113 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 113 / 113 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028087 0.064015 0.094124 0.104311 0.054087 0.078450 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -480.028650
Iterating by ming2
Initial: fx= 480.028650
x= 0.02809 0.06402 0.09412 0.10431 0.05409 0.07845 0.30000 1.30000
1 h-m-p 0.0000 0.0003 270.1178 +++ 461.562368 m 0.0003 14 | 1/8
2 h-m-p 0.0021 0.0106 29.7627 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 247.6278 +++ 447.115886 m 0.0002 47 | 2/8
4 h-m-p 0.0025 0.0167 20.4048 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 222.4355 ++ 442.662905 m 0.0001 79 | 3/8
6 h-m-p 0.0012 0.0263 14.4580 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 192.7527 ++ 437.783336 m 0.0001 110 | 4/8
8 h-m-p 0.0020 0.0396 10.5266 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 157.6383 ++ 434.226532 m 0.0001 142 | 5/8
10 h-m-p 0.0024 0.0752 6.6140 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 111.7239 ++ 433.063527 m 0.0001 174 | 6/8
12 h-m-p 0.4710 8.0000 0.0000 +++ 433.063527 m 8.0000 186 | 6/8
13 h-m-p 0.3459 8.0000 0.0000 --N 433.063527 0 0.0054 201 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -C 433.063527 0 0.0010 215 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 Y 433.063527 0 0.0040 228 | 6/8
16 h-m-p 0.0160 8.0000 0.0002 +++++ 433.063527 m 8.0000 244 | 6/8
17 h-m-p 0.0043 1.0767 0.3940 ------------.. | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063527 m 8.0000 283 | 6/8
19 h-m-p 0.0160 8.0000 0.1456 --------N 433.063527 0 0.0000 304 | 6/8
20 h-m-p 0.0160 8.0000 0.0004 +++++ 433.063527 m 8.0000 320 | 6/8
21 h-m-p 0.0160 8.0000 0.7161 ----------N 433.063527 0 0.0000 343 | 6/8
22 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063527 m 8.0000 359 | 6/8
23 h-m-p 0.0018 0.9001 0.3996 +++++ 433.063523 m 0.9001 375 | 7/8
24 h-m-p 0.3791 8.0000 0.5263 ---------------.. | 7/8
25 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063523 m 8.0000 416 | 7/8
26 h-m-p 0.0160 8.0000 0.7782 -------------.. | 7/8
27 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063522 m 8.0000 454 | 7/8
28 h-m-p 0.0009 0.4431 2.4731 +++++ 433.063437 m 0.4431 469 | 8/8
29 h-m-p 0.0160 8.0000 0.0000 N 433.063437 0 0.0160 480 | 8/8
30 h-m-p 0.0160 8.0000 0.0000 N 433.063437 0 0.0160 491
Out..
lnL = -433.063437
492 lfun, 492 eigenQcodon, 2952 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082592 0.032354 0.093950 0.080498 0.025498 0.075259 0.000100 0.817993 0.462044
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.285111
np = 9
lnL0 = -475.343100
Iterating by ming2
Initial: fx= 475.343100
x= 0.08259 0.03235 0.09395 0.08050 0.02550 0.07526 0.00011 0.81799 0.46204
1 h-m-p 0.0000 0.0000 259.6397 ++ 474.959908 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 249.1689 +++ 458.715742 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 116.9163 ++ 455.613433 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0010 212.6877 ++ 435.873538 m 0.0010 51 | 4/9
5 h-m-p 0.0000 0.0000 1850.3527 ++ 434.424390 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 349.5374 ++ 433.974966 m 0.0001 75 | 6/9
7 h-m-p 0.0000 0.0000 1009.6443 ++ 433.063485 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 433.063485 m 8.0000 99 | 7/9
9 h-m-p 0.0097 4.8515 0.2153 ----------C 433.063485 0 0.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 --------C 433.063485 0 0.0000 145 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063485 m 8.0000 162 | 7/9
12 h-m-p 0.0071 3.5628 0.2568 ---------Y 433.063485 0 0.0000 185 | 7/9
13 h-m-p 0.0160 8.0000 0.0004 +++++ 433.063485 m 8.0000 202 | 7/9
14 h-m-p 0.0123 3.4966 0.2626 -------------.. | 7/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 433.063485 m 8.0000 244 | 7/9
16 h-m-p 0.0160 8.0000 0.1398 ------------C 433.063485 0 0.0000 270 | 7/9
17 h-m-p 0.0160 8.0000 0.0003 +++++ 433.063484 m 8.0000 287 | 7/9
18 h-m-p 0.0104 4.3044 0.2073 ------------Y 433.063484 0 0.0000 313 | 7/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063484 m 8.0000 330 | 7/9
20 h-m-p 0.0120 6.0242 0.1630 -------------.. | 7/9
21 h-m-p 0.0160 8.0000 0.0002 +++++ 433.063484 m 8.0000 372 | 7/9
22 h-m-p 0.0160 8.0000 0.1385 ----------C 433.063484 0 0.0000 396 | 7/9
23 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063484 m 8.0000 413 | 7/9
24 h-m-p 0.0133 6.6733 0.1482 -------------.. | 7/9
25 h-m-p 0.0160 8.0000 0.0002 +++++ 433.063484 m 8.0000 455 | 7/9
26 h-m-p 0.0160 8.0000 0.1374 ---------Y 433.063484 0 0.0000 478 | 7/9
27 h-m-p 0.0160 8.0000 0.0003 +++++ 433.063483 m 8.0000 495 | 7/9
28 h-m-p 0.0112 3.8825 0.2374 -------------.. | 7/9
29 h-m-p 0.0160 8.0000 0.0002 +++++ 433.063483 m 8.0000 537 | 7/9
30 h-m-p 0.0160 8.0000 0.1356 ----------Y 433.063483 0 0.0000 561 | 7/9
31 h-m-p 0.0160 8.0000 0.0001 +++++ 433.063483 m 8.0000 578 | 7/9
32 h-m-p 0.0018 0.5741 0.5691 ------------.. | 7/9
33 h-m-p 0.0160 8.0000 0.0002 +++++ 433.063483 m 8.0000 619 | 7/9
34 h-m-p 0.0160 8.0000 0.1348 ---------C 433.063483 0 0.0000 642 | 7/9
35 h-m-p 0.0160 8.0000 0.0003 ------Y 433.063483 0 0.0000 662 | 7/9
36 h-m-p 0.0160 8.0000 0.0001 +++++ 433.063483 m 8.0000 679 | 7/9
37 h-m-p 0.0076 3.7948 0.2443 ---------C 433.063483 0 0.0000 702 | 7/9
38 h-m-p 0.0160 8.0000 0.0002 -----------C 433.063483 0 0.0000 727 | 7/9
39 h-m-p 0.0000 0.0106 7.2051 +++++ 433.063473 m 0.0106 744 | 8/9
40 h-m-p 0.3320 3.6537 0.0313 ++ 433.063437 m 3.6537 756 | 9/9
41 h-m-p 0.0160 8.0000 0.0000 Y 433.063437 0 0.0160 769
Out..
lnL = -433.063437
770 lfun, 2310 eigenQcodon, 9240 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.012760 0.043439 0.079487 0.039706 0.094723 0.028748 0.000100 0.818334 0.266600 0.406118 2.406610
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.741915
np = 11
lnL0 = -463.923699
Iterating by ming2
Initial: fx= 463.923699
x= 0.01276 0.04344 0.07949 0.03971 0.09472 0.02875 0.00011 0.81833 0.26660 0.40612 2.40661
1 h-m-p 0.0000 0.0000 236.0115 ++ 463.470048 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0026 65.5152 ++++ 453.808448 m 0.0026 32 | 2/11
3 h-m-p 0.0001 0.0005 104.4737 ++ 446.500101 m 0.0005 46 | 3/11
4 h-m-p 0.0011 0.0057 35.7465 ++ 440.321576 m 0.0057 60 | 4/11
5 h-m-p 0.0000 0.0000 8958.7597 ++ 439.135147 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 2763.1028 ++ 439.089832 m 0.0000 88 | 6/11
7 h-m-p 0.0002 0.0231 7.4168 ----------.. | 6/11
8 h-m-p 0.0000 0.0002 145.5919 +++ 434.157192 m 0.0002 125 | 7/11
9 h-m-p 0.0160 8.0000 2.8516 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 109.6560 ++ 433.063517 m 0.0001 164 | 8/11
11 h-m-p 0.1510 8.0000 0.0000 +++ 433.063517 m 8.0000 179 | 8/11
12 h-m-p 0.0160 8.0000 0.0101 +++++ 433.063516 m 8.0000 199 | 8/11
13 h-m-p 0.0160 8.0000 5.8063 ------------C 433.063516 0 0.0000 228 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063516 m 8.0000 245 | 8/11
15 h-m-p 0.0160 8.0000 0.0138 +++++ 433.063516 m 8.0000 265 | 8/11
16 h-m-p 0.0709 8.0000 1.5564 --------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 433.063516 m 8.0000 311 | 8/11
18 h-m-p 0.0160 8.0000 0.0141 ---------C 433.063516 0 0.0000 337 | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 433.063516 m 8.0000 357 | 8/11
20 h-m-p 0.0160 8.0000 1.1643 ----------Y 433.063516 0 0.0000 384 | 8/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 433.063516 m 8.0000 401 | 8/11
22 h-m-p 0.0160 8.0000 1.4720 ----------Y 433.063516 0 0.0000 428 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 --C 433.063516 0 0.0003 444 | 8/11
24 h-m-p 0.0160 8.0000 0.0000 ------------N 433.063516 0 0.0000 473
Out..
lnL = -433.063516
474 lfun, 1896 eigenQcodon, 8532 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -433.068559 S = -433.061567 -0.002673
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:05
did 20 / 39 patterns 0:05
did 30 / 39 patterns 0:05
did 39 / 39 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025683 0.010276 0.056307 0.082865 0.041731 0.067148 0.000100 0.732496 1.938721
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.588120
np = 9
lnL0 = -462.958762
Iterating by ming2
Initial: fx= 462.958762
x= 0.02568 0.01028 0.05631 0.08287 0.04173 0.06715 0.00011 0.73250 1.93872
1 h-m-p 0.0000 0.0000 246.9145 ++ 462.664445 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0319 22.8213 +++++ 456.691525 m 0.0319 29 | 2/9
3 h-m-p 0.0000 0.0000 6013.8491 ++ 440.709846 m 0.0000 41 | 3/9
4 h-m-p 0.0008 0.0038 25.8574 ++ 437.900674 m 0.0038 53 | 4/9
5 h-m-p 0.0001 0.0003 77.9588 ++ 435.219229 m 0.0003 65 | 5/9
6 h-m-p 0.0000 0.0001 116.2336 ++ 434.845666 m 0.0001 77 | 6/9
7 h-m-p 0.0001 0.0004 124.1104 ++ 434.603901 m 0.0004 89 | 7/9
8 h-m-p 0.0035 0.1296 12.9362 ------------.. | 7/9
9 h-m-p 0.0000 0.0001 105.9940 ++ 433.063437 m 0.0001 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 433.063437 0 1.6000 135 | 8/9
11 h-m-p 0.0160 8.0000 0.0000 C 433.063437 0 0.0160 148
Out..
lnL = -433.063437
149 lfun, 1639 eigenQcodon, 8940 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.060745 0.106728 0.034372 0.037285 0.079962 0.035656 0.000100 0.900000 0.273768 1.081084 2.359144
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.096794
np = 11
lnL0 = -464.730818
Iterating by ming2
Initial: fx= 464.730818
x= 0.06074 0.10673 0.03437 0.03729 0.07996 0.03566 0.00011 0.90000 0.27377 1.08108 2.35914
1 h-m-p 0.0000 0.0000 184.2771 ++ 464.635023 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 206.1930 ++++ 447.530450 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0000 1380.0133 ++ 446.950146 m 0.0000 46 | 3/11
4 h-m-p 0.0002 0.0010 33.5459 ++ 446.055851 m 0.0010 60 | 4/11
5 h-m-p 0.0000 0.0002 801.9889 ++ 441.762343 m 0.0002 74 | 5/11
6 h-m-p 0.0001 0.0007 78.3362 ++ 438.826579 m 0.0007 88 | 6/11
7 h-m-p 0.0014 0.0072 21.1009 ++ 435.644930 m 0.0072 102 | 7/11
8 h-m-p 0.0002 0.0009 82.8507 ++ 434.606247 m 0.0009 116 | 7/11
9 h-m-p 0.0237 0.4220 3.1136 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 105.9940 ++ 433.063437 m 0.0001 155 | 8/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 433.063437 m 8.0000 169 | 8/11
12 h-m-p 0.0160 8.0000 0.0092 ----------Y 433.063437 0 0.0000 196 | 8/11
13 h-m-p 0.0002 0.0878 0.0028 +++++ 433.063437 m 0.0878 216 | 9/11
14 h-m-p 1.6000 8.0000 0.0000 ++ 433.063437 m 8.0000 233 | 9/11
15 h-m-p 0.0347 8.0000 0.0032 ++++ 433.063437 m 8.0000 251 | 9/11
16 h-m-p 0.0700 8.0000 0.3705 -----Y 433.063437 0 0.0000 272 | 9/11
17 h-m-p 0.0696 8.0000 0.0001 --Y 433.063437 0 0.0011 290 | 9/11
18 h-m-p 0.0334 8.0000 0.0000 ------N 433.063437 0 0.0000 312
Out..
lnL = -433.063437
313 lfun, 3756 eigenQcodon, 20658 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -433.104306 S = -433.064072 -0.017789
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:13
did 20 / 39 patterns 0:13
did 30 / 39 patterns 0:13
did 39 / 39 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=131
NC_011896_1_WP_041323021_1_1975_MLBR_RS09375 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NC_002677_1_NP_302255_1_1127_rplN ---------VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG
*****************************************
NC_011896_1_WP_041323021_1_1975_MLBR_RS09375 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
NC_002677_1_NP_302255_1_1127_rplN NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445 NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
**************************************************
NC_011896_1_WP_041323021_1_1975_MLBR_RS09375 PVGRELREKRFMKIISLAPEVL---------
NC_002677_1_NP_302255_1_1127_rplN PVGRELREKRFMKIISLAPEVLooooooooo
NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310 PVGRELREKRFMKIISLAPEVL---------
NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470 PVGRELREKRFMKIISLAPEVL---------
NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180 PVGRELREKRFMKIISLAPEVL---------
NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445 PVGRELREKRFMKIISLAPEVL---------
**********************
>NC_011896_1_WP_041323021_1_1975_MLBR_RS09375 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT GGCTCCGGAGGTGCTG--------------------------- >NC_002677_1_NP_302255_1_1127_rplN ---------------------------GTGGCCGACAACACCGGCGCCAA GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT GGCTCCGGAGGTGCTG--------------------------- >NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT GGCTCCGGAGGTGCTG--------------------------- >NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT GGCTCCGGAGGTGCTG--------------------------- >NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT GGCTCCGGAGGTGCTG--------------------------- >NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445 GTGATTCAGCAGGAATCGCGACTGAAGGTGGCCGACAACACCGGCGCCAA GGAGATCTTGTGCATACGAGTGCTCGGCGGCTCGTCCCGACGCTACGCCA GCATTGGTGATGTCATCGTCGGCACCGTCAAGGACGCTATTCCTGGCGGC AACGTCAAACGCGGAGATGTCGTCAAAGCCGTCGTGGTACGCACCGCCAA AGAGTGCAGGCGTCCCGACGGCAGCTACATCAAGTTCGATGAAAACGCTG CTGTGATCATCAAGCCTGACAACGATCCGCGCGGAACTCGCATCTTCGGG CCGGTCGGCCGCGAACTTCGTGAGAAACGATTCATGAAGATCATCTCGCT GGCTCCGGAGGTGCTG---------------------------
>NC_011896_1_WP_041323021_1_1975_MLBR_RS09375 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG PVGRELREKRFMKIISLAPEVL >NC_002677_1_NP_302255_1_1127_rplN ---------VADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG PVGRELREKRFMKIISLAPEVL >NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG PVGRELREKRFMKIISLAPEVL >NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG PVGRELREKRFMKIISLAPEVL >NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG PVGRELREKRFMKIISLAPEVL >NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445 VIQQESRLKVADNTGAKEILCIRVLGGSSRRYASIGDVIVGTVKDAIPGG NVKRGDVVKAVVVRTAKECRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG PVGRELREKRFMKIISLAPEVL
#NEXUS
[ID: 0781097559]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_041323021_1_1975_MLBR_RS09375
NC_002677_1_NP_302255_1_1127_rplN
NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310
NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470
NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180
NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445
;
end;
begin trees;
translate
1 NC_011896_1_WP_041323021_1_1975_MLBR_RS09375,
2 NC_002677_1_NP_302255_1_1127_rplN,
3 NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310,
4 NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470,
5 NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180,
6 NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06885809,2:0.07014711,3:0.06849727,4:0.06580336,5:0.07147299,6:0.06793411);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06885809,2:0.07014711,3:0.06849727,4:0.06580336,5:0.07147299,6:0.06793411);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -502.00 -505.03
2 -501.91 -505.71
--------------------------------------
TOTAL -501.96 -505.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplN/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893050 0.089124 0.350626 1.475254 0.856800 1501.00 1501.00 1.001
r(A<->C){all} 0.176069 0.022756 0.000175 0.485162 0.133619 167.59 214.70 1.002
r(A<->G){all} 0.159537 0.019200 0.000150 0.442904 0.119356 183.22 218.52 1.000
r(A<->T){all} 0.162394 0.019755 0.000239 0.445840 0.124047 176.74 213.20 1.000
r(C<->G){all} 0.164313 0.019169 0.000049 0.440118 0.127171 180.12 234.41 1.003
r(C<->T){all} 0.177145 0.020497 0.000021 0.468158 0.141718 190.41 287.34 1.004
r(G<->T){all} 0.160542 0.017399 0.000068 0.424030 0.128895 196.09 214.44 1.002
pi(A){all} 0.223900 0.000458 0.183823 0.265957 0.223112 1270.87 1385.93 1.000
pi(C){all} 0.289586 0.000533 0.247082 0.336924 0.289138 837.90 998.80 1.000
pi(G){all} 0.303019 0.000562 0.255875 0.349882 0.303087 1010.53 1255.77 1.001
pi(T){all} 0.183495 0.000396 0.147292 0.224578 0.183333 1053.31 1190.82 1.000
alpha{1,2} 0.432761 0.240901 0.000103 1.464271 0.253398 1312.84 1331.48 1.000
alpha{3} 0.449303 0.228757 0.000109 1.455813 0.284373 1164.78 1288.67 1.000
pinvar{all} 0.995724 0.000026 0.986306 0.999997 0.997331 1238.98 1303.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplN/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 113
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 6 6 6 6 6 6
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 3 3 3 3 3 3
CTG 2 2 2 2 2 2 | CCG 3 3 3 3 3 3 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 3 3 3 3 3 3 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 4 4 4 4 4 4 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 8 8 8 8 8 8 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 8 8 8 8 8 8
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 0 0 0 0 0 0 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_041323021_1_1975_MLBR_RS09375
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
#2: NC_002677_1_NP_302255_1_1127_rplN
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
#3: NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
#4: NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
#5: NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
#6: NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 12 | TGC 12
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 12
CTC 6 | CCC 6 | CAC 0 | CGC 36
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 18
CTG 12 | CCG 18 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 48 | ACC 18 | AAC 24 | AGC 12
ATA 6 | ACA 0 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 24 | Asp D GAT 24 | Gly G GGT 6
GTC 48 | GCC 30 | GAC 24 | GGC 48
GTA 6 | GCA 0 | Glu E GAA 12 | GGA 12
GTG 30 | GCG 0 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09735 C:0.18584 A:0.28319 G:0.43363
position 2: T:0.30088 C:0.19469 A:0.25664 G:0.24779
position 3: T:0.15044 C:0.51327 A:0.11504 G:0.22124
Average T:0.18289 C:0.29794 A:0.21829 G:0.30088
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -433.063437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323021_1_1975_MLBR_RS09375: 0.000004, NC_002677_1_NP_302255_1_1127_rplN: 0.000004, NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310: 0.000004, NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470: 0.000004, NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180: 0.000004, NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 279.6 59.4 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 279.6 59.4 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 279.6 59.4 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 279.6 59.4 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 279.6 59.4 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 279.6 59.4 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -433.063437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323021_1_1975_MLBR_RS09375: 0.000004, NC_002677_1_NP_302255_1_1127_rplN: 0.000004, NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310: 0.000004, NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470: 0.000004, NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180: 0.000004, NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -433.063516 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.543372 0.244488 0.000001 2.297307
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323021_1_1975_MLBR_RS09375: 0.000004, NC_002677_1_NP_302255_1_1127_rplN: 0.000004, NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310: 0.000004, NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470: 0.000004, NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180: 0.000004, NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.54337 0.24449 0.21214
w: 0.00000 1.00000 2.29731
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 279.6 59.4 0.7318 0.0000 0.0000 0.0 0.0
7..2 0.000 279.6 59.4 0.7318 0.0000 0.0000 0.0 0.0
7..3 0.000 279.6 59.4 0.7318 0.0000 0.0000 0.0 0.0
7..4 0.000 279.6 59.4 0.7318 0.0000 0.0000 0.0 0.0
7..5 0.000 279.6 59.4 0.7318 0.0000 0.0000 0.0 0.0
7..6 0.000 279.6 59.4 0.7318 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323021_1_1975_MLBR_RS09375)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323021_1_1975_MLBR_RS09375)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -433.063437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.678982
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323021_1_1975_MLBR_RS09375: 0.000004, NC_002677_1_NP_302255_1_1127_rplN: 0.000004, NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310: 0.000004, NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470: 0.000004, NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180: 0.000004, NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.67898
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -433.063437 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.124026 2.423038
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041323021_1_1975_MLBR_RS09375: 0.000004, NC_002677_1_NP_302255_1_1127_rplN: 0.000004, NZ_LVXE01000061_1_WP_041323021_1_2367_A3216_RS12310: 0.000004, NZ_LYPH01000044_1_WP_041323021_1_1776_A8144_RS08470: 0.000004, NZ_CP029543_1_WP_041323021_1_2000_DIJ64_RS10180: 0.000004, NZ_AP014567_1_WP_041323021_1_2053_JK2ML_RS10445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.12403
(p1 = 0.00001) w = 2.42304
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 2.42304
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 279.6 59.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041323021_1_1975_MLBR_RS09375)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:13
Model 1: NearlyNeutral -433.063437 Model 2: PositiveSelection -433.063516 Model 0: one-ratio -433.063437 Model 7: beta -433.063437 Model 8: beta&w>1 -433.063437 Model 0 vs 1 0.0 Model 2 vs 1 1.5799999994214886E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
