--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:21:42 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1296/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -459.09 -462.23
2 -459.07 -462.43
--------------------------------------
TOTAL -459.08 -462.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895426 0.089591 0.366414 1.495390 0.853962 1249.62 1375.31 1.000
r(A<->C){all} 0.194486 0.024437 0.000006 0.507161 0.155575 185.69 189.89 1.002
r(A<->G){all} 0.144894 0.015791 0.000013 0.401036 0.113176 203.22 247.27 1.001
r(A<->T){all} 0.155837 0.018822 0.000044 0.439840 0.116869 252.55 257.27 1.004
r(C<->G){all} 0.170429 0.022262 0.000026 0.485363 0.129907 151.83 247.02 1.004
r(C<->T){all} 0.169443 0.020034 0.000156 0.452559 0.134375 219.83 267.86 1.000
r(G<->T){all} 0.164911 0.020000 0.000038 0.457748 0.132201 235.00 343.22 1.011
pi(A){all} 0.210733 0.000510 0.168053 0.256718 0.210814 1194.46 1329.74 1.000
pi(C){all} 0.243578 0.000545 0.199730 0.290982 0.242850 1313.13 1327.57 1.001
pi(G){all} 0.317479 0.000640 0.270772 0.367700 0.316638 1013.66 1220.45 1.001
pi(T){all} 0.228211 0.000513 0.187026 0.275745 0.227585 1309.31 1347.75 1.000
alpha{1,2} 0.421294 0.227407 0.000261 1.414232 0.250565 1273.84 1333.57 1.000
alpha{3} 0.449548 0.220823 0.000108 1.372784 0.293569 1450.49 1475.75 1.000
pinvar{all} 0.995082 0.000034 0.983973 0.999993 0.996920 1218.43 1230.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -444.514502
Model 2: PositiveSelection -444.514485
Model 0: one-ratio -444.514483
Model 7: beta -444.514516
Model 8: beta&w>1 -444.514483
Model 0 vs 1 3.800000001774606E-5
Model 2 vs 1 3.400000002784509E-5
Model 8 vs 7 6.60000000607397E-5
>C1
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C2
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C3
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C4
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C5
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C6
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=111
C1 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C2 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C3 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C4 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C5 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C6 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
**************************************************
C1 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C2 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C3 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C4 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C5 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C6 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
**************************************************
C1 DLVARTLTVSG
C2 DLVARTLTVSG
C3 DLVARTLTVSG
C4 DLVARTLTVSG
C5 DLVARTLTVSG
C6 DLVARTLTVSG
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 111 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 111 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3330]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3330]--->[3330]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.451 Mb, Max= 30.632 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C2 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C3 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C4 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C5 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
C6 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
**************************************************
C1 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C2 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C3 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C4 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C5 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
C6 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
**************************************************
C1 DLVARTLTVSG
C2 DLVARTLTVSG
C3 DLVARTLTVSG
C4 DLVARTLTVSG
C5 DLVARTLTVSG
C6 DLVARTLTVSG
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
C2 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
C3 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
C4 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
C5 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
C6 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
**************************************************
C1 CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
C2 CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
C3 CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
C4 CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
C5 CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
C6 CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
**************************************************
C1 TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
C2 TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
C3 TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
C4 TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
C5 TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
C6 TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
**************************************************
C1 CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
C2 CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
C3 CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
C4 CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
C5 CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
C6 CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
**************************************************
C1 CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
C2 CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
C3 CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
C4 CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
C5 CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
C6 CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
**************************************************
C1 TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
C2 TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
C3 TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
C4 TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
C5 TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
C6 TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
**************************************************
C1 GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
C2 GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
C3 GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
C4 GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
C5 GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
C6 GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
*********************************
>C1
ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>C2
ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>C3
ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>C4
ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>C5
ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>C6
ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA
CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA
TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC
CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC
CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC
TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA
GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>C1
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C2
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C3
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C4
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C5
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
>C6
MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
DLVARTLTVSG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 333 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857617
Setting output file names to "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 709808468
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5574132892
Seed = 1248749305
Swapseed = 1579857617
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -745.269849 -- -24.965149
Chain 2 -- -745.269919 -- -24.965149
Chain 3 -- -745.269963 -- -24.965149
Chain 4 -- -745.269919 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -745.269963 -- -24.965149
Chain 2 -- -745.269963 -- -24.965149
Chain 3 -- -745.269919 -- -24.965149
Chain 4 -- -745.269963 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-745.270] (-745.270) (-745.270) (-745.270) * [-745.270] (-745.270) (-745.270) (-745.270)
500 -- (-470.211) (-471.673) (-470.268) [-464.776] * (-468.254) [-465.660] (-469.923) (-468.496) -- 0:00:00
1000 -- (-465.023) (-474.680) [-463.802] (-470.480) * (-476.952) (-467.477) [-463.400] (-468.152) -- 0:00:00
1500 -- [-472.140] (-469.099) (-470.734) (-465.108) * [-464.814] (-465.770) (-471.988) (-469.031) -- 0:00:00
2000 -- (-475.287) [-466.550] (-475.917) (-465.446) * (-466.684) (-466.053) [-471.059] (-475.697) -- 0:00:00
2500 -- (-466.367) (-464.697) (-469.723) [-466.480] * (-465.973) [-470.911] (-474.383) (-473.987) -- 0:00:00
3000 -- (-467.216) (-464.436) (-464.861) [-462.712] * [-469.248] (-463.246) (-471.135) (-469.354) -- 0:00:00
3500 -- (-471.322) (-467.868) [-467.188] (-468.832) * (-470.947) (-469.132) (-471.923) [-469.230] -- 0:00:00
4000 -- (-466.321) (-474.945) (-475.050) [-466.819] * (-465.488) (-479.212) [-468.019] (-482.355) -- 0:00:00
4500 -- (-470.981) (-468.587) (-470.634) [-464.462] * (-465.159) (-465.929) [-467.050] (-468.219) -- 0:00:00
5000 -- (-471.139) (-471.168) [-466.202] (-465.777) * (-470.046) (-463.668) (-465.745) [-466.825] -- 0:00:00
Average standard deviation of split frequencies: 0.109311
5500 -- [-466.572] (-471.437) (-470.543) (-467.095) * (-467.339) (-466.281) [-467.852] (-466.918) -- 0:00:00
6000 -- [-468.963] (-470.319) (-467.797) (-477.735) * (-475.593) (-464.792) [-468.274] (-470.977) -- 0:00:00
6500 -- (-473.312) (-473.707) [-466.307] (-468.016) * (-480.350) [-469.055] (-462.885) (-471.355) -- 0:00:00
7000 -- [-462.387] (-483.957) (-466.704) (-468.129) * (-469.156) [-462.095] (-471.526) (-469.146) -- 0:00:00
7500 -- [-466.962] (-469.676) (-470.031) (-464.785) * (-469.757) [-464.204] (-468.137) (-475.070) -- 0:00:00
8000 -- (-468.652) (-468.210) (-468.634) [-463.174] * (-474.615) (-469.192) (-486.079) [-466.044] -- 0:00:00
8500 -- [-466.487] (-467.160) (-482.587) (-472.340) * (-472.785) (-467.741) (-472.931) [-476.703] -- 0:01:56
9000 -- [-465.172] (-460.311) (-467.927) (-467.922) * (-476.381) [-469.180] (-466.999) (-477.713) -- 0:01:50
9500 -- [-462.436] (-459.862) (-468.840) (-466.496) * (-468.370) [-469.110] (-471.180) (-472.804) -- 0:01:44
10000 -- [-467.292] (-460.669) (-467.406) (-470.581) * (-473.410) (-472.450) [-462.732] (-468.879) -- 0:01:39
Average standard deviation of split frequencies: 0.071552
10500 -- (-470.062) [-458.540] (-463.944) (-469.522) * (-471.495) (-471.993) (-467.234) [-459.039] -- 0:01:34
11000 -- (-468.865) [-458.394] (-466.591) (-478.869) * (-466.376) (-463.963) (-472.158) [-462.683] -- 0:01:29
11500 -- (-470.014) (-459.442) (-467.073) [-473.574] * [-466.085] (-479.465) (-464.179) (-458.824) -- 0:01:25
12000 -- [-472.604] (-460.363) (-474.837) (-472.266) * (-465.207) (-474.908) (-476.350) [-460.220] -- 0:01:22
12500 -- [-471.484] (-458.797) (-473.327) (-473.600) * (-467.227) (-471.896) (-475.370) [-461.012] -- 0:01:19
13000 -- (-467.061) (-458.740) (-479.771) [-465.513] * (-474.012) (-467.385) (-467.916) [-460.087] -- 0:01:15
13500 -- (-487.843) [-460.211] (-477.280) (-471.152) * (-469.852) (-468.337) (-469.366) [-459.543] -- 0:01:13
14000 -- (-478.661) (-462.809) (-479.993) [-463.945] * (-466.367) [-467.732] (-469.796) (-460.635) -- 0:01:10
14500 -- (-462.800) [-459.667] (-466.132) (-471.265) * (-468.356) (-472.877) [-470.095] (-459.453) -- 0:01:07
15000 -- (-458.611) [-461.554] (-465.600) (-471.730) * (-475.023) (-468.040) (-468.474) [-458.709] -- 0:01:05
Average standard deviation of split frequencies: 0.043419
15500 -- (-458.941) [-459.248] (-469.362) (-466.171) * (-477.131) (-470.580) (-460.908) [-459.039] -- 0:01:03
16000 -- (-459.147) (-458.577) [-469.512] (-474.115) * (-470.482) (-477.723) (-461.752) [-460.621] -- 0:01:01
16500 -- (-458.793) (-458.690) [-465.115] (-468.034) * (-465.855) (-466.552) (-460.446) [-458.890] -- 0:00:59
17000 -- (-457.799) (-461.240) [-473.185] (-473.139) * (-471.351) [-473.875] (-464.016) (-458.209) -- 0:00:57
17500 -- [-463.492] (-463.346) (-464.464) (-477.370) * [-466.179] (-475.643) (-460.370) (-461.145) -- 0:00:56
18000 -- (-459.517) (-460.269) (-472.045) [-468.192] * (-478.020) [-468.891] (-462.266) (-461.201) -- 0:00:54
18500 -- (-461.574) [-460.139] (-471.603) (-466.373) * (-470.905) (-479.374) [-458.810] (-463.403) -- 0:00:53
19000 -- (-463.323) (-459.011) [-474.386] (-473.364) * (-461.607) (-469.660) (-460.218) [-461.330] -- 0:00:51
19500 -- (-462.109) [-457.577] (-468.570) (-479.335) * (-463.607) (-475.855) [-461.709] (-459.236) -- 0:00:50
20000 -- (-459.509) (-460.158) [-463.343] (-467.638) * [-461.009] (-476.151) (-465.209) (-461.096) -- 0:00:49
Average standard deviation of split frequencies: 0.053766
20500 -- (-461.060) (-462.337) [-467.518] (-476.371) * (-459.600) (-469.421) [-462.063] (-459.394) -- 0:00:47
21000 -- (-458.603) [-458.819] (-475.561) (-484.010) * (-458.845) (-473.647) (-463.168) [-458.798] -- 0:00:46
21500 -- (-457.726) (-457.990) [-468.324] (-458.164) * [-460.388] (-463.388) (-458.222) (-459.696) -- 0:00:45
22000 -- [-460.238] (-461.421) (-471.380) (-459.740) * [-460.125] (-472.520) (-462.736) (-458.682) -- 0:00:44
22500 -- (-458.223) [-460.704] (-473.048) (-458.705) * (-459.209) (-468.429) (-460.687) [-459.167] -- 0:00:43
23000 -- (-458.898) (-461.515) (-474.819) [-461.106] * (-460.412) [-471.505] (-459.588) (-458.170) -- 0:00:42
23500 -- (-459.651) [-459.838] (-474.554) (-463.082) * [-459.400] (-481.760) (-457.965) (-460.379) -- 0:00:41
24000 -- [-458.817] (-457.780) (-471.210) (-459.180) * [-458.179] (-467.524) (-463.054) (-457.530) -- 0:01:21
24500 -- (-458.233) (-461.182) (-468.259) [-459.446] * (-457.811) [-470.662] (-459.689) (-459.754) -- 0:01:19
25000 -- [-459.924] (-463.056) (-467.582) (-464.039) * (-461.151) (-471.087) [-458.307] (-458.992) -- 0:01:18
Average standard deviation of split frequencies: 0.037050
25500 -- (-458.798) (-462.420) (-473.807) [-459.888] * (-459.542) (-467.095) [-457.467] (-461.327) -- 0:01:16
26000 -- (-458.548) (-458.134) [-467.145] (-460.954) * (-459.777) (-470.114) [-458.110] (-460.905) -- 0:01:14
26500 -- (-458.730) (-458.068) [-473.495] (-458.337) * [-459.721] (-471.891) (-460.883) (-459.339) -- 0:01:13
27000 -- (-457.858) [-460.785] (-468.362) (-459.337) * (-459.534) (-469.016) (-458.654) [-458.018] -- 0:01:12
27500 -- (-461.276) (-460.492) [-471.899] (-459.279) * (-463.201) (-471.747) (-458.954) [-458.010] -- 0:01:10
28000 -- [-460.864] (-461.497) (-469.794) (-457.917) * (-462.091) (-466.463) [-463.067] (-458.743) -- 0:01:09
28500 -- (-463.395) (-458.392) [-467.037] (-459.815) * (-458.429) (-468.638) (-464.067) [-460.487] -- 0:01:08
29000 -- [-461.197] (-458.171) (-465.506) (-464.306) * (-460.683) (-470.399) (-461.460) [-460.241] -- 0:01:06
29500 -- (-459.769) (-458.402) [-462.097] (-458.461) * [-459.386] (-469.029) (-462.852) (-460.554) -- 0:01:05
30000 -- (-461.587) (-459.284) [-467.902] (-461.862) * (-463.042) (-464.444) (-460.148) [-458.861] -- 0:01:04
Average standard deviation of split frequencies: 0.042106
30500 -- (-458.486) (-460.725) [-470.384] (-460.382) * [-462.175] (-465.238) (-459.927) (-459.803) -- 0:01:03
31000 -- [-459.260] (-459.002) (-481.655) (-460.882) * [-459.156] (-469.503) (-460.911) (-458.492) -- 0:01:02
31500 -- (-459.364) [-461.672] (-470.103) (-461.024) * [-458.497] (-470.784) (-460.102) (-459.361) -- 0:01:01
32000 -- (-458.240) (-464.975) (-469.640) [-460.363] * (-458.322) [-466.544] (-459.502) (-459.699) -- 0:01:00
32500 -- (-459.345) (-460.837) [-468.261] (-462.230) * (-458.686) (-471.852) [-459.166] (-458.913) -- 0:00:59
33000 -- (-460.770) [-459.885] (-472.926) (-457.531) * (-462.659) (-471.935) [-458.921] (-458.122) -- 0:00:58
33500 -- (-463.429) [-459.932] (-463.750) (-459.010) * (-461.134) [-468.345] (-459.507) (-459.969) -- 0:00:57
34000 -- (-459.145) (-461.270) (-462.274) [-458.224] * (-460.661) (-467.320) [-464.143] (-459.293) -- 0:00:56
34500 -- (-459.198) (-459.621) [-466.200] (-460.989) * (-465.806) (-469.475) [-458.805] (-458.719) -- 0:00:55
35000 -- (-459.320) (-460.569) (-477.452) [-462.352] * (-459.385) (-469.192) (-458.962) [-459.922] -- 0:00:55
Average standard deviation of split frequencies: 0.041154
35500 -- (-461.010) (-464.729) (-466.496) [-458.854] * (-460.310) [-466.915] (-460.308) (-461.697) -- 0:00:54
36000 -- (-460.953) (-464.318) (-479.337) [-459.045] * (-460.121) (-466.602) [-461.645] (-459.700) -- 0:00:53
36500 -- (-458.668) (-461.096) (-480.447) [-463.529] * (-460.898) [-469.808] (-459.069) (-459.154) -- 0:00:52
37000 -- [-458.223] (-466.097) (-483.824) (-459.362) * (-462.941) (-475.319) (-459.993) [-458.959] -- 0:00:52
37500 -- (-460.136) (-461.136) (-460.628) [-458.481] * (-464.725) [-470.655] (-460.521) (-459.361) -- 0:00:51
38000 -- (-461.029) (-459.543) [-462.468] (-458.479) * (-460.421) (-475.777) (-459.451) [-458.214] -- 0:00:50
38500 -- (-461.308) (-462.194) [-460.780] (-459.776) * (-459.196) (-473.657) [-458.236] (-459.585) -- 0:00:49
39000 -- (-462.566) (-460.819) [-458.409] (-462.444) * (-462.636) [-470.706] (-459.142) (-460.998) -- 0:00:49
39500 -- (-459.001) (-459.909) (-458.136) [-460.085] * (-460.589) (-469.235) [-462.220] (-458.879) -- 0:01:12
40000 -- [-459.291] (-460.914) (-459.397) (-458.760) * (-459.273) (-481.726) (-459.099) [-459.257] -- 0:01:12
Average standard deviation of split frequencies: 0.036515
40500 -- (-457.870) [-457.894] (-460.062) (-458.153) * (-458.674) (-467.829) [-458.938] (-459.316) -- 0:01:11
41000 -- (-460.408) (-458.031) [-459.086] (-458.727) * [-461.975] (-468.341) (-462.307) (-459.887) -- 0:01:10
41500 -- (-458.342) (-459.368) [-458.690] (-459.350) * (-460.094) (-462.946) [-459.936] (-459.181) -- 0:01:09
42000 -- (-462.251) (-460.390) [-460.898] (-460.698) * (-459.386) (-469.028) (-463.561) [-459.120] -- 0:01:08
42500 -- [-459.614] (-467.998) (-459.208) (-458.722) * (-459.338) (-468.167) [-459.403] (-460.546) -- 0:01:07
43000 -- (-459.423) (-460.820) [-461.420] (-462.958) * (-462.381) (-474.114) (-464.616) [-459.101] -- 0:01:06
43500 -- (-464.088) (-458.344) (-459.907) [-460.838] * (-460.836) (-472.338) (-459.498) [-458.234] -- 0:01:05
44000 -- [-458.062] (-460.688) (-465.771) (-462.078) * (-460.420) (-481.466) [-459.038] (-466.713) -- 0:01:05
44500 -- (-462.348) (-458.622) (-459.241) [-457.755] * (-460.887) [-476.871] (-457.873) (-462.772) -- 0:01:04
45000 -- (-459.337) [-458.640] (-462.011) (-463.309) * (-458.341) [-464.156] (-459.632) (-463.114) -- 0:01:03
Average standard deviation of split frequencies: 0.035624
45500 -- (-461.049) (-461.603) (-459.828) [-458.686] * (-458.051) [-463.205] (-464.089) (-463.762) -- 0:01:02
46000 -- (-459.768) (-459.270) (-458.345) [-459.243] * [-458.521] (-465.967) (-460.011) (-463.879) -- 0:01:02
46500 -- (-459.780) (-460.066) [-458.728] (-461.966) * (-460.879) [-465.359] (-459.517) (-459.842) -- 0:01:01
47000 -- (-459.106) [-460.270] (-461.169) (-460.034) * (-467.666) (-466.315) [-460.381] (-461.024) -- 0:01:00
47500 -- (-458.312) (-459.934) [-459.702] (-459.641) * (-461.200) [-470.879] (-458.271) (-462.511) -- 0:01:00
48000 -- (-460.921) (-458.870) (-460.152) [-459.060] * (-460.739) (-472.536) [-460.499] (-460.059) -- 0:00:59
48500 -- (-459.765) (-458.585) (-460.983) [-457.843] * (-460.960) [-470.185] (-461.102) (-458.612) -- 0:00:58
49000 -- [-459.993] (-459.547) (-460.280) (-458.919) * (-460.038) (-469.422) [-458.758] (-458.306) -- 0:00:58
49500 -- (-464.842) [-458.700] (-458.276) (-460.519) * (-459.852) (-463.640) [-458.813] (-460.278) -- 0:00:57
50000 -- (-459.619) [-459.624] (-458.516) (-459.881) * (-459.679) (-473.709) (-462.046) [-458.852] -- 0:00:57
Average standard deviation of split frequencies: 0.038062
50500 -- [-459.367] (-461.125) (-460.709) (-460.348) * (-457.558) [-468.918] (-461.192) (-460.120) -- 0:00:56
51000 -- (-458.843) (-461.260) (-459.991) [-459.558] * [-458.484] (-471.112) (-462.805) (-459.622) -- 0:00:55
51500 -- (-458.833) (-459.102) (-459.370) [-458.135] * (-459.201) (-462.120) (-458.469) [-460.697] -- 0:00:55
52000 -- (-459.134) (-461.345) [-462.450] (-460.734) * (-458.673) (-464.213) (-460.189) [-460.260] -- 0:00:54
52500 -- (-464.052) (-461.162) (-465.470) [-458.376] * (-460.499) (-465.015) (-462.659) [-459.262] -- 0:00:54
53000 -- [-462.189] (-460.142) (-461.129) (-460.822) * (-458.409) (-469.058) [-458.877] (-459.256) -- 0:00:53
53500 -- (-459.094) (-462.022) [-461.065] (-460.264) * (-458.775) (-472.272) [-460.710] (-460.783) -- 0:00:53
54000 -- [-459.955] (-465.640) (-462.438) (-459.171) * (-458.803) (-467.546) [-463.610] (-459.015) -- 0:00:52
54500 -- (-459.870) [-463.283] (-460.681) (-461.766) * (-460.441) [-472.123] (-460.560) (-459.836) -- 0:00:52
55000 -- [-462.976] (-460.675) (-463.754) (-462.707) * (-460.488) (-468.739) (-462.094) [-460.280] -- 0:01:08
Average standard deviation of split frequencies: 0.035355
55500 -- (-459.447) (-461.664) (-458.681) [-464.097] * (-461.316) [-465.698] (-462.357) (-460.403) -- 0:01:08
56000 -- (-459.645) [-459.472] (-458.237) (-463.376) * [-460.644] (-467.064) (-459.688) (-462.437) -- 0:01:07
56500 -- [-458.618] (-458.499) (-463.828) (-463.213) * (-464.497) [-462.106] (-458.597) (-464.156) -- 0:01:06
57000 -- (-459.601) [-459.709] (-459.463) (-459.779) * (-458.606) (-473.230) (-458.570) [-460.102] -- 0:01:06
57500 -- (-459.315) (-459.571) (-461.959) [-459.196] * (-458.086) (-479.244) [-460.895] (-459.292) -- 0:01:05
58000 -- (-458.876) (-462.622) (-459.200) [-457.795] * (-458.585) (-467.372) (-467.908) [-461.587] -- 0:01:04
58500 -- (-458.534) (-457.852) [-466.230] (-458.111) * (-458.358) (-458.494) (-461.987) [-460.145] -- 0:01:04
59000 -- (-458.671) (-460.167) (-459.082) [-462.100] * (-458.171) (-460.448) (-458.945) [-461.267] -- 0:01:03
59500 -- (-461.539) [-459.129] (-458.788) (-458.752) * (-458.178) (-461.270) (-459.395) [-460.400] -- 0:01:03
60000 -- (-460.556) (-460.232) [-459.052] (-463.182) * (-458.981) (-460.381) (-459.176) [-459.931] -- 0:01:02
Average standard deviation of split frequencies: 0.031470
60500 -- [-459.304] (-459.696) (-460.287) (-459.264) * (-460.144) (-460.425) [-458.418] (-460.492) -- 0:01:02
61000 -- (-462.772) [-460.078] (-459.420) (-461.278) * [-459.574] (-466.859) (-458.581) (-457.636) -- 0:01:01
61500 -- (-459.602) (-459.001) [-461.472] (-458.002) * [-458.584] (-462.594) (-460.106) (-458.807) -- 0:01:01
62000 -- (-458.390) (-460.645) [-459.909] (-465.379) * [-458.926] (-459.527) (-458.350) (-464.447) -- 0:01:00
62500 -- [-459.459] (-459.707) (-459.364) (-462.437) * (-462.386) (-458.622) (-461.386) [-458.948] -- 0:01:00
63000 -- (-458.058) (-459.135) (-459.708) [-461.753] * [-457.615] (-462.539) (-461.087) (-458.322) -- 0:00:59
63500 -- [-458.917] (-460.080) (-459.490) (-461.360) * [-457.535] (-458.886) (-460.077) (-459.706) -- 0:00:58
64000 -- [-457.469] (-460.346) (-460.251) (-460.089) * (-462.896) (-460.194) (-462.618) [-460.424] -- 0:00:58
64500 -- (-468.775) [-458.384] (-459.985) (-459.456) * (-460.966) (-457.606) (-459.760) [-464.838] -- 0:00:58
65000 -- (-460.839) [-459.331] (-460.534) (-462.039) * [-458.453] (-462.037) (-460.027) (-460.076) -- 0:00:57
Average standard deviation of split frequencies: 0.030193
65500 -- (-458.074) (-464.318) [-459.443] (-459.929) * (-463.413) (-466.042) [-463.088] (-459.529) -- 0:00:57
66000 -- (-460.526) (-458.884) [-458.354] (-462.011) * (-461.369) (-466.477) [-460.357] (-461.536) -- 0:00:56
66500 -- (-461.314) [-458.865] (-458.009) (-459.282) * (-460.514) (-463.761) (-459.397) [-459.197] -- 0:00:56
67000 -- (-458.513) [-457.915] (-458.715) (-459.068) * (-460.101) (-462.499) (-460.039) [-460.256] -- 0:00:55
67500 -- [-462.988] (-460.048) (-461.207) (-460.546) * (-460.316) [-458.892] (-459.131) (-458.311) -- 0:00:55
68000 -- (-459.575) (-459.598) (-462.764) [-457.703] * (-462.015) (-465.535) (-461.104) [-459.019] -- 0:00:54
68500 -- (-459.284) (-461.325) (-461.970) [-457.995] * (-459.755) [-464.095] (-458.469) (-459.212) -- 0:00:54
69000 -- (-461.573) (-459.997) [-459.633] (-458.808) * [-459.722] (-465.693) (-459.695) (-459.079) -- 0:00:53
69500 -- (-460.244) (-458.099) (-460.488) [-459.780] * (-459.905) (-460.953) (-459.173) [-459.685] -- 0:00:53
70000 -- (-461.704) [-459.124] (-461.316) (-461.775) * (-460.294) [-458.057] (-458.507) (-461.876) -- 0:00:53
Average standard deviation of split frequencies: 0.031766
70500 -- (-460.712) [-458.646] (-464.440) (-459.336) * [-463.976] (-459.368) (-458.094) (-458.955) -- 0:00:52
71000 -- (-460.755) (-458.534) [-459.215] (-461.993) * [-462.678] (-458.406) (-460.778) (-465.568) -- 0:01:05
71500 -- [-459.161] (-460.679) (-460.622) (-457.698) * (-460.487) [-459.600] (-458.234) (-459.504) -- 0:01:04
72000 -- (-458.192) [-458.439] (-458.524) (-457.998) * [-461.066] (-460.558) (-461.555) (-458.421) -- 0:01:04
72500 -- (-461.654) (-460.576) [-459.218] (-458.353) * (-461.816) (-463.759) [-460.312] (-461.325) -- 0:01:03
73000 -- [-464.100] (-457.594) (-458.134) (-458.756) * (-458.592) (-459.470) [-460.639] (-460.730) -- 0:01:03
73500 -- (-460.984) [-458.383] (-458.036) (-460.352) * [-461.724] (-460.629) (-460.108) (-461.961) -- 0:01:03
74000 -- (-460.335) (-459.044) [-458.632] (-458.022) * [-457.482] (-461.210) (-459.485) (-459.940) -- 0:01:02
74500 -- (-458.800) (-462.595) (-460.315) [-458.725] * [-459.258] (-461.172) (-457.845) (-461.659) -- 0:01:02
75000 -- (-458.406) [-460.096] (-459.228) (-458.196) * (-457.970) (-461.372) (-458.606) [-461.321] -- 0:01:01
Average standard deviation of split frequencies: 0.031604
75500 -- (-458.133) [-459.616] (-458.990) (-459.343) * (-459.866) (-458.542) (-459.925) [-458.402] -- 0:01:01
76000 -- (-458.133) (-459.159) (-463.124) [-459.519] * (-459.281) (-457.818) [-460.324] (-462.960) -- 0:01:00
76500 -- [-458.554] (-461.196) (-460.048) (-462.631) * (-462.312) (-458.535) (-461.707) [-460.142] -- 0:01:00
77000 -- (-459.750) (-464.147) (-459.838) [-464.946] * [-458.308] (-459.334) (-459.687) (-462.675) -- 0:00:59
77500 -- [-461.301] (-462.315) (-461.023) (-460.095) * [-461.321] (-462.170) (-458.947) (-458.728) -- 0:00:59
78000 -- (-461.994) (-459.055) [-458.612] (-460.200) * (-461.487) (-458.355) (-458.027) [-461.152] -- 0:00:59
78500 -- (-469.001) [-460.089] (-458.187) (-463.592) * (-459.946) (-460.434) [-461.449] (-460.918) -- 0:00:58
79000 -- [-467.956] (-460.333) (-462.580) (-459.099) * (-463.270) [-459.859] (-459.152) (-460.788) -- 0:00:58
79500 -- (-459.096) (-462.707) (-467.271) [-458.616] * [-459.578] (-462.506) (-458.952) (-462.759) -- 0:00:57
80000 -- [-459.772] (-460.719) (-467.271) (-460.643) * [-457.817] (-458.006) (-461.416) (-460.931) -- 0:00:57
Average standard deviation of split frequencies: 0.028384
80500 -- (-460.604) (-460.051) (-460.464) [-458.032] * (-458.113) (-458.290) [-459.844] (-458.221) -- 0:00:57
81000 -- [-460.554] (-457.857) (-460.316) (-460.540) * (-461.140) (-461.018) (-461.059) [-461.657] -- 0:00:56
81500 -- (-460.055) [-458.553] (-458.937) (-466.022) * (-462.734) (-458.034) (-465.542) [-459.196] -- 0:00:56
82000 -- (-463.809) (-459.375) [-459.554] (-459.940) * [-459.561] (-458.624) (-459.593) (-458.854) -- 0:00:55
82500 -- [-459.328] (-460.159) (-459.242) (-459.022) * (-459.733) (-461.190) [-458.679] (-461.292) -- 0:00:55
83000 -- [-458.311] (-460.586) (-463.245) (-458.644) * [-458.420] (-459.197) (-459.099) (-461.541) -- 0:00:55
83500 -- [-461.717] (-462.003) (-458.379) (-458.135) * (-459.477) (-458.755) (-458.287) [-458.768] -- 0:00:54
84000 -- (-461.659) (-461.780) [-458.570] (-458.468) * (-458.352) [-459.417] (-458.881) (-459.359) -- 0:00:54
84500 -- (-458.674) [-463.200] (-461.313) (-460.028) * [-460.851] (-459.815) (-458.490) (-460.099) -- 0:00:54
85000 -- [-462.242] (-464.660) (-460.164) (-460.515) * (-461.508) [-459.829] (-458.378) (-459.152) -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- (-458.067) (-458.858) (-458.378) [-459.264] * (-459.434) (-461.540) (-462.918) [-461.018] -- 0:00:53
86000 -- (-459.887) (-461.652) (-458.702) [-459.541] * (-459.072) (-463.181) [-460.140] (-461.461) -- 0:00:53
86500 -- [-459.005] (-461.563) (-460.439) (-458.885) * [-459.271] (-458.588) (-458.965) (-458.217) -- 0:00:52
87000 -- (-461.512) (-459.976) (-461.892) [-458.118] * [-458.700] (-462.629) (-459.847) (-461.210) -- 0:00:52
87500 -- (-460.828) [-460.028] (-460.300) (-458.302) * (-458.665) (-460.789) [-459.919] (-461.165) -- 0:00:52
88000 -- (-459.652) (-458.997) [-459.558] (-458.942) * (-458.402) (-458.074) [-462.482] (-461.760) -- 0:01:02
88500 -- (-458.707) [-458.827] (-458.705) (-460.799) * (-460.242) [-458.670] (-460.819) (-458.260) -- 0:01:01
89000 -- (-458.509) [-460.553] (-458.912) (-462.199) * (-460.135) [-460.958] (-464.546) (-459.755) -- 0:01:01
89500 -- (-458.126) (-459.404) [-459.434] (-459.891) * (-461.209) (-462.448) (-463.247) [-458.268] -- 0:01:01
90000 -- [-462.758] (-459.762) (-458.114) (-462.320) * (-462.824) (-458.315) (-458.106) [-460.483] -- 0:01:00
Average standard deviation of split frequencies: 0.025524
90500 -- (-459.747) [-459.366] (-467.014) (-459.815) * (-463.440) (-461.355) [-458.958] (-458.715) -- 0:01:00
91000 -- (-464.686) [-458.299] (-458.077) (-458.431) * (-459.359) (-459.243) [-459.406] (-459.613) -- 0:00:59
91500 -- (-462.844) (-464.116) (-459.482) [-457.910] * (-458.189) (-459.601) [-459.292] (-463.788) -- 0:00:59
92000 -- [-462.619] (-464.760) (-459.860) (-457.593) * (-462.721) (-459.136) (-464.047) [-459.757] -- 0:00:59
92500 -- (-463.106) [-459.361] (-458.147) (-459.743) * (-461.424) (-458.076) (-460.117) [-460.865] -- 0:00:58
93000 -- (-460.446) [-459.620] (-459.058) (-460.485) * (-459.079) (-458.985) [-462.078] (-462.454) -- 0:00:58
93500 -- (-460.803) (-458.481) (-459.316) [-458.686] * (-459.220) (-459.205) [-459.448] (-460.844) -- 0:00:58
94000 -- [-459.250] (-457.979) (-458.382) (-461.105) * (-459.969) [-458.591] (-459.975) (-465.896) -- 0:00:57
94500 -- [-460.568] (-460.640) (-459.131) (-462.083) * [-459.729] (-460.216) (-457.735) (-459.504) -- 0:00:57
95000 -- (-459.324) (-457.626) (-459.613) [-462.626] * [-459.927] (-463.244) (-458.717) (-458.374) -- 0:00:57
Average standard deviation of split frequencies: 0.025289
95500 -- (-458.218) [-458.535] (-460.687) (-459.514) * (-460.122) [-461.296] (-461.332) (-459.347) -- 0:00:56
96000 -- (-460.613) [-457.674] (-461.424) (-458.430) * (-458.774) [-459.245] (-459.407) (-462.684) -- 0:00:56
96500 -- (-458.608) (-459.324) (-462.883) [-462.613] * (-463.920) (-459.843) [-459.894] (-464.155) -- 0:00:56
97000 -- [-458.096] (-458.618) (-463.716) (-462.513) * (-457.903) (-458.857) (-459.080) [-458.391] -- 0:00:55
97500 -- (-461.063) [-460.633] (-459.861) (-463.613) * (-458.296) (-462.465) (-458.391) [-459.420] -- 0:00:55
98000 -- (-460.847) [-460.809] (-468.318) (-458.743) * [-460.069] (-462.071) (-459.278) (-462.290) -- 0:00:55
98500 -- (-462.448) (-459.499) [-463.791] (-463.803) * (-459.291) (-460.056) [-458.737] (-460.256) -- 0:00:54
99000 -- [-460.722] (-460.181) (-462.465) (-463.196) * [-457.651] (-461.426) (-460.567) (-463.145) -- 0:00:54
99500 -- [-461.246] (-459.932) (-460.133) (-459.611) * [-457.875] (-459.856) (-460.748) (-464.330) -- 0:00:54
100000 -- (-461.196) (-463.998) (-458.651) [-462.259] * (-458.366) (-459.528) (-460.431) [-459.279] -- 0:00:54
Average standard deviation of split frequencies: 0.023414
100500 -- (-460.531) (-460.088) [-458.402] (-459.106) * (-460.479) (-458.898) (-461.591) [-458.365] -- 0:00:53
101000 -- [-461.692] (-459.795) (-461.060) (-458.099) * (-459.393) (-459.382) (-460.713) [-457.844] -- 0:00:53
101500 -- [-459.870] (-463.078) (-460.012) (-458.200) * (-461.255) (-458.867) (-459.086) [-459.457] -- 0:00:53
102000 -- [-459.790] (-462.539) (-459.621) (-459.193) * [-462.007] (-458.361) (-461.204) (-458.728) -- 0:00:52
102500 -- (-459.605) (-466.267) [-457.698] (-458.167) * [-459.026] (-462.167) (-459.735) (-463.328) -- 0:00:52
103000 -- (-461.593) (-459.939) [-460.252] (-458.042) * (-461.511) [-460.078] (-461.025) (-463.958) -- 0:00:52
103500 -- (-458.785) [-459.436] (-459.104) (-457.542) * [-460.694] (-460.019) (-460.620) (-460.419) -- 0:00:51
104000 -- (-462.424) (-458.626) [-462.564] (-461.369) * (-458.271) (-459.301) (-458.120) [-463.830] -- 0:00:51
104500 -- (-460.257) (-460.793) (-466.415) [-460.259] * [-461.179] (-460.125) (-458.146) (-460.958) -- 0:00:51
105000 -- [-459.993] (-462.606) (-461.041) (-459.540) * [-457.611] (-459.014) (-460.190) (-460.325) -- 0:00:59
Average standard deviation of split frequencies: 0.022871
105500 -- [-461.194] (-461.283) (-458.096) (-459.489) * [-459.093] (-460.750) (-459.622) (-461.428) -- 0:00:59
106000 -- (-459.190) [-458.809] (-458.816) (-458.458) * (-459.299) (-460.934) (-457.518) [-461.451] -- 0:00:59
106500 -- (-458.406) (-459.619) (-460.293) [-458.865] * (-460.536) (-459.229) [-457.793] (-458.727) -- 0:00:58
107000 -- (-461.002) [-458.884] (-463.331) (-457.686) * [-460.811] (-460.556) (-458.052) (-461.373) -- 0:00:58
107500 -- (-458.532) (-458.213) (-461.196) [-463.597] * (-458.039) (-459.675) (-461.127) [-459.071] -- 0:00:58
108000 -- (-462.297) (-458.432) (-461.376) [-463.410] * (-460.502) (-459.662) (-462.618) [-462.236] -- 0:00:57
108500 -- (-461.566) (-457.860) (-457.985) [-459.285] * (-463.972) [-458.414] (-457.930) (-459.385) -- 0:00:57
109000 -- (-458.116) [-457.589] (-461.117) (-462.379) * (-458.622) (-459.504) [-458.743] (-458.443) -- 0:00:57
109500 -- (-460.503) [-458.704] (-463.649) (-461.413) * (-460.877) (-462.214) (-459.014) [-457.966] -- 0:00:56
110000 -- [-461.417] (-458.493) (-461.273) (-462.350) * [-460.413] (-461.926) (-460.495) (-458.093) -- 0:00:56
Average standard deviation of split frequencies: 0.025761
110500 -- (-462.110) (-460.397) [-459.968] (-465.486) * (-464.434) (-460.644) [-460.205] (-460.260) -- 0:00:56
111000 -- (-462.117) (-460.623) (-459.136) [-457.775] * (-468.387) (-460.860) [-461.508] (-458.693) -- 0:00:56
111500 -- (-461.356) (-458.655) (-459.640) [-460.217] * (-464.191) [-459.990] (-459.375) (-459.896) -- 0:00:55
112000 -- [-457.832] (-458.701) (-463.087) (-458.599) * (-458.097) (-464.611) (-458.397) [-458.432] -- 0:00:55
112500 -- (-460.462) (-460.658) (-463.362) [-459.848] * (-462.106) [-459.336] (-459.984) (-459.146) -- 0:00:55
113000 -- [-458.667] (-463.221) (-460.326) (-459.404) * (-465.157) [-462.234] (-462.624) (-459.288) -- 0:00:54
113500 -- (-458.738) (-459.282) (-466.304) [-457.858] * [-459.113] (-462.296) (-463.503) (-458.981) -- 0:00:54
114000 -- (-459.259) (-461.112) [-460.170] (-458.055) * (-459.963) (-457.892) (-463.082) [-457.904] -- 0:00:54
114500 -- (-461.072) [-459.573] (-459.479) (-466.738) * (-459.348) (-458.550) (-463.991) [-461.631] -- 0:00:54
115000 -- [-459.359] (-459.512) (-458.190) (-461.659) * (-460.168) [-458.686] (-459.226) (-463.699) -- 0:00:53
Average standard deviation of split frequencies: 0.024189
115500 -- (-460.882) [-459.056] (-458.173) (-460.163) * (-461.828) (-461.650) [-459.179] (-459.104) -- 0:00:53
116000 -- (-462.188) (-458.290) (-460.569) [-461.692] * (-458.944) [-459.821] (-458.908) (-458.486) -- 0:00:53
116500 -- (-460.663) (-460.719) [-460.073] (-457.978) * [-461.251] (-458.557) (-459.023) (-459.336) -- 0:00:53
117000 -- [-459.561] (-459.616) (-458.007) (-459.565) * (-457.889) [-461.883] (-458.534) (-459.461) -- 0:00:52
117500 -- (-465.763) (-458.487) (-461.825) [-459.572] * (-457.792) (-459.792) [-459.276] (-458.635) -- 0:00:52
118000 -- [-463.115] (-461.647) (-459.057) (-459.529) * (-459.927) [-459.247] (-457.946) (-458.298) -- 0:00:52
118500 -- (-459.639) (-458.807) (-459.548) [-458.898] * [-459.668] (-459.988) (-461.058) (-459.743) -- 0:00:52
119000 -- (-460.880) (-459.614) (-460.316) [-463.982] * (-460.697) [-459.107] (-462.900) (-460.118) -- 0:00:51
119500 -- (-459.242) (-459.928) [-459.389] (-462.286) * [-463.590] (-460.043) (-462.035) (-457.552) -- 0:00:51
120000 -- [-459.052] (-460.848) (-461.403) (-457.706) * (-458.895) [-460.842] (-459.788) (-461.669) -- 0:00:51
Average standard deviation of split frequencies: 0.024742
120500 -- (-458.544) [-460.309] (-460.627) (-457.739) * (-461.724) [-458.247] (-460.972) (-458.567) -- 0:00:51
121000 -- (-462.217) [-458.917] (-460.323) (-458.400) * (-457.742) [-459.853] (-459.247) (-462.002) -- 0:00:50
121500 -- (-459.223) (-459.987) (-460.498) [-460.808] * (-460.624) [-461.392] (-458.982) (-459.743) -- 0:00:57
122000 -- (-458.626) [-458.179] (-458.374) (-463.472) * (-459.453) (-460.564) (-460.103) [-459.820] -- 0:00:57
122500 -- (-460.141) (-460.306) (-459.582) [-461.002] * (-461.889) [-461.766] (-458.656) (-458.369) -- 0:00:57
123000 -- (-460.848) (-458.800) [-458.412] (-461.400) * (-460.281) [-461.318] (-459.157) (-458.560) -- 0:00:57
123500 -- [-459.786] (-459.616) (-458.695) (-460.219) * (-461.140) (-460.686) [-458.095] (-459.627) -- 0:00:56
124000 -- (-459.171) [-458.333] (-465.964) (-461.108) * (-465.168) (-459.334) (-461.480) [-461.599] -- 0:00:56
124500 -- (-460.088) [-458.671] (-458.822) (-462.639) * (-465.418) [-458.569] (-459.211) (-458.871) -- 0:00:56
125000 -- (-460.259) [-459.022] (-464.939) (-459.688) * (-459.056) [-459.446] (-458.594) (-458.134) -- 0:00:56
Average standard deviation of split frequencies: 0.021023
125500 -- [-460.154] (-459.600) (-461.852) (-460.376) * (-460.412) [-458.093] (-459.203) (-457.881) -- 0:00:55
126000 -- (-460.682) (-461.692) (-458.748) [-458.705] * [-459.077] (-458.902) (-465.483) (-462.677) -- 0:00:55
126500 -- [-457.961] (-457.730) (-462.584) (-459.597) * (-459.844) (-460.662) (-458.005) [-458.559] -- 0:00:55
127000 -- (-459.153) [-458.827] (-461.562) (-458.705) * (-459.156) [-458.507] (-458.144) (-459.659) -- 0:00:54
127500 -- (-460.410) (-462.180) (-458.392) [-458.576] * (-465.618) (-459.359) (-461.172) [-459.174] -- 0:00:54
128000 -- [-460.034] (-461.472) (-459.360) (-463.932) * (-459.635) (-459.930) (-462.862) [-462.655] -- 0:00:54
128500 -- (-463.635) [-458.586] (-460.443) (-465.397) * [-458.376] (-459.017) (-465.972) (-459.995) -- 0:00:54
129000 -- (-461.397) [-459.826] (-465.263) (-458.949) * [-460.431] (-459.186) (-464.620) (-459.304) -- 0:00:54
129500 -- [-461.183] (-459.952) (-459.470) (-459.002) * (-459.533) (-459.448) [-462.595] (-462.317) -- 0:00:53
130000 -- (-458.048) [-457.437] (-460.462) (-458.176) * (-459.020) (-458.798) [-457.847] (-458.120) -- 0:00:53
Average standard deviation of split frequencies: 0.020507
130500 -- (-460.001) (-460.238) [-462.812] (-458.660) * [-459.786] (-458.509) (-458.511) (-460.316) -- 0:00:53
131000 -- (-461.059) [-458.751] (-461.588) (-459.452) * (-460.090) [-459.868] (-458.266) (-460.431) -- 0:00:53
131500 -- (-458.677) [-458.566] (-461.243) (-457.851) * (-458.588) [-458.612] (-457.571) (-459.098) -- 0:00:52
132000 -- (-462.842) (-459.045) [-461.992] (-460.258) * (-458.846) [-460.457] (-458.489) (-458.811) -- 0:00:52
132500 -- (-458.087) (-457.633) [-460.013] (-460.633) * [-459.131] (-459.615) (-460.213) (-460.790) -- 0:00:52
133000 -- [-462.915] (-458.655) (-459.054) (-460.491) * (-461.820) (-460.522) (-461.926) [-458.990] -- 0:00:52
133500 -- (-461.073) (-459.754) [-459.119] (-461.984) * (-464.091) (-459.201) (-458.057) [-459.310] -- 0:00:51
134000 -- (-463.228) (-461.103) [-461.526] (-462.488) * (-460.886) [-460.543] (-459.931) (-463.608) -- 0:00:51
134500 -- (-460.395) [-458.778] (-460.318) (-461.186) * (-461.372) (-461.649) [-459.994] (-458.529) -- 0:00:51
135000 -- (-464.334) (-461.085) [-461.598] (-460.583) * (-460.472) (-462.378) (-459.367) [-462.033] -- 0:00:51
Average standard deviation of split frequencies: 0.018791
135500 -- [-460.722] (-458.312) (-460.460) (-458.709) * (-457.884) (-459.048) [-460.341] (-459.752) -- 0:00:51
136000 -- (-459.240) (-458.167) [-460.565] (-458.853) * (-460.632) (-459.748) [-459.433] (-459.322) -- 0:00:50
136500 -- (-458.245) [-460.426] (-462.240) (-459.081) * [-460.005] (-457.792) (-458.048) (-459.334) -- 0:00:50
137000 -- [-460.057] (-458.583) (-462.106) (-458.547) * [-459.567] (-459.446) (-464.572) (-458.692) -- 0:00:50
137500 -- (-459.504) [-459.747] (-460.873) (-459.721) * (-458.609) [-457.840] (-459.331) (-458.651) -- 0:00:50
138000 -- [-461.423] (-460.451) (-463.016) (-458.354) * (-458.949) (-459.249) (-460.927) [-461.123] -- 0:00:49
138500 -- [-461.787] (-460.105) (-459.396) (-459.714) * (-457.642) (-462.317) (-457.962) [-461.947] -- 0:00:55
139000 -- (-464.589) (-462.063) (-459.724) [-459.012] * (-458.062) (-459.476) [-458.978] (-461.550) -- 0:00:55
139500 -- (-463.976) [-458.564] (-459.277) (-459.234) * (-459.730) [-458.016] (-458.897) (-460.686) -- 0:00:55
140000 -- (-459.139) (-461.012) (-458.942) [-459.164] * (-459.116) (-458.593) [-459.403] (-460.031) -- 0:00:55
Average standard deviation of split frequencies: 0.019921
140500 -- (-464.344) (-461.862) (-459.905) [-459.369] * (-459.939) (-458.327) [-461.860] (-458.797) -- 0:00:55
141000 -- [-458.457] (-461.032) (-462.911) (-457.746) * [-458.349] (-458.520) (-462.349) (-459.770) -- 0:00:54
141500 -- [-459.760] (-460.682) (-460.131) (-459.147) * [-461.170] (-459.452) (-457.973) (-464.998) -- 0:00:54
142000 -- (-458.798) (-458.916) (-459.002) [-459.369] * (-463.118) [-460.167] (-461.132) (-464.655) -- 0:00:54
142500 -- (-459.475) [-458.545] (-461.000) (-461.144) * (-459.551) (-458.938) [-459.274] (-468.105) -- 0:00:54
143000 -- [-461.912] (-463.806) (-459.826) (-461.456) * (-459.425) [-459.513] (-459.283) (-460.490) -- 0:00:53
143500 -- (-458.589) [-458.766] (-457.489) (-458.777) * (-458.316) (-458.583) (-459.496) [-460.970] -- 0:00:53
144000 -- (-457.344) [-459.869] (-458.245) (-465.013) * [-458.800] (-464.470) (-459.269) (-460.391) -- 0:00:53
144500 -- (-457.647) (-459.382) [-462.452] (-461.075) * [-458.597] (-459.417) (-458.818) (-462.029) -- 0:00:53
145000 -- (-458.219) (-459.052) [-461.830] (-459.061) * (-459.345) (-458.179) (-458.452) [-458.772] -- 0:00:53
Average standard deviation of split frequencies: 0.020826
145500 -- (-458.105) [-458.499] (-459.872) (-460.424) * [-460.174] (-461.235) (-459.634) (-458.882) -- 0:00:52
146000 -- (-460.462) [-466.859] (-460.131) (-459.534) * [-459.557] (-459.979) (-463.094) (-461.019) -- 0:00:52
146500 -- (-461.043) (-466.585) [-458.959] (-459.764) * (-458.515) (-459.854) [-461.633] (-459.895) -- 0:00:52
147000 -- (-458.157) (-460.663) (-458.811) [-462.651] * (-459.832) [-458.088] (-462.186) (-461.314) -- 0:00:52
147500 -- [-459.274] (-459.756) (-459.677) (-460.860) * (-459.847) [-460.661] (-462.517) (-460.149) -- 0:00:52
148000 -- (-461.695) (-458.979) (-457.944) [-459.048] * (-460.148) [-460.327] (-459.258) (-458.151) -- 0:00:51
148500 -- (-459.414) (-460.175) [-458.422] (-459.340) * (-460.177) (-457.762) (-460.472) [-458.101] -- 0:00:51
149000 -- (-459.539) (-459.391) [-458.713] (-458.355) * (-458.122) [-457.708] (-461.444) (-457.894) -- 0:00:51
149500 -- (-459.564) (-459.779) (-458.749) [-460.086] * (-462.937) (-460.720) (-462.988) [-458.566] -- 0:00:51
150000 -- (-465.324) (-462.270) [-458.693] (-458.181) * [-458.861] (-460.165) (-459.882) (-460.556) -- 0:00:51
Average standard deviation of split frequencies: 0.020685
150500 -- (-462.023) [-458.279] (-458.462) (-457.874) * [-460.890] (-460.480) (-458.775) (-461.565) -- 0:00:50
151000 -- (-460.199) [-459.548] (-459.745) (-462.904) * (-462.528) (-461.042) (-460.237) [-460.339] -- 0:00:50
151500 -- (-460.199) (-459.899) (-459.333) [-459.331] * (-461.659) (-459.391) [-459.245] (-460.587) -- 0:00:50
152000 -- [-461.878] (-459.001) (-460.944) (-460.733) * (-460.245) (-458.980) [-460.228] (-464.344) -- 0:00:50
152500 -- (-461.227) [-461.848] (-458.758) (-460.655) * [-459.142] (-459.624) (-459.414) (-461.333) -- 0:00:50
153000 -- (-464.096) [-459.959] (-464.677) (-458.714) * (-460.501) (-462.470) [-464.927] (-462.447) -- 0:00:49
153500 -- [-462.921] (-459.506) (-462.515) (-459.279) * [-461.892] (-463.047) (-459.916) (-461.979) -- 0:00:49
154000 -- [-461.018] (-462.029) (-461.046) (-459.234) * (-462.153) (-460.436) [-458.576] (-461.423) -- 0:00:49
154500 -- (-459.322) (-458.655) (-459.766) [-458.319] * [-462.403] (-460.212) (-459.864) (-461.782) -- 0:00:49
155000 -- (-459.875) (-459.586) [-460.949] (-458.682) * [-460.425] (-461.703) (-464.246) (-459.677) -- 0:00:49
Average standard deviation of split frequencies: 0.017963
155500 -- (-460.650) (-465.784) [-458.618] (-459.039) * [-457.985] (-460.269) (-462.210) (-460.182) -- 0:00:54
156000 -- (-463.162) (-463.346) (-458.549) [-460.447] * (-458.523) [-459.040] (-460.073) (-459.259) -- 0:00:54
156500 -- [-458.765] (-463.483) (-459.810) (-461.683) * (-458.835) (-458.147) (-458.775) [-458.684] -- 0:00:53
157000 -- (-459.691) [-461.580] (-459.623) (-459.395) * (-459.740) [-457.740] (-459.434) (-460.906) -- 0:00:53
157500 -- (-457.814) (-461.123) (-460.128) [-457.468] * (-458.843) [-457.698] (-460.633) (-459.244) -- 0:00:53
158000 -- (-459.394) (-460.405) [-462.029] (-461.188) * (-461.045) [-460.100] (-459.736) (-458.904) -- 0:00:53
158500 -- [-458.695] (-458.297) (-458.848) (-460.577) * (-460.569) (-461.923) [-459.222] (-457.886) -- 0:00:53
159000 -- (-458.515) [-459.265] (-459.445) (-461.810) * [-458.703] (-462.108) (-461.906) (-459.038) -- 0:00:52
159500 -- (-459.019) (-459.069) [-459.628] (-463.461) * (-460.679) (-458.876) [-457.909] (-464.862) -- 0:00:52
160000 -- (-463.873) (-460.611) [-458.872] (-458.283) * [-460.386] (-459.946) (-460.909) (-461.958) -- 0:00:52
Average standard deviation of split frequencies: 0.019397
160500 -- [-462.155] (-460.287) (-458.971) (-459.068) * (-460.861) (-461.931) [-458.969] (-461.557) -- 0:00:52
161000 -- (-459.750) (-460.311) (-457.982) [-461.761] * (-458.190) (-459.056) [-461.257] (-459.624) -- 0:00:52
161500 -- (-467.414) (-459.297) [-457.852] (-458.953) * (-461.029) (-461.042) (-461.982) [-459.272] -- 0:00:51
162000 -- (-458.448) (-458.815) [-457.523] (-463.462) * (-461.869) [-461.620] (-461.142) (-459.262) -- 0:00:51
162500 -- (-463.752) (-458.536) (-460.782) [-459.293] * (-460.684) (-460.544) [-458.479] (-458.128) -- 0:00:51
163000 -- (-458.388) (-458.846) (-460.640) [-459.292] * (-460.230) (-458.663) [-458.887] (-462.120) -- 0:00:51
163500 -- (-459.029) (-458.800) (-458.369) [-459.867] * (-459.777) (-458.282) (-460.258) [-459.866] -- 0:00:51
164000 -- [-457.992] (-459.743) (-462.637) (-461.749) * (-460.157) [-460.021] (-459.525) (-460.399) -- 0:00:50
164500 -- (-460.655) (-460.287) (-462.085) [-458.414] * (-460.683) (-459.237) (-459.053) [-460.318] -- 0:00:50
165000 -- [-459.055] (-458.463) (-459.774) (-459.217) * (-460.043) (-457.805) [-458.708] (-468.029) -- 0:00:50
Average standard deviation of split frequencies: 0.021298
165500 -- (-459.054) [-458.793] (-459.913) (-461.095) * (-458.564) (-465.595) (-458.285) [-458.235] -- 0:00:50
166000 -- (-458.509) (-458.300) [-460.678] (-461.528) * (-458.751) (-462.148) [-458.596] (-458.251) -- 0:00:50
166500 -- (-459.454) [-459.063] (-457.710) (-462.737) * (-457.868) (-458.777) (-460.261) [-460.734] -- 0:00:50
167000 -- (-459.351) (-458.801) [-460.324] (-459.200) * (-461.812) [-464.941] (-460.396) (-459.235) -- 0:00:49
167500 -- [-458.954] (-458.282) (-460.682) (-460.650) * (-460.785) [-463.706] (-465.521) (-459.129) -- 0:00:49
168000 -- (-458.981) (-459.075) (-461.964) [-458.888] * [-458.719] (-464.686) (-457.658) (-461.067) -- 0:00:49
168500 -- (-458.628) (-459.276) (-460.051) [-457.906] * [-458.177] (-464.864) (-459.107) (-460.570) -- 0:00:49
169000 -- (-461.527) [-461.102] (-459.933) (-458.934) * (-460.583) (-466.072) [-459.200] (-458.867) -- 0:00:49
169500 -- (-462.812) (-459.828) (-460.292) [-460.426] * (-462.436) [-468.228] (-463.134) (-457.481) -- 0:00:48
170000 -- (-460.940) [-460.363] (-462.813) (-459.388) * [-463.772] (-465.398) (-461.037) (-459.977) -- 0:00:48
Average standard deviation of split frequencies: 0.020062
170500 -- (-458.413) (-460.489) (-459.410) [-459.985] * [-461.176] (-464.825) (-460.421) (-458.416) -- 0:00:48
171000 -- (-462.167) (-461.890) [-460.363] (-458.787) * (-460.180) (-459.744) (-461.232) [-460.122] -- 0:00:48
171500 -- (-459.755) (-459.292) [-459.668] (-461.191) * (-462.432) [-463.995] (-458.310) (-459.592) -- 0:00:48
172000 -- (-462.742) [-459.053] (-464.186) (-460.140) * (-462.962) (-458.885) [-458.877] (-459.982) -- 0:00:48
172500 -- [-459.137] (-458.890) (-461.190) (-458.845) * (-465.707) [-461.021] (-463.166) (-458.726) -- 0:00:52
173000 -- (-459.859) (-460.018) [-457.804] (-458.658) * [-460.542] (-461.815) (-462.335) (-462.851) -- 0:00:52
173500 -- (-458.731) (-460.920) [-457.670] (-460.717) * [-460.090] (-459.439) (-459.106) (-460.835) -- 0:00:52
174000 -- (-457.979) (-461.439) (-459.608) [-460.364] * (-460.335) (-459.283) [-460.004] (-460.450) -- 0:00:52
174500 -- (-458.508) [-459.485] (-460.381) (-461.967) * (-457.961) (-463.761) (-459.795) [-460.674] -- 0:00:52
175000 -- (-459.025) [-465.250] (-461.720) (-458.829) * (-459.810) (-462.587) [-458.834] (-459.642) -- 0:00:51
Average standard deviation of split frequencies: 0.020018
175500 -- (-461.537) (-459.414) [-461.387] (-461.522) * (-462.159) (-458.892) [-458.464] (-458.983) -- 0:00:51
176000 -- [-460.055] (-459.717) (-462.855) (-463.258) * (-460.343) [-459.584] (-460.871) (-459.217) -- 0:00:51
176500 -- (-463.280) (-458.358) [-461.110] (-458.265) * (-461.956) (-459.395) [-458.771] (-458.422) -- 0:00:51
177000 -- [-464.064] (-462.364) (-459.829) (-463.167) * (-462.918) [-460.731] (-460.350) (-458.656) -- 0:00:51
177500 -- [-462.130] (-463.243) (-460.913) (-459.410) * (-458.529) (-460.680) [-463.865] (-459.116) -- 0:00:50
178000 -- [-461.571] (-460.367) (-458.263) (-460.072) * (-460.190) (-463.121) (-459.949) [-457.749] -- 0:00:50
178500 -- (-458.424) (-458.762) [-459.859] (-460.035) * (-460.030) (-460.637) [-460.011] (-459.296) -- 0:00:50
179000 -- (-459.874) (-460.363) (-459.987) [-467.610] * (-460.003) (-457.962) [-461.601] (-461.812) -- 0:00:50
179500 -- (-458.913) [-457.964] (-461.004) (-465.190) * (-459.827) (-459.859) (-459.740) [-458.663] -- 0:00:50
180000 -- (-460.925) (-460.424) (-464.412) [-461.804] * (-457.824) (-460.374) [-459.833] (-458.423) -- 0:00:50
Average standard deviation of split frequencies: 0.017685
180500 -- [-458.521] (-460.282) (-460.851) (-462.755) * (-458.079) (-460.853) (-460.882) [-459.956] -- 0:00:49
181000 -- [-459.157] (-459.866) (-459.868) (-458.590) * (-458.804) (-458.068) (-459.777) [-459.980] -- 0:00:49
181500 -- (-458.316) [-458.866] (-459.493) (-457.782) * (-460.027) [-459.703] (-460.719) (-459.062) -- 0:00:49
182000 -- (-457.840) (-459.394) [-460.929] (-461.650) * (-463.488) [-457.732] (-458.354) (-459.929) -- 0:00:49
182500 -- (-457.763) [-460.726] (-461.379) (-458.235) * (-458.529) [-460.288] (-460.616) (-459.709) -- 0:00:49
183000 -- [-459.787] (-459.993) (-462.371) (-463.135) * (-458.688) (-461.515) (-461.183) [-462.224] -- 0:00:49
183500 -- (-460.461) (-462.204) [-459.946] (-458.214) * (-458.175) [-459.110] (-458.990) (-463.899) -- 0:00:48
184000 -- [-458.329] (-460.092) (-460.964) (-457.706) * (-458.146) (-459.711) (-459.626) [-460.032] -- 0:00:48
184500 -- (-460.428) [-459.348] (-460.428) (-459.894) * (-460.250) [-459.154] (-462.115) (-462.560) -- 0:00:48
185000 -- (-459.813) (-458.111) [-460.329] (-462.703) * [-461.402] (-459.170) (-458.715) (-461.185) -- 0:00:48
Average standard deviation of split frequencies: 0.018141
185500 -- [-459.977] (-460.007) (-460.479) (-461.705) * (-461.847) (-460.223) [-459.022] (-459.045) -- 0:00:48
186000 -- [-459.912] (-459.705) (-460.955) (-461.915) * (-459.849) (-459.986) (-460.657) [-461.250] -- 0:00:48
186500 -- (-458.692) (-460.343) (-458.859) [-463.328] * (-457.566) (-459.336) [-460.141] (-459.532) -- 0:00:47
187000 -- [-459.448] (-460.473) (-462.671) (-459.172) * (-459.535) (-459.844) (-458.756) [-459.119] -- 0:00:47
187500 -- (-459.271) (-462.642) [-457.543] (-463.132) * (-457.652) (-460.497) [-459.366] (-457.785) -- 0:00:47
188000 -- (-461.306) [-458.750] (-458.263) (-458.668) * (-457.870) (-459.089) (-458.470) [-457.532] -- 0:00:47
188500 -- (-467.116) (-460.553) (-458.292) [-460.057] * (-458.762) [-461.299] (-458.092) (-458.176) -- 0:00:47
189000 -- [-459.453] (-459.145) (-460.105) (-458.254) * (-458.623) (-460.336) [-458.068] (-457.839) -- 0:00:47
189500 -- (-459.094) [-462.125] (-458.521) (-458.062) * (-460.893) (-460.849) (-458.500) [-457.442] -- 0:00:51
190000 -- [-461.543] (-460.935) (-459.426) (-458.859) * (-459.336) (-460.213) (-457.629) [-459.208] -- 0:00:51
Average standard deviation of split frequencies: 0.017994
190500 -- (-465.017) (-469.715) (-461.061) [-462.375] * [-459.376] (-460.721) (-459.944) (-459.748) -- 0:00:50
191000 -- (-460.715) (-459.486) [-459.381] (-460.943) * (-458.941) (-458.949) [-460.255] (-459.662) -- 0:00:50
191500 -- (-465.627) (-460.584) (-458.169) [-460.719] * (-457.567) [-459.589] (-461.901) (-459.433) -- 0:00:50
192000 -- (-465.232) (-461.812) (-460.460) [-458.488] * (-459.865) (-461.928) (-458.596) [-459.384] -- 0:00:50
192500 -- (-459.685) (-459.705) (-458.834) [-459.883] * (-458.198) (-462.111) [-458.402] (-458.358) -- 0:00:50
193000 -- (-459.965) (-461.367) [-459.823] (-460.583) * [-459.678] (-462.904) (-460.461) (-458.110) -- 0:00:50
193500 -- [-461.913] (-463.759) (-458.807) (-461.300) * (-458.036) (-460.207) [-459.024] (-459.459) -- 0:00:50
194000 -- (-461.207) (-462.999) (-459.661) [-460.326] * (-459.797) [-462.506] (-460.277) (-459.034) -- 0:00:49
194500 -- [-460.137] (-460.454) (-460.658) (-461.738) * [-458.379] (-460.551) (-458.633) (-463.590) -- 0:00:49
195000 -- [-458.369] (-458.153) (-460.798) (-460.747) * (-458.440) [-458.359] (-460.263) (-460.360) -- 0:00:49
Average standard deviation of split frequencies: 0.016301
195500 -- (-459.773) [-462.182] (-460.391) (-462.819) * (-460.527) [-460.507] (-458.554) (-458.648) -- 0:00:49
196000 -- (-461.884) (-461.123) [-458.149] (-458.896) * (-458.621) (-461.182) (-458.549) [-457.410] -- 0:00:49
196500 -- (-459.075) [-460.579] (-462.030) (-460.184) * [-460.737] (-458.826) (-460.739) (-457.758) -- 0:00:49
197000 -- (-460.068) (-458.996) (-462.121) [-458.985] * (-461.276) (-460.842) [-471.565] (-460.750) -- 0:00:48
197500 -- (-458.758) (-457.545) (-461.018) [-459.083] * (-461.945) [-460.665] (-464.352) (-458.128) -- 0:00:48
198000 -- (-461.012) (-457.548) (-466.878) [-464.346] * [-459.605] (-462.868) (-459.465) (-458.146) -- 0:00:48
198500 -- (-462.761) (-458.180) [-459.319] (-458.092) * (-460.111) (-458.407) (-457.536) [-458.466] -- 0:00:48
199000 -- (-459.483) [-461.485] (-462.842) (-459.501) * (-460.628) (-466.386) [-458.868] (-460.108) -- 0:00:48
199500 -- [-461.156] (-462.610) (-462.251) (-463.597) * (-462.227) (-462.615) (-459.997) [-457.979] -- 0:00:48
200000 -- (-459.436) (-461.877) (-457.763) [-463.797] * (-458.934) (-462.509) (-463.498) [-457.742] -- 0:00:48
Average standard deviation of split frequencies: 0.016306
200500 -- [-459.704] (-459.990) (-458.594) (-458.267) * (-458.954) [-459.541] (-464.839) (-458.581) -- 0:00:47
201000 -- (-458.226) (-461.374) (-458.685) [-458.568] * (-459.175) (-458.686) [-464.568] (-460.063) -- 0:00:47
201500 -- (-457.794) (-457.937) [-459.814] (-459.081) * (-460.230) (-458.208) [-458.664] (-458.928) -- 0:00:47
202000 -- [-459.485] (-461.060) (-463.368) (-459.506) * (-459.320) (-460.130) (-459.588) [-458.536] -- 0:00:47
202500 -- (-461.353) (-458.426) (-458.556) [-459.269] * (-459.108) (-461.456) [-461.174] (-460.407) -- 0:00:47
203000 -- (-461.225) [-459.336] (-458.527) (-458.290) * (-459.423) [-459.804] (-458.130) (-458.912) -- 0:00:47
203500 -- (-460.604) (-459.385) [-458.727] (-458.354) * [-460.966] (-458.522) (-459.962) (-460.810) -- 0:00:46
204000 -- (-459.171) (-460.094) (-460.017) [-457.679] * [-459.670] (-460.785) (-458.595) (-458.079) -- 0:00:46
204500 -- [-459.243] (-460.560) (-462.196) (-458.241) * [-458.218] (-459.189) (-458.735) (-459.414) -- 0:00:46
205000 -- (-458.548) [-462.439] (-460.266) (-458.095) * (-459.478) (-458.500) [-460.094] (-460.715) -- 0:00:46
Average standard deviation of split frequencies: 0.016146
205500 -- (-460.598) (-459.427) (-461.670) [-459.514] * (-462.004) [-461.405] (-459.732) (-460.418) -- 0:00:46
206000 -- [-460.617] (-461.272) (-461.446) (-460.023) * [-461.294] (-461.466) (-458.923) (-460.897) -- 0:00:46
206500 -- (-460.241) (-458.876) (-461.208) [-459.448] * (-459.232) [-466.276] (-462.068) (-458.665) -- 0:00:49
207000 -- (-463.708) (-462.595) (-458.330) [-458.954] * (-459.993) (-461.769) (-463.083) [-459.801] -- 0:00:49
207500 -- (-461.395) [-458.760] (-457.966) (-459.218) * (-458.953) (-464.376) [-462.231] (-458.864) -- 0:00:49
208000 -- (-461.678) (-458.737) (-463.530) [-461.229] * [-460.160] (-461.997) (-460.596) (-458.209) -- 0:00:49
208500 -- (-460.794) (-461.699) [-459.232] (-459.364) * (-461.156) (-461.211) [-459.993] (-460.071) -- 0:00:49
209000 -- (-460.437) (-460.183) [-460.993] (-459.035) * [-458.410] (-459.295) (-458.976) (-458.190) -- 0:00:49
209500 -- [-459.316] (-458.886) (-458.364) (-458.710) * (-461.913) [-459.711] (-458.741) (-457.677) -- 0:00:49
210000 -- (-461.246) [-458.299] (-458.364) (-458.468) * (-459.430) [-459.312] (-459.552) (-461.855) -- 0:00:48
Average standard deviation of split frequencies: 0.015788
210500 -- (-459.707) (-461.036) [-459.546] (-459.490) * (-460.469) (-459.582) [-459.626] (-461.834) -- 0:00:48
211000 -- (-458.832) [-460.126] (-459.738) (-462.366) * (-460.954) (-458.758) (-459.511) [-461.811] -- 0:00:48
211500 -- (-458.009) (-461.555) (-459.462) [-458.546] * (-459.445) (-460.481) [-458.253] (-459.675) -- 0:00:48
212000 -- (-458.189) (-459.142) (-459.269) [-459.836] * (-459.432) (-459.726) (-459.739) [-459.932] -- 0:00:48
212500 -- (-461.778) [-458.743] (-461.626) (-457.706) * (-464.639) [-459.194] (-459.699) (-458.352) -- 0:00:48
213000 -- [-460.648] (-459.329) (-460.969) (-460.137) * [-459.262] (-458.244) (-461.770) (-460.995) -- 0:00:48
213500 -- [-459.000] (-458.781) (-462.120) (-458.279) * (-458.290) (-459.425) [-460.719] (-460.459) -- 0:00:47
214000 -- (-459.148) (-459.137) [-460.089] (-460.109) * (-459.661) (-459.553) (-460.307) [-462.992] -- 0:00:47
214500 -- (-462.635) (-462.054) (-462.782) [-460.950] * (-459.874) [-458.636] (-459.217) (-458.561) -- 0:00:47
215000 -- [-458.560] (-462.245) (-458.568) (-460.110) * (-461.873) [-458.406] (-461.488) (-460.961) -- 0:00:47
Average standard deviation of split frequencies: 0.015277
215500 -- (-458.950) (-459.807) [-461.301] (-460.743) * (-459.814) [-458.134] (-463.777) (-462.044) -- 0:00:47
216000 -- [-458.372] (-461.647) (-458.378) (-462.419) * [-458.216] (-459.627) (-459.260) (-459.209) -- 0:00:47
216500 -- [-460.913] (-460.999) (-458.598) (-463.268) * (-459.361) [-459.617] (-462.320) (-466.153) -- 0:00:47
217000 -- (-460.773) (-461.070) [-465.937] (-461.643) * [-458.726] (-460.037) (-458.098) (-466.613) -- 0:00:46
217500 -- (-457.649) [-464.906] (-460.608) (-459.406) * (-459.049) (-460.658) (-459.024) [-461.852] -- 0:00:46
218000 -- (-458.737) [-461.836] (-457.903) (-458.500) * (-460.633) [-459.730] (-460.491) (-461.071) -- 0:00:46
218500 -- (-458.201) [-458.406] (-458.541) (-460.785) * [-459.796] (-460.725) (-461.985) (-460.530) -- 0:00:46
219000 -- (-459.966) [-460.061] (-458.165) (-460.119) * [-459.472] (-461.639) (-463.464) (-460.076) -- 0:00:46
219500 -- (-458.204) (-458.372) [-458.710] (-462.476) * (-460.079) (-460.119) [-459.009] (-458.428) -- 0:00:46
220000 -- (-458.492) [-460.373] (-463.767) (-459.686) * (-458.816) (-458.708) [-461.473] (-458.295) -- 0:00:46
Average standard deviation of split frequencies: 0.014835
220500 -- [-458.019] (-462.544) (-458.504) (-460.558) * [-460.310] (-463.973) (-459.079) (-466.891) -- 0:00:45
221000 -- (-460.432) [-460.534] (-463.204) (-458.343) * (-460.610) [-459.282] (-459.167) (-467.329) -- 0:00:45
221500 -- (-457.552) [-459.349] (-457.989) (-459.917) * (-467.311) [-461.180] (-459.300) (-459.718) -- 0:00:45
222000 -- [-459.543] (-458.739) (-458.332) (-461.041) * (-460.240) [-458.962] (-462.273) (-458.631) -- 0:00:45
222500 -- (-459.347) (-460.732) (-459.439) [-459.652] * (-459.675) (-459.201) [-458.418] (-460.223) -- 0:00:45
223000 -- [-459.305] (-457.678) (-459.356) (-459.820) * (-462.380) (-460.987) [-460.903] (-459.793) -- 0:00:45
223500 -- (-460.372) (-460.042) (-458.385) [-460.572] * (-459.179) (-458.303) [-461.217] (-462.754) -- 0:00:48
224000 -- (-459.008) (-458.244) [-457.763] (-457.802) * [-458.485] (-461.042) (-460.579) (-463.469) -- 0:00:48
224500 -- [-461.867] (-459.400) (-459.259) (-459.044) * (-463.048) [-461.733] (-459.884) (-460.939) -- 0:00:48
225000 -- (-458.539) (-458.629) [-458.289] (-458.325) * (-463.959) [-458.909] (-460.664) (-460.862) -- 0:00:48
Average standard deviation of split frequencies: 0.014717
225500 -- (-462.369) [-459.555] (-463.043) (-461.332) * (-459.096) (-459.768) (-460.902) [-464.501] -- 0:00:48
226000 -- (-459.812) (-460.769) (-464.782) [-458.516] * (-463.387) (-460.273) [-460.758] (-458.965) -- 0:00:47
226500 -- (-459.181) (-463.369) [-465.031] (-460.413) * [-459.552] (-460.600) (-458.030) (-461.934) -- 0:00:47
227000 -- (-459.382) (-460.524) [-458.790] (-461.372) * (-458.585) (-467.641) [-457.974] (-468.427) -- 0:00:47
227500 -- [-458.455] (-461.629) (-458.121) (-460.931) * (-459.943) (-461.335) [-458.933] (-468.073) -- 0:00:47
228000 -- (-458.998) [-461.888] (-460.476) (-461.402) * [-459.733] (-460.427) (-459.856) (-459.146) -- 0:00:47
228500 -- [-459.175] (-461.673) (-462.746) (-465.110) * [-458.494] (-460.434) (-460.483) (-458.245) -- 0:00:47
229000 -- (-460.379) (-460.957) (-459.671) [-460.412] * [-458.817] (-464.374) (-458.343) (-458.245) -- 0:00:47
229500 -- (-461.558) (-459.705) (-458.668) [-461.774] * (-459.939) (-461.188) [-458.604] (-460.664) -- 0:00:47
230000 -- (-461.903) (-461.479) [-458.749] (-464.463) * (-458.608) (-457.877) [-458.519] (-458.469) -- 0:00:46
Average standard deviation of split frequencies: 0.014533
230500 -- (-462.444) [-460.287] (-459.965) (-458.853) * (-458.997) (-458.025) (-459.259) [-458.887] -- 0:00:46
231000 -- (-458.091) [-465.909] (-458.176) (-459.075) * [-458.512] (-458.161) (-457.555) (-459.670) -- 0:00:46
231500 -- (-461.268) [-463.729] (-457.979) (-458.813) * (-458.329) [-460.981] (-460.800) (-458.521) -- 0:00:46
232000 -- (-458.510) (-460.393) [-459.068] (-460.158) * (-458.904) (-464.643) [-461.341] (-458.202) -- 0:00:46
232500 -- (-458.675) (-460.360) [-461.614] (-460.319) * (-459.164) [-462.012] (-462.389) (-459.364) -- 0:00:46
233000 -- [-462.598] (-459.660) (-460.229) (-460.004) * (-458.291) (-459.200) (-461.501) [-459.692] -- 0:00:46
233500 -- [-460.685] (-458.384) (-463.270) (-459.303) * (-459.592) (-459.288) [-462.321] (-462.160) -- 0:00:45
234000 -- (-461.773) (-461.435) [-462.528] (-457.782) * (-458.965) [-461.813] (-466.549) (-457.683) -- 0:00:45
234500 -- [-459.606] (-460.628) (-459.189) (-460.027) * (-462.712) (-459.950) (-459.209) [-458.761] -- 0:00:45
235000 -- (-459.147) (-458.728) (-459.793) [-460.231] * [-460.023] (-458.474) (-460.449) (-460.406) -- 0:00:45
Average standard deviation of split frequencies: 0.013871
235500 -- (-460.633) (-459.574) (-458.792) [-460.778] * (-458.936) (-461.153) [-460.182] (-462.221) -- 0:00:45
236000 -- (-458.817) (-458.456) [-457.551] (-461.827) * (-458.994) (-460.206) (-459.389) [-460.044] -- 0:00:45
236500 -- (-460.631) (-458.890) (-461.834) [-458.649] * [-459.459] (-458.875) (-458.083) (-460.744) -- 0:00:45
237000 -- (-459.238) [-458.660] (-461.049) (-462.913) * (-458.347) [-460.082] (-460.474) (-459.312) -- 0:00:45
237500 -- (-459.261) [-458.119] (-458.879) (-458.958) * (-462.886) (-460.096) (-460.791) [-460.020] -- 0:00:44
238000 -- (-461.003) [-458.287] (-460.785) (-462.161) * [-460.616] (-458.528) (-458.598) (-459.198) -- 0:00:44
238500 -- (-457.733) (-463.193) [-459.603] (-457.741) * [-459.060] (-460.990) (-462.923) (-462.589) -- 0:00:44
239000 -- (-460.455) (-459.218) (-461.006) [-460.215] * [-461.336] (-458.620) (-461.822) (-459.524) -- 0:00:44
239500 -- (-458.329) [-458.288] (-459.618) (-461.904) * [-457.502] (-459.509) (-460.879) (-460.698) -- 0:00:44
240000 -- [-462.128] (-458.891) (-458.967) (-459.684) * (-461.035) [-458.675] (-459.509) (-461.559) -- 0:00:47
Average standard deviation of split frequencies: 0.012841
240500 -- (-461.581) [-461.655] (-458.218) (-460.516) * [-461.265] (-462.385) (-458.131) (-459.412) -- 0:00:47
241000 -- (-460.947) (-460.896) (-458.990) [-458.730] * (-460.622) (-458.488) [-459.592] (-458.469) -- 0:00:47
241500 -- (-460.447) (-461.230) (-464.042) [-459.002] * (-462.799) (-459.291) (-460.472) [-459.751] -- 0:00:47
242000 -- (-458.293) [-459.902] (-464.196) (-458.531) * [-458.935] (-458.828) (-462.898) (-457.760) -- 0:00:46
242500 -- [-459.740] (-459.752) (-460.471) (-460.295) * (-457.907) [-458.563] (-463.072) (-460.221) -- 0:00:46
243000 -- [-458.154] (-458.597) (-458.579) (-462.353) * (-465.343) (-457.812) (-458.353) [-458.018] -- 0:00:46
243500 -- (-459.103) [-460.098] (-462.828) (-460.574) * [-465.930] (-464.433) (-460.905) (-460.225) -- 0:00:46
244000 -- (-457.678) (-460.274) [-462.207] (-458.407) * (-459.730) [-459.169] (-464.417) (-460.277) -- 0:00:46
244500 -- (-458.630) (-457.851) [-460.486] (-458.292) * (-460.135) (-459.229) (-461.079) [-460.598] -- 0:00:46
245000 -- (-459.662) [-458.682] (-461.579) (-463.009) * [-458.696] (-461.857) (-460.630) (-458.646) -- 0:00:46
Average standard deviation of split frequencies: 0.012305
245500 -- (-459.468) [-460.439] (-458.554) (-458.939) * (-458.521) (-459.275) (-461.183) [-462.561] -- 0:00:46
246000 -- (-460.570) (-462.918) [-458.853] (-459.286) * (-460.741) (-460.124) (-458.478) [-457.512] -- 0:00:45
246500 -- (-458.614) (-461.734) [-457.947] (-459.849) * [-459.595] (-459.886) (-459.856) (-458.366) -- 0:00:45
247000 -- (-459.382) (-463.589) (-464.435) [-458.473] * (-461.899) [-462.417] (-461.535) (-459.209) -- 0:00:45
247500 -- (-459.095) (-459.107) (-463.141) [-458.336] * (-460.660) (-460.376) (-462.804) [-459.064] -- 0:00:45
248000 -- (-459.674) [-462.232] (-467.569) (-458.749) * (-465.803) [-464.600] (-460.423) (-459.288) -- 0:00:45
248500 -- [-460.408] (-460.239) (-459.905) (-458.631) * (-461.116) (-464.784) (-460.594) [-459.327] -- 0:00:45
249000 -- (-461.314) (-460.670) [-459.328] (-458.119) * (-458.666) (-458.479) [-457.966] (-463.953) -- 0:00:45
249500 -- (-463.391) [-458.739] (-460.575) (-461.338) * (-458.924) (-458.837) (-459.742) [-461.757] -- 0:00:45
250000 -- (-462.973) (-459.125) (-460.227) [-458.248] * (-460.522) [-458.461] (-458.724) (-460.094) -- 0:00:45
Average standard deviation of split frequencies: 0.012433
250500 -- (-458.580) (-459.190) (-461.220) [-458.068] * [-461.362] (-458.012) (-460.203) (-461.365) -- 0:00:44
251000 -- (-458.114) (-459.940) (-459.096) [-458.947] * (-460.366) [-457.820] (-461.357) (-460.926) -- 0:00:44
251500 -- (-458.149) [-459.826] (-462.819) (-458.739) * [-457.967] (-463.022) (-459.525) (-460.735) -- 0:00:44
252000 -- (-458.874) (-458.415) [-461.285] (-457.990) * (-460.816) (-464.801) (-459.364) [-457.636] -- 0:00:44
252500 -- (-458.750) (-460.547) (-465.128) [-458.779] * (-460.563) (-462.001) [-457.976] (-457.871) -- 0:00:44
253000 -- (-460.096) (-461.351) (-465.307) [-460.036] * (-459.666) [-459.930] (-460.131) (-458.888) -- 0:00:44
253500 -- (-458.873) [-459.264] (-458.412) (-461.544) * (-459.563) (-458.585) [-461.647] (-460.646) -- 0:00:44
254000 -- (-462.828) (-458.638) (-458.552) [-459.312] * [-459.010] (-457.994) (-461.680) (-462.433) -- 0:00:44
254500 -- [-458.946] (-458.962) (-461.010) (-458.613) * (-459.881) [-459.546] (-458.675) (-462.503) -- 0:00:43
255000 -- (-460.456) (-459.205) (-464.452) [-460.922] * [-460.805] (-458.531) (-458.647) (-462.255) -- 0:00:43
Average standard deviation of split frequencies: 0.011824
255500 -- (-459.256) [-461.013] (-458.572) (-459.654) * (-463.001) (-465.251) [-460.298] (-460.551) -- 0:00:43
256000 -- (-459.407) (-459.410) (-460.616) [-461.150] * (-462.511) (-458.911) [-459.474] (-459.015) -- 0:00:46
256500 -- (-463.450) [-460.013] (-458.735) (-462.280) * (-459.200) [-460.546] (-457.521) (-458.266) -- 0:00:46
257000 -- (-465.529) [-461.261] (-460.159) (-458.780) * [-458.232] (-461.541) (-458.658) (-461.010) -- 0:00:46
257500 -- (-460.121) (-459.174) (-465.837) [-459.680] * (-458.606) (-458.989) (-458.901) [-464.398] -- 0:00:46
258000 -- [-457.726] (-459.956) (-467.771) (-461.376) * (-459.500) (-461.749) (-459.541) [-461.581] -- 0:00:46
258500 -- (-459.055) (-461.539) (-462.426) [-458.750] * (-458.741) [-462.514] (-460.009) (-459.861) -- 0:00:45
259000 -- [-462.289] (-461.996) (-458.765) (-459.224) * [-457.537] (-460.046) (-461.516) (-464.392) -- 0:00:45
259500 -- (-460.551) (-459.995) (-459.654) [-459.307] * (-460.272) [-460.097] (-465.465) (-460.228) -- 0:00:45
260000 -- [-460.587] (-460.592) (-460.133) (-459.080) * (-459.404) [-462.359] (-462.850) (-459.248) -- 0:00:45
Average standard deviation of split frequencies: 0.010851
260500 -- (-461.752) (-458.397) [-458.085] (-459.049) * [-460.858] (-460.679) (-458.173) (-465.801) -- 0:00:45
261000 -- (-459.358) (-458.667) [-461.481] (-464.500) * (-459.824) (-459.927) [-459.213] (-459.180) -- 0:00:45
261500 -- (-458.474) (-458.364) [-457.764] (-461.887) * (-460.880) (-460.659) (-461.300) [-461.381] -- 0:00:45
262000 -- (-460.803) (-458.738) (-458.593) [-458.239] * (-462.043) [-459.433] (-458.707) (-461.057) -- 0:00:45
262500 -- [-458.432] (-460.406) (-460.341) (-461.760) * (-464.479) [-460.105] (-457.689) (-463.019) -- 0:00:44
263000 -- (-459.517) (-459.449) [-459.597] (-458.826) * (-459.352) (-459.978) (-458.091) [-459.354] -- 0:00:44
263500 -- (-461.791) (-459.343) [-459.811] (-458.863) * (-458.506) [-459.687] (-460.226) (-458.539) -- 0:00:44
264000 -- (-464.517) (-462.204) [-459.161] (-458.056) * (-458.577) (-464.510) [-458.685] (-460.014) -- 0:00:44
264500 -- [-466.939] (-461.298) (-460.331) (-461.752) * (-458.145) (-459.637) (-461.075) [-460.704] -- 0:00:44
265000 -- [-461.361] (-460.243) (-459.624) (-457.790) * (-462.027) [-457.568] (-462.347) (-460.467) -- 0:00:44
Average standard deviation of split frequencies: 0.010425
265500 -- (-460.444) [-459.758] (-458.278) (-458.070) * (-459.415) (-457.890) [-459.849] (-458.345) -- 0:00:44
266000 -- (-459.559) (-459.386) (-461.761) [-458.742] * [-459.572] (-461.737) (-460.737) (-463.442) -- 0:00:44
266500 -- (-459.012) (-458.733) (-461.065) [-459.212] * (-459.271) (-462.446) [-460.879] (-462.629) -- 0:00:44
267000 -- [-459.142] (-460.342) (-461.535) (-464.050) * (-458.421) [-460.294] (-464.811) (-461.421) -- 0:00:43
267500 -- (-459.958) [-459.196] (-458.381) (-458.564) * (-463.859) (-458.075) (-465.906) [-461.884] -- 0:00:43
268000 -- (-460.302) [-458.649] (-459.773) (-458.148) * (-460.602) [-458.769] (-462.714) (-460.206) -- 0:00:43
268500 -- (-458.973) (-458.889) (-461.534) [-458.035] * [-459.039] (-459.118) (-460.413) (-460.160) -- 0:00:43
269000 -- [-458.465] (-460.714) (-459.258) (-461.503) * (-458.794) [-459.629] (-459.647) (-468.595) -- 0:00:43
269500 -- (-461.404) (-460.501) (-459.969) [-461.003] * (-461.043) (-459.844) (-463.457) [-460.575] -- 0:00:43
270000 -- (-459.639) [-458.618] (-461.753) (-459.311) * (-460.020) (-458.936) (-461.709) [-457.535] -- 0:00:43
Average standard deviation of split frequencies: 0.010552
270500 -- (-460.598) (-458.298) [-462.844] (-459.063) * (-458.805) (-459.328) [-462.344] (-458.112) -- 0:00:43
271000 -- (-461.831) (-457.695) [-459.562] (-459.658) * (-458.767) [-460.293] (-460.456) (-458.602) -- 0:00:43
271500 -- [-460.098] (-459.129) (-459.539) (-461.254) * (-457.642) (-467.170) (-458.956) [-460.288] -- 0:00:42
272000 -- (-460.489) (-459.787) [-459.768] (-461.644) * (-459.689) (-460.884) (-459.516) [-458.217] -- 0:00:45
272500 -- (-464.941) [-458.224] (-459.328) (-458.683) * (-459.690) (-464.340) [-462.222] (-462.015) -- 0:00:45
273000 -- (-460.307) (-460.131) (-461.755) [-458.592] * [-459.266] (-463.649) (-458.682) (-459.768) -- 0:00:45
273500 -- (-466.102) [-458.741] (-463.509) (-457.731) * [-462.559] (-459.000) (-458.802) (-459.197) -- 0:00:45
274000 -- (-467.746) (-460.159) (-460.776) [-458.840] * (-461.810) [-458.947] (-461.227) (-460.720) -- 0:00:45
274500 -- (-460.743) (-458.439) (-461.776) [-458.745] * [-461.570] (-459.764) (-458.047) (-460.311) -- 0:00:44
275000 -- [-459.348] (-459.159) (-461.194) (-459.013) * (-458.656) (-461.297) (-464.523) [-459.317] -- 0:00:44
Average standard deviation of split frequencies: 0.010449
275500 -- (-458.615) (-460.024) (-461.516) [-458.801] * [-460.014] (-458.555) (-461.781) (-461.443) -- 0:00:44
276000 -- [-458.856] (-457.739) (-460.238) (-459.564) * (-458.040) (-459.012) [-458.849] (-460.577) -- 0:00:44
276500 -- [-464.371] (-458.765) (-459.413) (-459.800) * (-461.580) (-459.300) [-458.812] (-461.262) -- 0:00:44
277000 -- (-458.861) [-461.673] (-458.583) (-461.459) * [-459.988] (-460.384) (-457.913) (-463.311) -- 0:00:44
277500 -- (-459.190) [-458.578] (-458.147) (-458.974) * (-460.357) [-458.664] (-459.759) (-460.335) -- 0:00:44
278000 -- [-458.211] (-460.684) (-457.977) (-457.887) * [-461.968] (-458.802) (-457.692) (-458.040) -- 0:00:44
278500 -- (-463.992) (-460.390) [-457.894] (-459.692) * (-459.454) [-457.620] (-458.343) (-462.414) -- 0:00:44
279000 -- (-458.261) (-461.510) (-459.858) [-457.926] * (-458.862) (-457.833) (-461.011) [-458.300] -- 0:00:43
279500 -- (-458.725) (-458.257) (-459.283) [-457.984] * (-463.030) (-458.491) [-460.803] (-459.590) -- 0:00:43
280000 -- (-462.372) (-462.248) [-458.708] (-459.886) * (-460.519) (-460.186) [-458.639] (-457.751) -- 0:00:43
Average standard deviation of split frequencies: 0.008793
280500 -- [-462.503] (-458.510) (-462.635) (-460.586) * (-459.791) (-461.635) [-460.834] (-459.445) -- 0:00:43
281000 -- (-464.218) (-462.834) (-460.120) [-460.766] * (-459.828) (-458.316) (-458.619) [-459.827] -- 0:00:43
281500 -- (-459.451) (-468.006) [-462.916] (-463.269) * (-463.301) [-464.015] (-458.556) (-457.872) -- 0:00:43
282000 -- (-466.725) [-461.414] (-462.429) (-458.735) * [-458.687] (-463.045) (-457.888) (-460.141) -- 0:00:43
282500 -- (-464.455) (-460.887) (-461.777) [-459.894] * (-458.576) [-460.808] (-460.199) (-461.656) -- 0:00:43
283000 -- [-461.107] (-462.747) (-459.351) (-459.729) * (-460.321) (-459.075) [-457.814] (-459.061) -- 0:00:43
283500 -- (-458.939) (-462.076) (-459.255) [-459.919] * (-461.160) (-457.802) [-459.119] (-464.455) -- 0:00:42
284000 -- [-463.356] (-469.629) (-459.990) (-461.246) * (-459.850) (-458.204) [-459.110] (-461.324) -- 0:00:42
284500 -- (-463.555) (-465.804) [-458.995] (-459.178) * [-460.368] (-458.666) (-457.866) (-458.419) -- 0:00:42
285000 -- (-461.670) (-461.549) [-460.358] (-459.496) * (-461.321) (-458.816) (-463.872) [-460.734] -- 0:00:42
Average standard deviation of split frequencies: 0.009696
285500 -- [-458.825] (-461.364) (-460.716) (-460.558) * [-459.114] (-457.888) (-462.517) (-461.928) -- 0:00:42
286000 -- (-460.372) (-460.787) (-458.879) [-461.556] * (-459.893) (-457.929) [-462.171] (-459.443) -- 0:00:42
286500 -- (-459.820) [-459.635] (-458.268) (-458.539) * (-460.180) (-458.528) [-458.626] (-458.522) -- 0:00:44
287000 -- [-459.483] (-459.348) (-458.551) (-459.164) * [-462.128] (-463.523) (-461.838) (-462.332) -- 0:00:44
287500 -- (-463.121) [-461.258] (-458.186) (-458.907) * (-459.159) (-461.249) (-458.568) [-463.757] -- 0:00:44
288000 -- (-461.094) [-458.967] (-462.403) (-460.621) * [-462.114] (-459.631) (-458.318) (-463.933) -- 0:00:44
288500 -- (-459.704) (-459.303) (-461.302) [-458.461] * (-460.239) (-459.788) (-460.300) [-459.878] -- 0:00:44
289000 -- (-459.651) (-459.383) [-459.728] (-462.718) * (-459.379) (-467.001) (-461.071) [-459.111] -- 0:00:44
289500 -- (-457.568) [-459.417] (-460.740) (-459.777) * (-461.838) (-457.902) [-461.537] (-458.521) -- 0:00:44
290000 -- (-458.430) (-458.348) (-460.971) [-462.248] * (-460.238) [-457.351] (-458.130) (-458.361) -- 0:00:44
Average standard deviation of split frequencies: 0.009635
290500 -- (-459.731) (-462.403) (-461.003) [-459.239] * (-459.509) (-457.363) (-458.059) [-459.150] -- 0:00:43
291000 -- (-459.549) [-462.038] (-463.691) (-458.160) * (-460.065) (-458.619) [-458.697] (-460.253) -- 0:00:43
291500 -- (-459.840) [-457.579] (-459.330) (-459.092) * [-457.568] (-458.636) (-460.210) (-458.332) -- 0:00:43
292000 -- [-458.191] (-459.232) (-459.816) (-459.089) * (-458.307) (-457.437) (-459.033) [-460.518] -- 0:00:43
292500 -- (-459.528) (-461.044) (-459.117) [-459.013] * (-460.089) (-460.089) (-462.316) [-458.009] -- 0:00:43
293000 -- (-461.468) [-463.255] (-458.156) (-458.959) * [-460.833] (-457.932) (-458.575) (-461.147) -- 0:00:43
293500 -- (-463.049) (-458.168) (-458.362) [-458.367] * (-459.514) [-458.071] (-461.277) (-464.893) -- 0:00:43
294000 -- [-458.443] (-458.422) (-459.195) (-458.878) * (-465.880) [-463.357] (-458.486) (-460.745) -- 0:00:43
294500 -- [-458.986] (-461.289) (-459.319) (-462.794) * [-463.074] (-463.389) (-458.054) (-461.899) -- 0:00:43
295000 -- (-458.104) (-461.412) (-458.108) [-458.559] * (-464.561) (-461.666) [-458.634] (-459.720) -- 0:00:43
Average standard deviation of split frequencies: 0.010706
295500 -- [-461.596] (-459.111) (-460.925) (-457.684) * (-460.709) (-459.110) [-458.289] (-465.170) -- 0:00:42
296000 -- [-461.551] (-459.218) (-458.936) (-459.770) * (-458.794) (-458.652) (-458.922) [-460.155] -- 0:00:42
296500 -- (-461.147) (-459.414) [-458.306] (-458.732) * (-458.290) (-459.084) [-459.117] (-458.307) -- 0:00:42
297000 -- (-465.255) (-459.332) (-459.629) [-459.267] * (-463.672) (-458.423) (-460.452) [-460.077] -- 0:00:42
297500 -- (-462.591) (-459.095) (-459.307) [-461.135] * (-461.934) (-459.171) [-460.774] (-458.321) -- 0:00:42
298000 -- (-460.142) [-461.250] (-459.852) (-461.430) * (-459.962) (-459.654) (-460.406) [-458.880] -- 0:00:42
298500 -- (-460.712) (-458.667) (-458.600) [-459.636] * (-461.057) (-460.841) [-459.308] (-459.230) -- 0:00:42
299000 -- [-459.876] (-459.967) (-458.277) (-458.894) * (-458.738) (-458.916) (-460.938) [-458.394] -- 0:00:42
299500 -- (-458.264) [-464.054] (-458.620) (-458.082) * (-462.640) (-463.905) [-460.086] (-459.226) -- 0:00:44
300000 -- (-459.926) (-458.161) [-460.087] (-458.934) * (-460.395) [-457.856] (-460.610) (-460.911) -- 0:00:44
Average standard deviation of split frequencies: 0.010540
300500 -- (-458.367) (-461.865) [-460.249] (-460.996) * [-459.980] (-462.196) (-461.799) (-460.757) -- 0:00:44
301000 -- (-458.122) [-460.286] (-458.911) (-458.749) * (-460.710) [-459.864] (-462.618) (-458.647) -- 0:00:44
301500 -- (-457.819) (-459.985) (-459.505) [-463.402] * (-459.489) [-465.361] (-461.325) (-460.237) -- 0:00:44
302000 -- (-461.122) [-458.241] (-462.053) (-460.451) * (-458.281) [-458.104] (-461.551) (-463.279) -- 0:00:43
302500 -- (-458.018) [-458.648] (-461.353) (-459.797) * [-458.932] (-458.132) (-463.348) (-464.587) -- 0:00:43
303000 -- (-458.575) [-459.335] (-464.096) (-458.856) * (-459.527) [-458.941] (-461.889) (-457.909) -- 0:00:43
303500 -- (-460.137) (-459.529) [-460.285] (-458.783) * (-459.439) (-458.448) (-461.239) [-459.732] -- 0:00:43
304000 -- [-459.962] (-458.741) (-462.435) (-458.461) * (-461.328) (-462.734) (-461.650) [-460.515] -- 0:00:43
304500 -- (-462.789) [-460.802] (-462.488) (-458.637) * (-462.095) (-461.006) [-460.526] (-463.298) -- 0:00:43
305000 -- [-460.884] (-458.777) (-463.024) (-461.457) * (-464.696) [-459.681] (-461.840) (-462.571) -- 0:00:43
Average standard deviation of split frequencies: 0.012863
305500 -- (-459.694) (-458.330) (-462.532) [-460.167] * (-462.914) (-460.167) (-462.108) [-458.405] -- 0:00:43
306000 -- (-464.937) [-459.250] (-460.477) (-458.292) * (-468.518) (-463.137) [-459.868] (-460.775) -- 0:00:43
306500 -- (-458.011) (-458.903) (-459.853) [-459.470] * (-464.877) (-462.415) [-460.504] (-460.496) -- 0:00:42
307000 -- (-458.453) (-458.366) [-459.967] (-458.003) * (-464.689) [-458.292] (-458.879) (-465.437) -- 0:00:42
307500 -- (-460.117) (-462.647) (-460.754) [-461.058] * (-461.812) (-459.965) (-459.463) [-459.989] -- 0:00:42
308000 -- (-461.507) (-464.551) [-459.950] (-459.116) * [-462.089] (-459.979) (-460.980) (-458.726) -- 0:00:42
308500 -- (-459.575) (-459.533) (-461.483) [-460.680] * (-459.828) (-457.864) [-458.897] (-459.265) -- 0:00:42
309000 -- (-461.775) [-465.149] (-461.664) (-462.794) * (-459.373) [-458.462] (-459.563) (-461.185) -- 0:00:42
309500 -- [-459.859] (-458.930) (-459.709) (-463.143) * (-462.121) (-459.258) [-461.420] (-460.715) -- 0:00:42
310000 -- (-463.814) (-460.822) (-458.374) [-459.540] * (-463.088) [-460.890] (-458.978) (-460.432) -- 0:00:42
Average standard deviation of split frequencies: 0.012822
310500 -- (-459.112) [-459.136] (-461.756) (-458.129) * (-464.384) (-457.969) [-461.409] (-459.435) -- 0:00:42
311000 -- [-459.547] (-460.425) (-460.412) (-461.953) * (-464.065) (-458.851) [-460.427] (-460.512) -- 0:00:42
311500 -- (-457.991) [-457.985] (-458.059) (-457.731) * (-458.831) [-457.990] (-459.701) (-460.301) -- 0:00:41
312000 -- [-458.746] (-458.383) (-460.195) (-459.100) * (-458.094) (-460.721) (-460.191) [-460.761] -- 0:00:41
312500 -- (-459.502) [-460.044] (-461.376) (-460.120) * [-459.629] (-460.875) (-460.669) (-458.374) -- 0:00:41
313000 -- (-457.605) [-458.735] (-459.825) (-459.148) * (-460.849) (-462.784) [-457.842] (-459.597) -- 0:00:41
313500 -- (-457.660) (-458.919) [-458.162] (-459.390) * (-458.316) (-462.910) [-459.558] (-464.504) -- 0:00:41
314000 -- (-459.786) [-462.521] (-457.693) (-461.866) * (-458.926) (-457.694) [-458.130] (-460.110) -- 0:00:41
314500 -- (-459.759) (-459.358) (-459.063) [-461.685] * (-461.126) (-458.998) [-458.297] (-459.771) -- 0:00:43
315000 -- (-459.375) [-461.137] (-459.587) (-461.905) * (-460.284) (-459.703) [-459.825] (-462.443) -- 0:00:43
Average standard deviation of split frequencies: 0.012017
315500 -- (-458.089) (-459.056) (-461.158) [-460.973] * [-459.996] (-461.088) (-460.280) (-460.246) -- 0:00:43
316000 -- (-458.917) (-458.095) (-459.786) [-460.089] * (-464.237) (-458.660) (-458.037) [-458.356] -- 0:00:43
316500 -- (-459.371) (-459.236) [-460.792] (-458.403) * [-460.263] (-459.439) (-459.107) (-460.317) -- 0:00:43
317000 -- (-464.292) (-459.800) [-460.008] (-465.235) * (-460.649) (-458.526) (-460.662) [-458.060] -- 0:00:43
317500 -- [-460.579] (-460.933) (-459.939) (-459.755) * (-459.898) (-458.863) [-459.684] (-459.044) -- 0:00:42
318000 -- (-459.016) (-458.818) (-461.480) [-459.570] * (-462.019) (-461.764) (-461.608) [-458.898] -- 0:00:42
318500 -- (-459.199) [-459.238] (-458.997) (-458.320) * (-459.370) [-458.203] (-460.717) (-460.054) -- 0:00:42
319000 -- (-461.688) [-461.096] (-463.284) (-458.377) * (-460.184) (-458.800) (-459.985) [-458.932] -- 0:00:42
319500 -- (-461.400) (-461.465) (-460.509) [-459.910] * (-463.238) (-458.805) (-459.270) [-459.302] -- 0:00:42
320000 -- (-461.351) (-461.416) [-459.689] (-458.569) * (-460.957) (-457.704) (-463.059) [-460.121] -- 0:00:42
Average standard deviation of split frequencies: 0.012380
320500 -- [-458.561] (-463.177) (-459.166) (-458.170) * (-458.381) (-458.084) [-458.652] (-459.340) -- 0:00:42
321000 -- (-459.582) (-457.771) [-459.026] (-459.276) * (-459.185) [-457.562] (-461.603) (-459.312) -- 0:00:42
321500 -- (-459.752) (-466.047) [-462.372] (-460.713) * (-464.466) [-460.556] (-458.488) (-463.987) -- 0:00:42
322000 -- (-463.371) (-460.429) (-461.163) [-460.437] * (-458.477) [-459.001] (-459.940) (-458.627) -- 0:00:42
322500 -- (-458.535) [-459.300] (-459.585) (-462.240) * (-458.821) (-462.069) (-460.438) [-462.673] -- 0:00:42
323000 -- (-459.136) (-459.893) [-463.425] (-460.554) * (-458.170) (-459.632) [-463.357] (-462.164) -- 0:00:41
323500 -- [-459.590] (-460.320) (-458.629) (-458.183) * (-459.078) (-458.648) [-458.725] (-463.674) -- 0:00:41
324000 -- (-458.543) [-458.582] (-459.061) (-460.042) * (-458.281) (-459.330) (-458.950) [-461.505] -- 0:00:41
324500 -- [-459.699] (-459.717) (-458.713) (-460.054) * (-457.742) [-458.714] (-458.679) (-460.547) -- 0:00:41
325000 -- (-461.466) (-459.272) [-459.184] (-462.366) * (-459.129) [-460.483] (-461.301) (-458.834) -- 0:00:41
Average standard deviation of split frequencies: 0.012177
325500 -- (-462.446) [-459.596] (-459.257) (-461.548) * (-460.108) (-459.987) [-461.133] (-461.867) -- 0:00:41
326000 -- (-459.604) (-463.902) (-458.323) [-461.887] * [-459.674] (-459.043) (-459.636) (-459.880) -- 0:00:41
326500 -- (-459.057) (-464.751) [-458.777] (-460.192) * (-462.688) [-462.286] (-460.576) (-458.743) -- 0:00:41
327000 -- [-460.505] (-465.604) (-459.954) (-459.650) * [-459.634] (-463.707) (-461.244) (-459.839) -- 0:00:41
327500 -- (-461.535) (-460.653) [-460.425] (-459.327) * (-468.799) (-464.404) [-461.877] (-458.810) -- 0:00:41
328000 -- (-462.498) (-461.532) (-460.720) [-460.444] * (-458.131) (-466.312) (-460.439) [-461.029] -- 0:00:40
328500 -- (-460.870) (-460.465) [-462.714] (-460.264) * (-458.784) [-464.852] (-459.679) (-458.792) -- 0:00:40
329000 -- (-460.712) (-457.915) (-459.051) [-459.994] * (-458.451) [-460.619] (-458.181) (-458.751) -- 0:00:42
329500 -- (-459.330) (-462.499) [-459.466] (-458.694) * (-460.585) (-460.559) [-457.998] (-458.704) -- 0:00:42
330000 -- (-458.956) [-463.497] (-461.098) (-458.605) * (-460.878) [-461.216] (-459.468) (-458.803) -- 0:00:42
Average standard deviation of split frequencies: 0.012230
330500 -- (-458.175) [-458.763] (-459.339) (-460.332) * (-459.380) (-466.441) [-462.150] (-460.027) -- 0:00:42
331000 -- [-459.830] (-460.656) (-462.342) (-459.544) * (-457.578) (-462.736) [-460.626] (-459.662) -- 0:00:42
331500 -- (-459.888) [-459.287] (-458.576) (-459.070) * (-457.497) (-459.306) (-458.535) [-460.219] -- 0:00:42
332000 -- (-461.692) (-460.272) (-460.068) [-460.740] * (-458.819) (-463.539) [-458.308] (-458.500) -- 0:00:42
332500 -- (-459.900) [-458.908] (-458.842) (-458.519) * [-458.747] (-459.388) (-458.208) (-459.152) -- 0:00:42
333000 -- (-460.210) (-458.780) [-462.489] (-466.672) * (-458.251) [-459.380] (-458.486) (-458.928) -- 0:00:42
333500 -- (-461.921) (-458.111) (-465.287) [-459.905] * (-462.797) (-462.328) (-459.016) [-458.739] -- 0:00:41
334000 -- (-459.039) (-460.742) (-464.129) [-459.259] * (-457.957) [-461.024] (-457.591) (-461.770) -- 0:00:41
334500 -- (-459.427) [-459.786] (-462.391) (-459.350) * [-458.703] (-460.021) (-459.679) (-461.424) -- 0:00:41
335000 -- [-458.452] (-459.295) (-459.470) (-460.537) * (-461.497) (-458.360) [-458.085] (-459.356) -- 0:00:41
Average standard deviation of split frequencies: 0.012159
335500 -- (-458.881) [-459.690] (-461.375) (-457.945) * (-460.121) [-457.456] (-460.635) (-459.054) -- 0:00:41
336000 -- (-458.894) [-460.555] (-459.131) (-462.311) * [-459.443] (-458.970) (-457.769) (-459.267) -- 0:00:41
336500 -- (-460.699) [-459.756] (-458.650) (-465.560) * (-463.803) [-459.043] (-458.356) (-459.152) -- 0:00:41
337000 -- (-458.851) [-461.350] (-461.633) (-459.268) * (-462.885) (-459.606) (-457.529) [-460.635] -- 0:00:41
337500 -- (-457.759) (-462.407) [-461.046] (-458.154) * (-460.511) (-463.113) [-461.072] (-461.229) -- 0:00:41
338000 -- [-460.657] (-463.361) (-468.557) (-460.329) * [-461.029] (-462.989) (-462.860) (-461.188) -- 0:00:41
338500 -- [-459.738] (-458.620) (-463.580) (-461.887) * (-461.459) (-462.952) (-462.693) [-464.658] -- 0:00:41
339000 -- [-460.132] (-459.381) (-464.362) (-464.029) * (-460.662) (-459.410) (-463.313) [-461.001] -- 0:00:40
339500 -- (-462.580) [-459.456] (-462.303) (-461.683) * [-459.509] (-459.730) (-459.309) (-459.375) -- 0:00:40
340000 -- (-460.352) [-459.770] (-459.308) (-459.976) * [-460.302] (-460.224) (-463.255) (-460.484) -- 0:00:40
Average standard deviation of split frequencies: 0.011966
340500 -- (-460.657) (-460.824) [-458.368] (-458.765) * (-461.155) (-458.512) (-459.408) [-460.072] -- 0:00:40
341000 -- (-458.239) (-457.694) (-459.065) [-460.326] * [-459.481] (-458.610) (-462.316) (-460.576) -- 0:00:40
341500 -- (-459.167) (-459.203) (-459.984) [-458.215] * (-459.295) (-461.337) (-459.241) [-461.934] -- 0:00:40
342000 -- [-460.462] (-458.542) (-459.935) (-459.544) * [-458.483] (-464.041) (-459.929) (-462.677) -- 0:00:40
342500 -- (-458.331) (-462.331) (-458.826) [-460.912] * (-459.781) (-463.642) [-459.156] (-458.711) -- 0:00:42
343000 -- [-459.666] (-460.552) (-459.037) (-459.227) * (-460.334) (-461.809) (-458.924) [-461.411] -- 0:00:42
343500 -- (-461.252) [-459.814] (-459.545) (-460.315) * (-460.025) (-462.044) (-460.070) [-459.287] -- 0:00:42
344000 -- (-461.714) (-459.779) (-459.860) [-460.348] * (-462.883) (-458.119) [-460.361] (-459.475) -- 0:00:41
344500 -- (-460.682) [-459.088] (-459.780) (-458.935) * (-462.070) (-463.881) [-459.554] (-459.806) -- 0:00:41
345000 -- (-461.271) (-457.679) [-464.686] (-461.521) * (-457.859) (-460.367) (-459.988) [-459.108] -- 0:00:41
Average standard deviation of split frequencies: 0.012489
345500 -- (-458.528) [-457.960] (-462.484) (-459.122) * (-458.663) [-458.923] (-460.184) (-460.958) -- 0:00:41
346000 -- (-461.134) [-459.935] (-457.843) (-458.517) * (-461.387) [-459.495] (-460.125) (-462.748) -- 0:00:41
346500 -- [-459.544] (-460.996) (-463.851) (-461.003) * [-460.594] (-458.801) (-459.304) (-461.224) -- 0:00:41
347000 -- [-459.779] (-458.905) (-459.628) (-459.886) * (-460.957) (-460.981) (-458.604) [-460.103] -- 0:00:41
347500 -- (-458.737) (-464.781) (-461.450) [-460.949] * (-459.012) [-458.383] (-459.729) (-461.175) -- 0:00:41
348000 -- (-460.582) (-460.234) (-461.188) [-459.347] * (-458.733) (-461.141) (-459.372) [-460.005] -- 0:00:41
348500 -- [-459.669] (-459.748) (-459.578) (-460.968) * (-459.373) [-464.333] (-459.125) (-460.383) -- 0:00:41
349000 -- (-458.867) (-462.634) [-459.794] (-460.171) * (-460.302) (-459.592) [-460.738] (-459.069) -- 0:00:41
349500 -- [-461.059] (-460.177) (-458.772) (-458.321) * [-457.797] (-461.585) (-459.100) (-459.382) -- 0:00:40
350000 -- [-458.870] (-460.623) (-459.855) (-457.838) * (-457.860) (-458.448) [-460.239] (-461.842) -- 0:00:40
Average standard deviation of split frequencies: 0.013206
350500 -- (-460.908) (-458.947) (-462.056) [-458.854] * (-457.804) [-458.424] (-458.683) (-461.843) -- 0:00:40
351000 -- [-460.664] (-460.954) (-459.300) (-457.918) * (-457.992) (-461.241) [-458.684] (-458.796) -- 0:00:40
351500 -- [-460.065] (-459.368) (-461.307) (-460.176) * [-458.681] (-463.293) (-459.299) (-459.514) -- 0:00:40
352000 -- (-457.937) [-459.649] (-457.939) (-463.270) * (-460.397) [-459.741] (-458.128) (-462.957) -- 0:00:40
352500 -- (-460.957) (-459.063) (-459.052) [-458.897] * [-459.403] (-467.324) (-459.702) (-460.163) -- 0:00:40
353000 -- (-459.224) [-458.236] (-457.879) (-461.889) * (-459.559) (-461.618) [-460.463] (-463.600) -- 0:00:40
353500 -- (-461.971) (-458.933) (-459.375) [-458.294] * [-459.358] (-459.916) (-459.189) (-462.269) -- 0:00:40
354000 -- (-461.126) (-460.541) (-459.803) [-462.236] * (-460.878) (-460.383) [-458.993] (-463.251) -- 0:00:40
354500 -- (-461.874) (-458.283) [-462.181] (-461.756) * (-459.925) (-463.197) [-459.035] (-463.327) -- 0:00:40
355000 -- [-459.592] (-461.864) (-468.548) (-462.699) * [-460.609] (-459.357) (-457.717) (-461.233) -- 0:00:39
Average standard deviation of split frequencies: 0.012497
355500 -- (-460.033) (-465.476) [-458.277] (-461.643) * (-457.844) (-460.648) (-460.450) [-460.374] -- 0:00:39
356000 -- [-460.790] (-460.678) (-461.843) (-460.513) * [-458.828] (-461.189) (-459.065) (-464.732) -- 0:00:39
356500 -- (-461.137) [-457.801] (-459.255) (-458.411) * (-458.746) (-459.037) (-461.564) [-460.613] -- 0:00:41
357000 -- (-459.401) [-458.380] (-459.392) (-458.860) * (-460.104) (-460.892) [-458.941] (-461.025) -- 0:00:41
357500 -- (-461.556) (-457.571) (-460.493) [-459.880] * (-459.135) (-458.316) [-459.580] (-461.250) -- 0:00:41
358000 -- (-464.512) (-460.556) (-461.005) [-458.491] * (-459.770) (-459.707) (-458.066) [-461.850] -- 0:00:41
358500 -- (-457.463) (-459.109) (-460.830) [-458.283] * (-463.550) (-461.864) [-457.382] (-462.736) -- 0:00:41
359000 -- (-459.365) (-460.995) [-460.370] (-461.937) * (-458.529) (-458.767) [-458.624] (-463.098) -- 0:00:41
359500 -- (-460.006) (-459.233) (-458.111) [-461.212] * (-461.231) [-460.391] (-458.704) (-467.312) -- 0:00:40
360000 -- (-465.223) [-458.715] (-458.024) (-463.289) * [-460.795] (-461.563) (-457.826) (-463.113) -- 0:00:40
Average standard deviation of split frequencies: 0.011763
360500 -- [-464.007] (-465.549) (-458.692) (-463.474) * (-461.895) (-459.561) [-458.572] (-459.551) -- 0:00:40
361000 -- [-457.900] (-467.003) (-459.106) (-462.207) * [-458.979] (-460.236) (-461.652) (-462.333) -- 0:00:40
361500 -- (-461.020) (-461.596) [-459.361] (-457.956) * [-458.505] (-458.300) (-459.742) (-459.249) -- 0:00:40
362000 -- (-460.466) [-458.894] (-463.222) (-461.617) * (-463.278) (-460.676) [-460.222] (-459.737) -- 0:00:40
362500 -- [-461.555] (-462.820) (-463.024) (-459.268) * (-461.391) (-460.840) (-457.643) [-459.892] -- 0:00:40
363000 -- (-458.614) [-460.968] (-458.440) (-458.862) * [-457.764] (-461.299) (-458.283) (-461.782) -- 0:00:40
363500 -- (-458.694) [-459.865] (-458.586) (-460.182) * (-459.553) [-458.858] (-458.660) (-458.426) -- 0:00:40
364000 -- [-458.943] (-461.190) (-459.016) (-460.418) * (-460.094) (-463.549) (-460.166) [-460.365] -- 0:00:40
364500 -- (-459.549) (-458.529) (-458.213) [-460.509] * (-459.161) [-459.523] (-458.059) (-460.576) -- 0:00:40
365000 -- (-459.226) (-459.967) [-458.815] (-459.805) * (-459.022) (-459.855) [-460.278] (-458.644) -- 0:00:40
Average standard deviation of split frequencies: 0.011743
365500 -- (-465.598) (-459.494) [-459.217] (-460.095) * (-461.129) (-458.911) [-460.874] (-457.965) -- 0:00:39
366000 -- (-460.558) (-461.080) [-465.255] (-460.486) * (-459.311) (-459.056) [-459.877] (-457.761) -- 0:00:39
366500 -- (-460.026) (-458.822) [-461.869] (-459.879) * (-459.436) [-458.291] (-459.437) (-459.523) -- 0:00:39
367000 -- (-458.112) (-459.606) (-459.533) [-459.483] * (-460.337) (-459.185) (-459.713) [-457.939] -- 0:00:39
367500 -- [-458.066] (-461.068) (-458.530) (-460.871) * (-459.396) [-461.604] (-460.545) (-458.431) -- 0:00:39
368000 -- (-459.212) [-459.939] (-460.296) (-460.744) * (-463.780) (-461.608) (-462.526) [-460.163] -- 0:00:39
368500 -- (-458.552) (-467.308) [-457.826] (-460.973) * [-458.385] (-458.262) (-459.484) (-460.025) -- 0:00:39
369000 -- [-462.312] (-461.416) (-459.026) (-459.963) * [-459.202] (-458.002) (-458.124) (-460.259) -- 0:00:39
369500 -- (-459.072) (-460.459) (-460.781) [-461.907] * (-458.207) (-458.704) (-458.803) [-463.957] -- 0:00:39
370000 -- [-458.202] (-459.044) (-462.995) (-458.976) * (-461.592) (-460.322) [-459.127] (-458.173) -- 0:00:40
Average standard deviation of split frequencies: 0.012082
370500 -- (-458.181) (-459.548) [-461.689] (-460.535) * (-462.089) (-467.148) (-460.617) [-458.383] -- 0:00:40
371000 -- (-457.931) [-458.676] (-459.214) (-459.394) * (-461.117) [-461.184] (-460.484) (-461.858) -- 0:00:40
371500 -- (-457.977) (-463.505) [-459.316] (-459.625) * (-465.261) (-462.675) (-460.025) [-458.109] -- 0:00:40
372000 -- (-461.618) (-462.506) [-461.126] (-459.132) * (-459.162) [-458.490] (-459.376) (-458.542) -- 0:00:40
372500 -- (-460.131) (-460.026) (-457.997) [-459.123] * (-460.154) [-462.999] (-461.040) (-459.577) -- 0:00:40
373000 -- (-459.459) (-458.040) (-457.811) [-458.757] * (-458.116) (-460.890) [-459.256] (-458.298) -- 0:00:40
373500 -- (-462.553) (-459.572) [-459.032] (-459.602) * (-459.068) [-457.860] (-458.423) (-460.269) -- 0:00:40
374000 -- [-461.234] (-460.180) (-458.195) (-459.246) * [-458.432] (-459.491) (-464.870) (-460.324) -- 0:00:40
374500 -- (-458.544) (-465.162) [-458.342] (-458.025) * (-460.013) (-462.465) (-463.057) [-461.473] -- 0:00:40
375000 -- [-459.936] (-460.439) (-461.419) (-458.506) * (-461.120) (-458.694) [-462.193] (-458.662) -- 0:00:40
Average standard deviation of split frequencies: 0.012677
375500 -- (-463.783) (-462.023) [-459.169] (-459.175) * [-461.419] (-460.845) (-461.211) (-464.961) -- 0:00:39
376000 -- [-458.446] (-462.386) (-460.624) (-462.444) * [-458.344] (-460.431) (-462.535) (-459.992) -- 0:00:39
376500 -- [-458.169] (-458.116) (-467.105) (-459.877) * (-458.347) (-459.457) (-459.881) [-459.945] -- 0:00:39
377000 -- (-459.618) (-459.190) [-459.798] (-464.758) * (-461.275) (-460.711) (-460.100) [-460.961] -- 0:00:39
377500 -- (-459.341) [-458.582] (-459.143) (-462.590) * (-459.018) (-459.041) (-461.426) [-461.961] -- 0:00:39
378000 -- (-458.472) (-461.312) (-459.073) [-457.509] * (-458.315) [-457.899] (-458.116) (-466.125) -- 0:00:39
378500 -- (-457.807) [-458.850] (-458.958) (-460.656) * [-458.177] (-461.846) (-460.771) (-459.270) -- 0:00:39
379000 -- (-459.175) (-460.634) [-463.157] (-467.147) * (-458.222) [-460.138] (-458.563) (-459.655) -- 0:00:39
379500 -- (-459.455) (-459.083) (-459.796) [-457.955] * (-464.336) (-461.099) (-458.412) [-462.232] -- 0:00:39
380000 -- [-458.089] (-461.029) (-457.877) (-457.717) * [-461.332] (-463.310) (-460.030) (-458.399) -- 0:00:39
Average standard deviation of split frequencies: 0.011874
380500 -- (-459.561) [-461.752] (-459.364) (-460.303) * (-458.678) [-459.097] (-458.701) (-460.040) -- 0:00:39
381000 -- (-461.568) (-459.393) [-459.562] (-460.769) * (-459.672) (-461.634) (-457.614) [-460.422] -- 0:00:38
381500 -- (-463.943) (-458.640) (-458.001) [-458.661] * (-458.645) [-458.300] (-463.837) (-458.038) -- 0:00:38
382000 -- (-461.636) (-458.061) (-459.234) [-459.404] * [-459.625] (-458.301) (-458.079) (-461.388) -- 0:00:38
382500 -- (-459.421) (-460.288) (-458.681) [-458.542] * [-462.889] (-457.855) (-458.894) (-459.964) -- 0:00:38
383000 -- (-461.037) [-459.181] (-461.262) (-457.993) * (-459.447) [-457.983] (-461.376) (-458.668) -- 0:00:38
383500 -- (-462.658) (-460.229) (-459.144) [-458.318] * (-459.384) (-458.439) [-459.707] (-457.658) -- 0:00:38
384000 -- [-462.696] (-459.121) (-459.391) (-457.496) * [-459.982] (-458.371) (-459.835) (-459.065) -- 0:00:40
384500 -- (-459.164) (-463.734) [-458.140] (-458.545) * (-458.116) (-458.242) (-458.860) [-458.153] -- 0:00:40
385000 -- (-462.159) [-461.489] (-458.849) (-461.235) * [-458.583] (-458.917) (-460.078) (-459.151) -- 0:00:39
Average standard deviation of split frequencies: 0.012552
385500 -- (-458.493) (-460.014) (-459.073) [-462.499] * (-460.635) [-459.392] (-459.216) (-461.760) -- 0:00:39
386000 -- (-459.653) [-458.184] (-459.317) (-460.474) * (-458.463) (-457.613) [-457.698] (-464.397) -- 0:00:39
386500 -- [-462.479] (-459.911) (-458.818) (-463.105) * (-460.489) [-458.840] (-459.057) (-460.210) -- 0:00:39
387000 -- (-462.436) (-459.587) (-459.471) [-459.780] * (-458.068) [-460.738] (-459.764) (-459.020) -- 0:00:39
387500 -- (-459.464) [-460.265] (-461.450) (-457.997) * [-458.427] (-460.755) (-460.565) (-457.836) -- 0:00:39
388000 -- (-458.943) [-458.028] (-460.109) (-460.827) * (-460.163) (-460.475) [-459.023] (-458.614) -- 0:00:39
388500 -- (-458.828) (-458.461) [-459.085] (-460.347) * (-460.483) (-458.462) [-458.084] (-459.497) -- 0:00:39
389000 -- (-463.718) (-460.474) (-463.458) [-459.786] * (-459.040) (-458.303) (-459.056) [-458.918] -- 0:00:39
389500 -- [-460.044] (-460.907) (-460.457) (-458.581) * (-459.184) (-459.766) [-458.647] (-461.469) -- 0:00:39
390000 -- [-459.184] (-460.016) (-467.436) (-458.327) * (-462.303) [-458.683] (-459.919) (-462.497) -- 0:00:39
Average standard deviation of split frequencies: 0.012351
390500 -- [-458.383] (-458.422) (-459.234) (-457.773) * (-458.788) (-461.203) [-458.311] (-458.559) -- 0:00:39
391000 -- [-458.291] (-458.791) (-460.925) (-460.073) * (-460.028) (-462.622) (-462.345) [-462.333] -- 0:00:38
391500 -- [-458.780] (-458.032) (-457.826) (-459.181) * (-460.247) (-462.364) [-462.643] (-460.297) -- 0:00:38
392000 -- [-459.111] (-460.002) (-460.595) (-460.435) * [-459.701] (-458.925) (-461.656) (-458.289) -- 0:00:38
392500 -- [-459.747] (-461.879) (-463.442) (-459.668) * [-462.026] (-458.406) (-459.178) (-458.153) -- 0:00:38
393000 -- (-458.824) (-459.437) [-459.814] (-458.249) * (-460.212) (-460.264) [-459.591] (-457.500) -- 0:00:38
393500 -- (-459.445) [-459.333] (-460.013) (-461.408) * (-459.721) (-465.363) [-459.202] (-459.290) -- 0:00:38
394000 -- (-458.249) [-459.508] (-460.430) (-460.960) * [-464.280] (-459.987) (-461.796) (-460.273) -- 0:00:38
394500 -- (-459.299) [-458.374] (-461.715) (-458.650) * (-458.534) (-458.226) (-458.424) [-460.911] -- 0:00:38
395000 -- (-459.297) [-457.970] (-462.000) (-459.805) * (-459.303) [-459.909] (-459.028) (-458.128) -- 0:00:38
Average standard deviation of split frequencies: 0.011681
395500 -- (-458.689) (-460.191) (-459.673) [-459.666] * (-457.936) [-458.131] (-459.312) (-459.574) -- 0:00:38
396000 -- (-461.016) (-461.000) (-458.739) [-459.401] * (-459.804) (-459.675) [-460.758] (-459.439) -- 0:00:38
396500 -- (-462.182) (-459.326) (-460.374) [-460.644] * [-457.708] (-458.564) (-459.406) (-461.475) -- 0:00:38
397000 -- [-462.053] (-462.952) (-458.075) (-461.468) * (-460.678) (-459.191) [-463.595] (-459.972) -- 0:00:37
397500 -- (-462.031) (-460.976) [-459.147] (-459.589) * (-461.288) (-461.176) (-459.506) [-459.994] -- 0:00:37
398000 -- (-459.390) [-459.942] (-458.675) (-458.532) * (-457.715) [-459.936] (-458.969) (-458.772) -- 0:00:37
398500 -- (-463.809) (-464.047) (-462.176) [-461.218] * [-459.089] (-460.330) (-458.185) (-458.720) -- 0:00:39
399000 -- [-459.843] (-458.930) (-462.640) (-460.331) * [-458.426] (-458.747) (-458.427) (-458.263) -- 0:00:39
399500 -- (-459.855) (-458.844) [-464.779] (-460.394) * (-459.436) (-458.477) [-458.511] (-458.927) -- 0:00:39
400000 -- (-460.529) (-460.161) (-462.079) [-459.302] * (-460.650) [-458.334] (-458.015) (-460.477) -- 0:00:39
Average standard deviation of split frequencies: 0.012250
400500 -- (-457.629) (-459.401) [-461.275] (-461.956) * (-462.552) (-457.759) [-459.355] (-458.084) -- 0:00:38
401000 -- (-462.052) (-460.051) [-459.615] (-459.806) * (-461.801) (-463.956) [-459.642] (-460.101) -- 0:00:38
401500 -- [-459.144] (-458.576) (-457.967) (-461.531) * (-461.941) (-462.572) (-459.606) [-460.937] -- 0:00:38
402000 -- [-460.379] (-460.264) (-463.597) (-458.818) * (-460.618) [-458.251] (-459.884) (-458.967) -- 0:00:38
402500 -- (-462.277) [-461.353] (-459.007) (-459.519) * (-458.650) (-457.805) (-457.790) [-461.848] -- 0:00:38
403000 -- (-459.223) [-460.549] (-458.620) (-462.996) * (-460.491) [-458.611] (-457.854) (-458.327) -- 0:00:38
403500 -- (-458.611) (-461.317) (-460.903) [-460.765] * (-460.785) [-459.013] (-460.915) (-459.550) -- 0:00:38
404000 -- (-458.614) (-458.056) (-463.731) [-459.999] * (-461.909) [-458.158] (-458.549) (-458.537) -- 0:00:38
404500 -- (-458.437) [-458.442] (-459.801) (-458.373) * (-459.972) [-458.255] (-458.851) (-463.446) -- 0:00:38
405000 -- (-459.424) [-459.461] (-461.351) (-459.244) * (-461.297) [-458.381] (-461.640) (-458.446) -- 0:00:38
Average standard deviation of split frequencies: 0.012708
405500 -- (-459.781) (-460.669) [-461.190] (-459.350) * (-460.261) (-457.899) (-460.971) [-460.337] -- 0:00:38
406000 -- (-460.195) [-463.170] (-458.802) (-457.869) * (-462.257) [-458.020] (-458.126) (-459.242) -- 0:00:38
406500 -- (-458.824) [-462.675] (-458.839) (-457.777) * (-463.796) (-460.907) (-461.684) [-460.214] -- 0:00:37
407000 -- [-459.222] (-461.416) (-459.108) (-457.884) * [-459.152] (-461.897) (-459.955) (-462.917) -- 0:00:37
407500 -- (-460.862) [-459.910] (-457.972) (-462.528) * (-458.507) (-462.867) [-462.477] (-460.515) -- 0:00:37
408000 -- (-460.383) (-460.882) [-461.453] (-461.072) * (-458.355) (-458.924) [-463.146] (-460.491) -- 0:00:37
408500 -- (-459.711) [-462.549] (-458.710) (-458.810) * (-458.513) [-461.833] (-462.270) (-462.874) -- 0:00:37
409000 -- [-458.082] (-460.404) (-458.819) (-460.190) * (-457.944) [-458.806] (-460.268) (-461.840) -- 0:00:37
409500 -- (-458.075) (-461.055) [-458.633] (-459.667) * (-462.136) (-460.321) [-459.176] (-458.126) -- 0:00:37
410000 -- [-457.736] (-461.841) (-460.583) (-460.763) * (-461.995) (-461.250) [-459.804] (-457.903) -- 0:00:37
Average standard deviation of split frequencies: 0.012372
410500 -- (-459.058) (-461.326) (-459.411) [-459.703] * (-458.456) [-459.514] (-461.598) (-461.433) -- 0:00:37
411000 -- (-459.574) (-459.965) (-458.123) [-460.058] * [-460.087] (-463.335) (-459.478) (-463.167) -- 0:00:37
411500 -- [-462.066] (-458.563) (-460.222) (-457.613) * [-460.536] (-465.169) (-459.574) (-462.532) -- 0:00:37
412000 -- (-462.810) (-459.372) (-457.610) [-459.112] * (-460.564) (-459.146) (-459.664) [-459.974] -- 0:00:37
412500 -- [-459.682] (-459.320) (-461.962) (-458.961) * (-464.937) [-460.439] (-460.439) (-459.650) -- 0:00:37
413000 -- [-459.277] (-459.129) (-459.399) (-457.739) * [-465.775] (-459.812) (-459.514) (-459.664) -- 0:00:38
413500 -- (-460.025) (-462.155) [-459.712] (-460.763) * (-458.278) (-462.530) [-460.940] (-460.852) -- 0:00:38
414000 -- (-460.834) [-458.461] (-459.715) (-460.261) * (-458.916) [-458.600] (-465.081) (-458.752) -- 0:00:38
414500 -- (-459.458) [-461.370] (-460.089) (-460.767) * (-463.043) (-461.602) (-458.279) [-457.733] -- 0:00:38
415000 -- (-464.072) (-459.461) (-462.234) [-458.859] * (-460.189) [-459.230] (-459.505) (-457.959) -- 0:00:38
Average standard deviation of split frequencies: 0.012704
415500 -- (-461.903) (-458.266) (-460.488) [-460.836] * (-458.267) (-461.858) (-463.219) [-459.461] -- 0:00:37
416000 -- [-462.291] (-459.921) (-463.434) (-463.146) * (-463.646) (-459.230) [-459.319] (-460.436) -- 0:00:37
416500 -- (-459.771) (-459.236) [-458.685] (-462.567) * (-459.079) (-458.775) [-459.863] (-463.441) -- 0:00:37
417000 -- (-462.371) (-459.884) [-458.021] (-464.850) * (-459.261) (-461.004) (-463.378) [-463.635] -- 0:00:37
417500 -- [-458.628] (-459.781) (-458.217) (-460.567) * [-459.918] (-461.751) (-468.143) (-458.807) -- 0:00:37
418000 -- (-459.046) (-460.053) [-459.029] (-459.945) * (-459.761) (-459.240) (-462.094) [-459.850] -- 0:00:37
418500 -- [-460.572] (-461.724) (-460.679) (-458.898) * (-460.228) [-460.223] (-460.164) (-463.085) -- 0:00:37
419000 -- [-460.806] (-461.883) (-459.808) (-458.161) * [-461.967] (-458.749) (-461.696) (-461.286) -- 0:00:37
419500 -- (-459.300) (-463.816) (-461.573) [-458.470] * (-459.898) (-458.368) (-459.293) [-459.187] -- 0:00:37
420000 -- (-462.785) [-460.360] (-463.560) (-462.071) * (-458.629) (-461.072) [-457.851] (-460.702) -- 0:00:37
Average standard deviation of split frequencies: 0.012015
420500 -- (-459.666) (-460.567) [-459.462] (-462.708) * [-459.293] (-458.832) (-462.377) (-460.368) -- 0:00:37
421000 -- (-458.746) (-464.065) [-462.321] (-460.148) * (-462.376) (-461.073) (-465.600) [-459.903] -- 0:00:37
421500 -- [-459.032] (-459.694) (-459.903) (-460.770) * (-460.716) (-461.933) (-458.491) [-461.930] -- 0:00:37
422000 -- (-462.740) (-461.748) [-462.765] (-460.139) * (-459.812) (-458.637) (-458.755) [-468.217] -- 0:00:36
422500 -- [-459.885] (-464.265) (-461.047) (-459.207) * (-459.257) (-458.525) [-458.056] (-460.697) -- 0:00:36
423000 -- [-459.653] (-461.928) (-458.518) (-458.086) * (-462.061) [-459.762] (-461.248) (-460.318) -- 0:00:36
423500 -- [-459.380] (-462.359) (-459.293) (-458.703) * (-459.221) (-460.887) [-458.335] (-463.294) -- 0:00:36
424000 -- (-458.324) [-458.885] (-458.973) (-458.628) * (-459.409) (-458.096) (-461.107) [-458.071] -- 0:00:36
424500 -- [-460.122] (-461.876) (-460.186) (-459.148) * (-458.410) (-460.483) (-462.573) [-458.815] -- 0:00:36
425000 -- (-459.542) (-464.501) [-460.599] (-460.092) * (-459.674) (-459.492) [-462.030] (-458.267) -- 0:00:36
Average standard deviation of split frequencies: 0.011998
425500 -- (-459.652) (-461.564) [-459.710] (-460.487) * (-458.833) (-458.996) [-467.180] (-458.747) -- 0:00:36
426000 -- (-457.917) [-458.566] (-460.078) (-461.033) * (-460.518) (-459.377) (-461.595) [-462.933] -- 0:00:36
426500 -- (-458.663) (-459.242) [-458.645] (-461.911) * [-459.879] (-458.154) (-461.378) (-460.229) -- 0:00:36
427000 -- (-460.385) [-457.812] (-459.768) (-458.495) * (-458.734) (-458.350) (-460.543) [-458.605] -- 0:00:36
427500 -- (-462.332) (-460.167) (-462.100) [-460.316] * (-460.425) (-460.349) (-461.051) [-460.355] -- 0:00:36
428000 -- (-460.296) (-465.564) [-459.361] (-461.187) * [-459.964] (-460.020) (-458.473) (-459.241) -- 0:00:36
428500 -- (-460.282) (-460.574) (-462.076) [-458.204] * (-461.908) [-459.135] (-461.947) (-459.419) -- 0:00:37
429000 -- (-458.692) (-459.572) [-460.032] (-461.997) * [-459.465] (-458.575) (-458.979) (-459.112) -- 0:00:37
429500 -- [-458.977] (-460.855) (-461.118) (-459.495) * [-460.093] (-457.927) (-461.372) (-458.649) -- 0:00:37
430000 -- [-461.133] (-461.400) (-464.433) (-465.369) * (-461.029) (-458.019) (-458.666) [-458.147] -- 0:00:37
Average standard deviation of split frequencies: 0.012527
430500 -- (-461.883) (-462.970) (-462.912) [-458.044] * (-458.601) (-459.167) [-459.795] (-461.264) -- 0:00:37
431000 -- (-467.137) (-459.328) (-461.221) [-457.629] * [-457.907] (-458.334) (-462.380) (-462.502) -- 0:00:36
431500 -- (-464.570) [-465.897] (-460.483) (-457.525) * [-460.167] (-460.359) (-460.488) (-461.385) -- 0:00:36
432000 -- [-459.796] (-458.980) (-461.942) (-457.828) * (-459.101) (-459.618) [-461.059] (-461.704) -- 0:00:36
432500 -- (-459.149) [-465.222] (-457.633) (-458.783) * [-459.194] (-460.420) (-460.262) (-459.403) -- 0:00:36
433000 -- [-457.640] (-461.699) (-459.136) (-459.519) * (-459.818) [-460.690] (-459.435) (-459.421) -- 0:00:36
433500 -- (-458.081) [-458.251] (-460.416) (-463.896) * [-459.240] (-459.728) (-462.940) (-458.984) -- 0:00:36
434000 -- [-459.063] (-463.134) (-460.926) (-463.605) * [-461.549] (-462.103) (-461.748) (-459.765) -- 0:00:36
434500 -- (-459.794) (-458.460) [-458.199] (-458.285) * (-459.088) [-460.265] (-461.122) (-459.535) -- 0:00:36
435000 -- (-460.681) (-460.320) (-462.690) [-458.473] * (-461.553) (-461.148) [-462.969] (-460.166) -- 0:00:36
Average standard deviation of split frequencies: 0.013095
435500 -- [-461.925] (-460.752) (-459.473) (-458.583) * (-460.568) (-458.848) [-461.262] (-460.741) -- 0:00:36
436000 -- (-462.002) [-458.852] (-461.273) (-458.249) * (-464.049) (-461.811) [-459.674] (-462.230) -- 0:00:36
436500 -- (-458.923) (-459.641) (-458.442) [-457.457] * (-461.152) [-460.733] (-460.979) (-458.559) -- 0:00:36
437000 -- (-464.404) (-458.376) [-458.818] (-461.947) * [-460.766] (-462.321) (-458.683) (-460.483) -- 0:00:36
437500 -- (-460.047) (-458.376) [-459.972] (-461.139) * (-458.917) (-459.927) [-458.286] (-460.836) -- 0:00:36
438000 -- (-460.482) (-457.528) (-457.959) [-458.527] * (-461.369) (-463.998) [-459.580] (-466.008) -- 0:00:35
438500 -- [-460.062] (-459.084) (-459.754) (-460.293) * (-458.163) (-459.184) [-460.019] (-462.489) -- 0:00:35
439000 -- (-457.742) (-459.138) (-459.012) [-461.336] * [-462.327] (-462.897) (-460.835) (-460.051) -- 0:00:35
439500 -- [-459.947] (-460.578) (-461.100) (-458.093) * (-459.664) [-459.547] (-459.463) (-459.769) -- 0:00:35
440000 -- (-461.702) [-458.160] (-458.969) (-463.349) * (-458.186) (-460.273) (-458.980) [-458.204] -- 0:00:35
Average standard deviation of split frequencies: 0.012585
440500 -- [-463.819] (-461.588) (-459.623) (-459.929) * [-461.926] (-458.587) (-459.881) (-458.517) -- 0:00:35
441000 -- [-458.723] (-460.721) (-459.997) (-459.573) * [-460.820] (-461.246) (-460.342) (-461.093) -- 0:00:35
441500 -- (-458.676) (-459.108) (-460.712) [-462.437] * [-460.529] (-463.907) (-460.354) (-463.315) -- 0:00:35
442000 -- (-459.167) (-457.752) (-461.031) [-458.833] * (-460.252) (-461.702) (-458.331) [-459.625] -- 0:00:35
442500 -- (-460.487) (-459.083) (-460.107) [-460.429] * (-459.406) (-461.042) [-458.389] (-461.023) -- 0:00:35
443000 -- [-461.567] (-458.813) (-462.208) (-461.687) * (-459.961) (-457.927) [-458.227] (-460.353) -- 0:00:35
443500 -- (-460.413) [-460.287] (-458.428) (-461.960) * (-459.829) (-458.869) (-457.972) [-458.524] -- 0:00:35
444000 -- (-465.627) (-464.034) (-458.828) [-459.491] * (-460.456) [-460.206] (-459.219) (-458.236) -- 0:00:35
444500 -- (-461.813) (-459.744) [-459.279] (-460.768) * (-459.553) (-461.966) (-459.130) [-460.843] -- 0:00:36
445000 -- (-459.918) (-459.431) [-460.020] (-462.556) * (-460.260) [-460.672] (-458.844) (-463.145) -- 0:00:36
Average standard deviation of split frequencies: 0.012214
445500 -- (-458.565) (-458.369) (-465.054) [-458.715] * (-458.132) (-459.867) [-458.645] (-461.626) -- 0:00:36
446000 -- [-461.754] (-458.524) (-458.119) (-467.501) * (-459.425) [-458.264] (-460.760) (-462.197) -- 0:00:36
446500 -- (-465.054) (-459.526) (-460.054) [-462.643] * (-461.826) (-458.603) (-458.989) [-459.193] -- 0:00:35
447000 -- (-461.982) (-460.440) [-457.979] (-462.647) * (-459.200) (-461.816) [-458.622] (-458.342) -- 0:00:35
447500 -- (-463.785) (-464.527) (-460.816) [-459.209] * [-459.118] (-458.495) (-458.098) (-460.891) -- 0:00:35
448000 -- (-461.150) (-459.750) (-459.170) [-458.329] * (-460.612) [-459.585] (-460.706) (-460.160) -- 0:00:35
448500 -- [-459.913] (-461.306) (-461.269) (-460.422) * (-460.724) (-461.403) (-460.542) [-461.772] -- 0:00:35
449000 -- [-458.347] (-463.789) (-462.472) (-460.841) * (-465.635) [-462.253] (-461.522) (-460.580) -- 0:00:35
449500 -- (-458.793) (-459.885) [-461.736] (-462.369) * (-463.231) [-458.916] (-463.332) (-459.371) -- 0:00:35
450000 -- (-462.342) (-458.422) (-463.882) [-459.601] * (-459.505) (-458.071) (-461.673) [-459.732] -- 0:00:35
Average standard deviation of split frequencies: 0.011875
450500 -- (-460.467) [-458.342] (-460.935) (-459.015) * (-460.094) (-458.236) [-458.277] (-459.406) -- 0:00:35
451000 -- (-462.779) (-462.395) [-459.452] (-460.661) * [-458.607] (-458.557) (-462.013) (-461.880) -- 0:00:35
451500 -- [-457.815] (-459.961) (-458.381) (-460.848) * (-458.607) (-458.314) (-458.516) [-460.177] -- 0:00:35
452000 -- (-457.848) (-457.794) [-459.536] (-458.495) * (-462.644) (-459.229) (-459.451) [-458.871] -- 0:00:35
452500 -- (-458.504) (-458.053) (-459.197) [-462.367] * [-459.710] (-458.888) (-461.301) (-463.721) -- 0:00:35
453000 -- (-460.729) (-460.503) [-457.962] (-459.680) * [-462.155] (-462.225) (-459.967) (-458.144) -- 0:00:35
453500 -- (-461.522) [-461.078] (-458.901) (-460.324) * (-460.815) [-458.653] (-459.819) (-458.866) -- 0:00:34
454000 -- (-458.398) [-458.057] (-458.917) (-459.560) * [-458.367] (-458.960) (-459.136) (-462.664) -- 0:00:34
454500 -- (-458.553) (-458.686) (-459.829) [-461.419] * (-457.707) [-461.438] (-460.559) (-458.520) -- 0:00:34
455000 -- [-460.226] (-458.915) (-460.924) (-461.756) * (-458.471) (-459.281) (-458.105) [-460.019] -- 0:00:34
Average standard deviation of split frequencies: 0.012892
455500 -- (-462.343) (-458.718) [-459.758] (-458.820) * (-461.772) [-462.037] (-461.495) (-459.195) -- 0:00:34
456000 -- (-459.564) (-459.863) [-457.747] (-459.968) * (-458.229) (-462.920) (-461.821) [-464.730] -- 0:00:34
456500 -- [-458.522] (-457.839) (-458.939) (-458.371) * [-458.555] (-458.500) (-460.497) (-459.010) -- 0:00:34
457000 -- (-458.908) (-458.761) [-458.986] (-460.473) * [-460.082] (-460.969) (-459.044) (-460.331) -- 0:00:34
457500 -- (-459.133) [-458.263] (-465.393) (-461.261) * [-457.578] (-458.801) (-463.446) (-458.417) -- 0:00:34
458000 -- (-459.546) [-458.396] (-458.022) (-458.786) * [-459.324] (-459.397) (-459.800) (-458.881) -- 0:00:34
458500 -- [-458.267] (-459.000) (-458.609) (-459.467) * (-469.042) (-461.968) [-458.686] (-458.050) -- 0:00:34
459000 -- [-459.364] (-459.668) (-458.310) (-459.231) * (-463.114) (-460.629) (-459.434) [-460.717] -- 0:00:34
459500 -- (-463.523) (-461.188) [-461.223] (-460.157) * [-462.710] (-458.900) (-460.314) (-462.671) -- 0:00:34
460000 -- (-459.615) (-458.709) [-461.324] (-460.746) * (-462.712) (-458.231) (-458.654) [-463.715] -- 0:00:34
Average standard deviation of split frequencies: 0.012882
460500 -- (-460.046) (-460.049) (-462.716) [-459.793] * [-461.370] (-458.107) (-461.919) (-458.681) -- 0:00:35
461000 -- (-460.706) (-458.688) [-458.415] (-459.974) * (-462.596) (-458.378) (-464.627) [-460.283] -- 0:00:35
461500 -- [-459.531] (-457.568) (-459.907) (-463.202) * (-460.230) (-460.407) (-458.844) [-461.410] -- 0:00:35
462000 -- (-460.386) (-459.645) [-459.226] (-458.031) * (-461.385) (-460.819) (-467.748) [-461.521] -- 0:00:34
462500 -- (-459.325) [-460.324] (-459.328) (-459.863) * [-460.951] (-458.769) (-464.628) (-464.387) -- 0:00:34
463000 -- [-458.003] (-467.963) (-461.737) (-462.650) * (-463.073) [-458.559] (-460.760) (-463.918) -- 0:00:34
463500 -- [-458.216] (-469.323) (-459.042) (-460.773) * (-458.686) (-459.143) (-460.982) [-461.561] -- 0:00:34
464000 -- [-459.087] (-461.018) (-458.330) (-458.064) * (-462.466) (-461.041) (-459.419) [-460.994] -- 0:00:34
464500 -- (-459.957) (-461.658) [-463.397] (-460.015) * (-458.163) [-457.798] (-459.728) (-458.124) -- 0:00:34
465000 -- [-462.350] (-458.350) (-460.309) (-458.149) * [-457.974] (-458.038) (-461.950) (-458.142) -- 0:00:34
Average standard deviation of split frequencies: 0.012675
465500 -- (-459.076) [-459.670] (-460.086) (-459.872) * (-460.703) (-459.491) [-458.600] (-458.041) -- 0:00:34
466000 -- [-458.078] (-458.556) (-457.985) (-461.301) * (-459.015) (-461.416) [-459.594] (-458.034) -- 0:00:34
466500 -- (-460.383) (-458.353) (-459.428) [-459.608] * (-460.340) (-462.236) (-465.052) [-460.520] -- 0:00:34
467000 -- (-459.044) (-463.409) (-457.998) [-457.872] * (-459.493) [-459.360] (-459.209) (-458.964) -- 0:00:34
467500 -- (-465.021) (-459.713) [-460.988] (-458.928) * (-457.728) [-462.036] (-467.057) (-459.351) -- 0:00:34
468000 -- (-466.212) (-457.909) [-459.523] (-460.133) * [-457.861] (-460.556) (-458.775) (-460.482) -- 0:00:34
468500 -- (-464.129) [-458.524] (-460.052) (-463.716) * (-459.724) (-461.391) [-460.155] (-459.854) -- 0:00:34
469000 -- (-462.220) [-462.206] (-462.183) (-457.493) * (-461.908) [-459.864] (-461.044) (-458.670) -- 0:00:33
469500 -- (-458.482) [-461.635] (-461.722) (-460.355) * (-461.797) [-464.666] (-458.667) (-458.281) -- 0:00:33
470000 -- [-462.909] (-458.393) (-458.879) (-461.026) * (-461.903) (-459.883) [-459.112] (-462.665) -- 0:00:33
Average standard deviation of split frequencies: 0.012785
470500 -- [-458.894] (-460.631) (-458.754) (-461.130) * (-458.842) [-458.543] (-459.014) (-457.752) -- 0:00:33
471000 -- [-461.627] (-463.482) (-462.790) (-460.014) * (-465.684) [-457.704] (-459.700) (-460.802) -- 0:00:33
471500 -- [-461.196] (-458.742) (-459.599) (-460.038) * (-459.635) (-463.802) (-457.957) [-458.784] -- 0:00:33
472000 -- (-459.839) (-460.009) (-461.661) [-459.277] * (-461.849) [-458.799] (-457.983) (-460.698) -- 0:00:33
472500 -- (-459.343) [-459.151] (-460.743) (-459.324) * (-459.670) (-459.794) (-459.696) [-459.193] -- 0:00:33
473000 -- (-464.091) (-457.691) (-459.938) [-458.447] * (-458.265) (-458.798) [-459.068] (-461.131) -- 0:00:33
473500 -- (-460.325) [-462.365] (-463.947) (-459.794) * (-458.705) [-458.906] (-460.782) (-459.938) -- 0:00:33
474000 -- (-462.016) (-460.256) [-459.247] (-460.810) * (-464.476) (-462.028) [-458.779] (-465.193) -- 0:00:33
474500 -- (-458.208) (-460.374) (-463.142) [-458.907] * [-463.093] (-460.748) (-459.471) (-463.199) -- 0:00:33
475000 -- [-459.108] (-458.305) (-460.688) (-460.932) * (-465.058) (-462.246) [-457.987] (-461.991) -- 0:00:33
Average standard deviation of split frequencies: 0.013632
475500 -- (-458.184) (-459.176) (-460.755) [-457.898] * [-459.636] (-459.346) (-458.327) (-460.110) -- 0:00:33
476000 -- [-459.315] (-459.592) (-460.850) (-458.286) * (-458.654) (-463.122) (-459.239) [-459.167] -- 0:00:33
476500 -- [-459.434] (-457.861) (-461.438) (-463.938) * [-457.628] (-463.455) (-458.743) (-459.306) -- 0:00:34
477000 -- (-460.286) [-459.859] (-458.777) (-460.489) * [-457.621] (-458.533) (-464.502) (-459.249) -- 0:00:33
477500 -- [-458.058] (-458.776) (-458.268) (-458.186) * [-458.509] (-458.624) (-458.514) (-458.492) -- 0:00:33
478000 -- [-457.888] (-460.949) (-460.765) (-458.003) * [-460.785] (-458.991) (-463.927) (-457.797) -- 0:00:33
478500 -- (-458.320) (-464.242) [-458.394] (-458.408) * (-458.653) (-458.667) [-460.364] (-458.239) -- 0:00:33
479000 -- (-458.494) [-460.042] (-459.179) (-460.411) * (-458.970) (-460.367) [-459.239] (-460.670) -- 0:00:33
479500 -- (-458.941) (-461.635) (-461.421) [-459.187] * (-459.545) [-461.862] (-463.096) (-459.612) -- 0:00:33
480000 -- (-459.524) [-460.487] (-460.967) (-460.615) * [-458.858] (-458.587) (-459.204) (-460.136) -- 0:00:33
Average standard deviation of split frequencies: 0.013211
480500 -- (-459.747) (-460.634) (-458.188) [-458.273] * [-459.156] (-459.162) (-460.398) (-462.834) -- 0:00:33
481000 -- (-459.793) (-458.860) (-458.318) [-462.671] * (-463.274) [-459.911] (-458.336) (-461.289) -- 0:00:33
481500 -- (-458.996) [-461.904] (-458.842) (-459.244) * (-464.041) [-458.297] (-459.765) (-459.980) -- 0:00:33
482000 -- (-458.932) (-462.136) [-458.789] (-459.224) * [-460.720] (-459.020) (-461.427) (-460.400) -- 0:00:33
482500 -- [-459.077] (-459.479) (-460.128) (-460.207) * (-458.043) [-457.682] (-459.986) (-458.635) -- 0:00:33
483000 -- (-457.860) [-458.035] (-458.312) (-461.601) * (-459.476) (-459.164) (-461.938) [-457.560] -- 0:00:33
483500 -- (-458.596) (-458.335) [-457.799] (-458.959) * (-458.066) (-465.515) (-459.507) [-463.154] -- 0:00:33
484000 -- (-458.542) (-462.345) (-459.603) [-461.010] * [-459.395] (-461.869) (-458.212) (-459.980) -- 0:00:33
484500 -- (-458.034) (-458.813) [-458.615] (-460.235) * (-462.606) (-462.751) (-458.291) [-461.357] -- 0:00:32
485000 -- [-460.119] (-459.109) (-460.016) (-459.359) * [-461.909] (-460.650) (-458.802) (-461.512) -- 0:00:32
Average standard deviation of split frequencies: 0.013408
485500 -- (-458.771) (-460.156) [-460.891] (-458.489) * (-460.011) (-458.439) [-458.228] (-458.516) -- 0:00:32
486000 -- [-458.622] (-461.058) (-461.871) (-464.339) * (-460.664) [-462.128] (-458.609) (-462.673) -- 0:00:32
486500 -- (-457.694) (-461.312) (-458.602) [-460.420] * (-464.491) (-462.105) [-458.423] (-463.087) -- 0:00:32
487000 -- (-459.626) (-459.291) [-458.000] (-458.228) * [-460.435] (-460.695) (-457.790) (-459.555) -- 0:00:32
487500 -- (-458.420) (-457.889) [-458.369] (-459.695) * (-460.908) (-458.131) [-461.891] (-459.369) -- 0:00:32
488000 -- [-458.509] (-462.265) (-458.791) (-459.323) * (-461.095) (-458.655) [-460.033] (-462.523) -- 0:00:32
488500 -- (-460.438) [-460.517] (-459.499) (-458.745) * [-458.940] (-458.391) (-460.672) (-461.034) -- 0:00:32
489000 -- (-458.503) [-458.778] (-459.789) (-461.361) * (-457.950) (-459.239) (-458.157) [-459.965] -- 0:00:32
489500 -- (-458.988) (-458.610) (-457.889) [-461.875] * (-460.640) [-461.170] (-458.919) (-462.048) -- 0:00:32
490000 -- (-459.842) [-459.985] (-458.400) (-463.948) * (-460.208) (-462.305) (-463.256) [-460.507] -- 0:00:32
Average standard deviation of split frequencies: 0.012942
490500 -- (-460.427) (-458.841) [-460.019] (-458.762) * (-458.937) [-459.447] (-458.871) (-462.156) -- 0:00:32
491000 -- (-461.848) (-459.097) [-460.029] (-459.265) * (-458.860) [-464.098] (-461.931) (-465.671) -- 0:00:32
491500 -- (-459.355) (-459.032) (-458.562) [-458.022] * (-461.122) (-461.280) [-457.971] (-465.112) -- 0:00:32
492000 -- (-462.070) (-458.846) [-459.307] (-457.860) * [-461.511] (-459.395) (-460.447) (-459.841) -- 0:00:32
492500 -- (-460.488) [-462.327] (-459.436) (-459.322) * (-458.766) (-460.455) (-459.603) [-460.721] -- 0:00:31
493000 -- (-462.760) [-457.934] (-460.903) (-458.254) * (-458.829) (-460.043) [-459.904] (-460.934) -- 0:00:32
493500 -- (-459.042) [-458.328] (-459.941) (-458.864) * [-461.102] (-459.372) (-465.625) (-461.493) -- 0:00:32
494000 -- [-461.467] (-459.882) (-457.944) (-464.187) * (-458.400) [-457.772] (-460.653) (-459.603) -- 0:00:32
494500 -- (-460.179) (-460.554) (-459.108) [-458.246] * (-458.031) [-461.666] (-458.501) (-464.393) -- 0:00:32
495000 -- (-458.349) (-458.524) [-460.881] (-460.155) * (-458.847) (-459.616) (-459.067) [-460.168] -- 0:00:32
Average standard deviation of split frequencies: 0.012970
495500 -- (-461.927) (-461.314) (-457.971) [-459.998] * (-458.305) (-463.794) (-462.964) [-460.855] -- 0:00:32
496000 -- (-459.056) [-460.045] (-461.176) (-462.208) * (-458.221) (-462.591) [-464.847] (-463.806) -- 0:00:32
496500 -- (-462.579) (-459.438) (-460.275) [-459.911] * (-458.203) [-461.243] (-458.173) (-458.455) -- 0:00:32
497000 -- (-460.950) [-458.671] (-471.487) (-459.962) * (-462.600) (-460.832) [-458.873] (-459.434) -- 0:00:32
497500 -- [-459.882] (-460.244) (-461.302) (-459.118) * (-460.950) (-463.544) [-461.357] (-459.670) -- 0:00:32
498000 -- [-459.909] (-460.025) (-458.904) (-459.783) * [-459.574] (-464.204) (-458.859) (-459.477) -- 0:00:32
498500 -- (-459.544) [-459.151] (-462.582) (-460.329) * (-461.309) [-461.712] (-460.910) (-458.722) -- 0:00:32
499000 -- (-461.028) (-459.020) (-460.452) [-459.178] * [-465.675] (-458.693) (-459.594) (-461.717) -- 0:00:32
499500 -- [-459.022] (-457.730) (-458.705) (-461.015) * [-459.537] (-459.422) (-459.692) (-459.415) -- 0:00:32
500000 -- (-459.962) [-460.265] (-460.764) (-464.596) * (-458.921) (-460.049) (-459.326) [-460.539] -- 0:00:32
Average standard deviation of split frequencies: 0.012005
500500 -- [-460.013] (-459.783) (-458.438) (-460.693) * (-458.649) (-463.462) [-458.130] (-460.844) -- 0:00:31
501000 -- (-460.940) (-458.773) [-460.387] (-460.364) * [-458.510] (-458.326) (-461.526) (-459.615) -- 0:00:31
501500 -- (-458.476) [-458.162] (-464.960) (-461.438) * (-459.285) (-459.373) (-460.760) [-459.030] -- 0:00:31
502000 -- (-463.791) [-458.310] (-469.264) (-459.825) * (-459.063) (-461.132) (-461.265) [-461.724] -- 0:00:31
502500 -- (-459.842) (-460.409) [-458.546] (-460.402) * (-459.278) (-460.620) [-459.674] (-461.558) -- 0:00:31
503000 -- [-461.722] (-459.975) (-463.734) (-458.362) * (-460.410) [-458.350] (-459.028) (-458.505) -- 0:00:31
503500 -- (-461.784) [-458.429] (-458.951) (-463.127) * (-463.132) [-459.108] (-460.779) (-459.235) -- 0:00:31
504000 -- (-458.157) (-458.078) [-460.493] (-468.357) * (-463.894) (-460.331) (-460.523) [-460.303] -- 0:00:31
504500 -- [-458.545] (-458.326) (-459.881) (-461.877) * (-461.000) (-465.332) (-459.372) [-458.312] -- 0:00:31
505000 -- (-460.263) (-458.932) (-461.138) [-463.308] * (-458.559) [-461.462] (-459.360) (-457.938) -- 0:00:31
Average standard deviation of split frequencies: 0.012385
505500 -- (-460.390) (-460.120) [-460.790] (-460.623) * (-459.097) (-460.209) [-459.521] (-461.185) -- 0:00:31
506000 -- (-462.024) (-460.198) [-459.288] (-463.689) * (-459.631) (-459.240) (-462.282) [-459.392] -- 0:00:31
506500 -- (-463.544) [-459.025] (-464.164) (-465.012) * (-460.246) (-459.973) [-461.697] (-459.357) -- 0:00:31
507000 -- (-462.220) [-461.214] (-460.021) (-459.646) * (-460.440) (-461.852) [-461.617] (-457.960) -- 0:00:31
507500 -- (-463.288) (-459.642) [-460.904] (-461.755) * (-460.783) [-463.047] (-457.818) (-459.639) -- 0:00:31
508000 -- (-470.061) (-458.302) [-463.425] (-459.754) * (-462.370) [-462.111] (-462.312) (-459.492) -- 0:00:30
508500 -- [-461.030] (-461.550) (-461.026) (-458.641) * [-458.936] (-458.405) (-462.252) (-459.510) -- 0:00:30
509000 -- (-460.467) (-458.355) (-458.808) [-458.634] * (-462.873) (-464.080) [-458.947] (-461.463) -- 0:00:31
509500 -- (-461.230) (-459.193) (-458.969) [-461.154] * (-461.338) (-459.201) (-465.819) [-461.984] -- 0:00:31
510000 -- [-458.156] (-458.902) (-458.219) (-460.210) * (-458.747) (-458.361) (-458.802) [-461.558] -- 0:00:31
Average standard deviation of split frequencies: 0.011885
510500 -- [-459.762] (-458.001) (-460.035) (-460.563) * (-458.389) (-458.602) (-459.203) [-460.633] -- 0:00:31
511000 -- (-457.914) [-457.906] (-458.088) (-459.922) * (-462.053) (-459.367) [-459.648] (-458.936) -- 0:00:31
511500 -- (-459.786) (-459.877) [-461.059] (-463.840) * (-457.861) (-460.850) (-458.160) [-458.236] -- 0:00:31
512000 -- (-458.584) [-458.432] (-463.720) (-462.492) * [-458.612] (-457.788) (-464.837) (-462.053) -- 0:00:31
512500 -- (-461.832) (-457.521) (-459.799) [-460.235] * (-458.251) (-458.170) (-459.207) [-462.097] -- 0:00:31
513000 -- (-462.095) (-458.312) [-458.731] (-458.229) * (-459.710) (-459.230) [-461.438] (-460.441) -- 0:00:31
513500 -- (-460.892) [-457.874] (-458.442) (-460.088) * [-459.972] (-459.304) (-464.309) (-461.123) -- 0:00:31
514000 -- (-459.870) (-458.109) [-457.562] (-460.304) * (-460.829) [-459.500] (-465.463) (-460.177) -- 0:00:31
514500 -- (-459.527) [-458.100] (-458.203) (-459.090) * (-462.995) [-458.704] (-462.387) (-458.388) -- 0:00:31
515000 -- [-459.062] (-459.063) (-457.778) (-459.386) * (-463.703) (-457.902) (-461.733) [-458.257] -- 0:00:31
Average standard deviation of split frequencies: 0.013190
515500 -- (-460.355) (-461.282) (-463.569) [-459.671] * (-462.778) (-461.997) [-459.283] (-458.467) -- 0:00:31
516000 -- (-461.703) (-460.088) (-461.214) [-459.151] * (-457.683) (-458.860) (-458.252) [-459.889] -- 0:00:30
516500 -- (-460.777) (-459.175) [-461.449] (-459.478) * (-458.426) (-459.231) [-457.989] (-458.870) -- 0:00:30
517000 -- [-459.427] (-459.232) (-459.270) (-459.282) * [-458.681] (-459.633) (-458.128) (-459.013) -- 0:00:30
517500 -- [-458.612] (-460.818) (-458.476) (-460.882) * (-458.026) (-459.524) (-460.794) [-459.626] -- 0:00:30
518000 -- (-460.449) (-458.864) [-459.344] (-460.094) * (-458.881) [-462.063] (-458.400) (-459.336) -- 0:00:30
518500 -- [-458.804] (-459.422) (-462.094) (-458.296) * (-459.267) (-458.251) (-458.949) [-461.600] -- 0:00:30
519000 -- (-460.590) (-458.012) (-467.346) [-458.577] * [-459.218] (-460.308) (-459.918) (-460.195) -- 0:00:30
519500 -- (-460.938) (-459.031) [-458.065] (-461.306) * (-458.664) (-460.073) (-457.962) [-459.521] -- 0:00:30
520000 -- (-459.230) (-458.997) (-459.759) [-459.016] * (-464.313) (-459.285) (-465.894) [-458.680] -- 0:00:30
Average standard deviation of split frequencies: 0.013015
520500 -- [-463.802] (-459.440) (-460.668) (-461.257) * (-463.500) [-462.584] (-460.103) (-461.572) -- 0:00:30
521000 -- (-465.378) (-459.959) [-459.413] (-458.654) * (-463.454) [-461.058] (-459.610) (-460.978) -- 0:00:30
521500 -- (-459.052) (-459.317) (-458.103) [-459.571] * (-459.368) [-458.240] (-459.477) (-463.784) -- 0:00:30
522000 -- (-461.295) [-461.627] (-460.545) (-459.978) * (-460.717) (-459.234) (-460.534) [-458.166] -- 0:00:30
522500 -- (-463.633) (-459.113) [-459.665] (-460.843) * (-460.247) [-460.135] (-459.942) (-457.883) -- 0:00:30
523000 -- (-461.766) (-461.769) (-459.754) [-461.310] * [-459.813] (-460.345) (-464.262) (-459.229) -- 0:00:30
523500 -- [-458.500] (-459.793) (-463.667) (-460.085) * (-461.002) (-462.569) (-461.016) [-459.391] -- 0:00:30
524000 -- (-457.932) [-458.506] (-460.147) (-461.505) * (-459.574) [-458.943] (-461.779) (-460.258) -- 0:00:29
524500 -- (-460.736) (-458.740) (-458.798) [-459.086] * (-457.825) (-461.440) [-458.658] (-458.146) -- 0:00:29
525000 -- (-459.889) (-458.010) [-462.180] (-461.198) * (-458.131) (-460.043) [-460.048] (-458.734) -- 0:00:30
Average standard deviation of split frequencies: 0.013499
525500 -- (-458.142) [-458.572] (-460.768) (-462.525) * (-460.530) [-458.808] (-459.160) (-461.069) -- 0:00:30
526000 -- (-461.202) (-458.159) [-458.459] (-459.917) * (-461.513) (-460.149) [-460.049] (-460.982) -- 0:00:30
526500 -- [-458.502] (-458.044) (-462.995) (-459.441) * (-459.891) [-461.287] (-460.424) (-458.623) -- 0:00:30
527000 -- (-459.574) [-460.263] (-463.398) (-457.854) * (-460.202) (-460.291) (-458.780) [-458.081] -- 0:00:30
527500 -- (-459.380) (-460.755) (-460.027) [-458.532] * [-459.117] (-458.403) (-464.814) (-458.039) -- 0:00:30
528000 -- (-465.881) (-458.446) (-459.748) [-459.404] * [-458.113] (-459.275) (-462.028) (-461.701) -- 0:00:30
528500 -- (-461.766) [-458.869] (-458.580) (-458.650) * (-458.017) [-458.755] (-462.443) (-459.028) -- 0:00:30
529000 -- (-460.515) [-458.963] (-458.100) (-463.034) * (-463.855) (-461.967) (-464.761) [-459.712] -- 0:00:30
529500 -- (-460.751) [-459.823] (-459.377) (-459.000) * (-458.746) (-463.673) (-458.696) [-458.025] -- 0:00:30
530000 -- [-460.004] (-460.131) (-460.019) (-463.370) * (-463.895) [-460.248] (-461.203) (-457.945) -- 0:00:30
Average standard deviation of split frequencies: 0.013547
530500 -- (-460.681) (-459.529) (-459.305) [-464.544] * (-460.423) (-459.459) (-459.155) [-459.717] -- 0:00:30
531000 -- [-458.436] (-459.540) (-459.304) (-460.015) * (-457.798) (-461.136) [-461.305] (-460.162) -- 0:00:30
531500 -- (-458.488) (-461.628) (-459.255) [-458.167] * (-460.258) (-463.166) (-461.151) [-459.737] -- 0:00:29
532000 -- [-457.925] (-461.190) (-458.066) (-463.181) * (-462.201) [-460.294] (-459.577) (-461.300) -- 0:00:29
532500 -- [-458.832] (-461.745) (-461.186) (-459.030) * (-460.233) [-457.940] (-460.808) (-462.880) -- 0:00:29
533000 -- (-458.713) (-459.624) (-459.966) [-460.202] * [-460.075] (-459.960) (-459.118) (-462.514) -- 0:00:29
533500 -- (-459.602) (-458.888) (-464.929) [-461.756] * [-461.275] (-460.178) (-459.803) (-461.313) -- 0:00:29
534000 -- [-460.851] (-459.172) (-463.811) (-458.392) * (-459.758) (-459.503) [-460.109] (-460.627) -- 0:00:29
534500 -- (-460.032) (-457.883) [-459.387] (-458.747) * [-457.947] (-458.153) (-463.272) (-457.529) -- 0:00:29
535000 -- [-461.096] (-460.719) (-459.449) (-460.159) * (-462.422) (-458.405) [-461.845] (-458.564) -- 0:00:29
Average standard deviation of split frequencies: 0.013412
535500 -- (-459.955) [-459.043] (-462.611) (-458.784) * [-458.493] (-460.089) (-459.687) (-458.209) -- 0:00:29
536000 -- [-462.968] (-461.172) (-458.464) (-460.097) * (-461.675) (-459.034) [-457.938] (-462.651) -- 0:00:29
536500 -- (-459.020) [-459.399] (-460.376) (-459.720) * (-463.546) (-460.614) (-460.574) [-458.439] -- 0:00:29
537000 -- (-459.784) (-461.405) (-458.946) [-457.814] * (-461.945) (-463.385) (-461.170) [-458.919] -- 0:00:29
537500 -- (-459.246) (-459.776) [-457.620] (-458.810) * (-458.126) (-461.795) [-458.713] (-462.316) -- 0:00:29
538000 -- [-458.204] (-459.272) (-460.655) (-458.477) * (-457.761) (-462.112) (-462.109) [-459.210] -- 0:00:29
538500 -- (-461.808) [-458.645] (-463.704) (-463.380) * (-461.788) (-460.469) [-460.592] (-460.305) -- 0:00:29
539000 -- (-460.402) (-459.594) [-459.324] (-458.571) * [-458.199] (-460.843) (-459.339) (-459.568) -- 0:00:29
539500 -- (-463.971) (-461.648) (-458.024) [-460.421] * (-460.098) (-460.761) (-465.979) [-462.254] -- 0:00:29
540000 -- (-462.400) (-459.724) (-458.039) [-459.634] * (-460.206) [-460.836] (-462.202) (-461.918) -- 0:00:28
Average standard deviation of split frequencies: 0.013460
540500 -- (-458.521) (-459.512) (-458.307) [-459.690] * (-464.409) (-462.291) [-461.870] (-460.198) -- 0:00:29
541000 -- [-461.028] (-458.142) (-458.289) (-457.871) * (-461.377) [-462.070] (-459.535) (-462.281) -- 0:00:29
541500 -- [-459.134] (-461.465) (-461.179) (-460.018) * (-461.133) (-460.189) [-459.543] (-462.141) -- 0:00:29
542000 -- [-460.369] (-461.075) (-462.028) (-457.783) * (-461.585) (-460.422) [-458.395] (-460.796) -- 0:00:29
542500 -- (-460.057) [-460.408] (-463.181) (-459.814) * (-459.698) (-462.336) [-458.870] (-460.121) -- 0:00:29
543000 -- (-462.472) (-461.924) (-462.012) [-459.804] * (-460.606) (-458.594) (-457.907) [-461.153] -- 0:00:29
543500 -- [-459.151] (-458.993) (-459.377) (-457.878) * (-460.243) [-459.161] (-459.284) (-463.256) -- 0:00:29
544000 -- (-457.579) (-459.494) [-458.222] (-458.269) * (-465.440) (-460.277) (-459.226) [-465.135] -- 0:00:29
544500 -- [-459.790] (-460.602) (-458.909) (-465.119) * [-459.385] (-460.578) (-458.882) (-461.451) -- 0:00:29
545000 -- [-460.818] (-459.972) (-459.324) (-461.486) * [-460.740] (-460.116) (-457.737) (-458.590) -- 0:00:29
Average standard deviation of split frequencies: 0.013598
545500 -- (-458.900) [-457.952] (-459.715) (-457.937) * (-459.786) (-457.967) (-460.562) [-462.339] -- 0:00:29
546000 -- [-460.116] (-458.762) (-459.873) (-458.332) * (-457.800) [-459.398] (-463.468) (-460.173) -- 0:00:29
546500 -- [-462.590] (-458.093) (-460.390) (-457.726) * (-460.180) [-457.812] (-458.516) (-463.821) -- 0:00:29
547000 -- (-463.090) (-460.012) [-461.495] (-457.913) * [-461.097] (-461.104) (-457.873) (-460.468) -- 0:00:28
547500 -- (-463.843) [-458.224] (-466.326) (-459.153) * (-460.340) (-459.563) (-457.809) [-458.974] -- 0:00:28
548000 -- [-460.585] (-460.456) (-464.779) (-457.558) * [-462.257] (-466.100) (-459.235) (-458.833) -- 0:00:28
548500 -- (-462.476) [-459.066] (-458.900) (-458.504) * [-461.350] (-465.695) (-458.898) (-465.361) -- 0:00:28
549000 -- (-459.240) (-460.967) [-459.406] (-460.236) * (-458.234) [-460.687] (-460.452) (-460.463) -- 0:00:28
549500 -- [-459.346] (-465.447) (-460.178) (-462.063) * (-458.365) (-460.792) [-460.914] (-459.110) -- 0:00:28
550000 -- [-458.623] (-459.280) (-459.687) (-457.864) * (-457.853) (-459.306) (-459.923) [-458.364] -- 0:00:28
Average standard deviation of split frequencies: 0.013857
550500 -- [-458.356] (-462.103) (-457.773) (-457.785) * (-459.658) (-466.567) [-458.882] (-462.253) -- 0:00:28
551000 -- (-465.226) (-465.049) (-459.801) [-458.209] * (-458.295) [-465.259] (-460.612) (-459.729) -- 0:00:28
551500 -- (-457.852) (-462.215) (-459.420) [-457.432] * (-458.243) (-461.888) [-460.156] (-459.988) -- 0:00:28
552000 -- (-462.112) [-460.790] (-458.654) (-457.384) * [-458.398] (-460.466) (-461.882) (-459.837) -- 0:00:28
552500 -- [-460.588] (-459.270) (-458.466) (-457.706) * (-460.940) (-462.047) [-458.573] (-465.155) -- 0:00:28
553000 -- [-460.638] (-458.651) (-459.931) (-460.869) * (-459.577) (-460.367) (-460.484) [-458.550] -- 0:00:28
553500 -- [-461.338] (-461.892) (-459.723) (-458.892) * (-460.994) [-459.466] (-459.210) (-458.332) -- 0:00:28
554000 -- [-460.157] (-461.865) (-458.740) (-459.021) * (-462.485) (-460.126) [-459.199] (-459.133) -- 0:00:28
554500 -- (-459.212) (-460.523) (-460.019) [-459.897] * [-460.460] (-460.926) (-459.214) (-461.066) -- 0:00:28
555000 -- [-462.984] (-458.453) (-461.395) (-460.957) * (-457.868) (-459.081) [-459.208] (-459.504) -- 0:00:28
Average standard deviation of split frequencies: 0.013778
555500 -- (-458.703) (-458.352) (-461.769) [-461.509] * (-463.546) [-458.220] (-462.277) (-460.859) -- 0:00:28
556000 -- (-459.359) (-461.223) [-458.669] (-458.736) * (-462.386) (-458.566) [-459.453] (-460.170) -- 0:00:28
556500 -- (-459.301) [-458.938] (-459.134) (-458.395) * (-460.321) (-459.043) [-460.113] (-458.839) -- 0:00:28
557000 -- (-459.395) (-459.991) (-460.167) [-457.661] * [-459.092] (-459.000) (-459.693) (-458.445) -- 0:00:28
557500 -- (-458.284) [-461.987] (-459.396) (-458.486) * (-460.186) [-460.972] (-459.798) (-463.622) -- 0:00:28
558000 -- (-458.080) (-458.348) [-460.668] (-458.935) * (-461.099) (-459.613) (-459.374) [-460.487] -- 0:00:28
558500 -- (-458.383) (-458.193) [-459.902] (-459.001) * [-458.159] (-459.223) (-458.654) (-459.486) -- 0:00:28
559000 -- (-458.124) [-458.444] (-458.607) (-460.686) * (-464.571) (-460.402) [-457.889] (-459.727) -- 0:00:28
559500 -- (-460.173) (-459.211) [-458.581] (-460.811) * (-463.296) (-459.087) (-460.066) [-458.580] -- 0:00:28
560000 -- (-459.403) (-461.065) (-459.439) [-459.119] * (-461.538) (-459.187) [-461.110] (-459.416) -- 0:00:28
Average standard deviation of split frequencies: 0.013610
560500 -- [-458.301] (-459.520) (-462.680) (-459.453) * [-458.592] (-461.103) (-458.702) (-461.382) -- 0:00:28
561000 -- (-462.625) [-460.348] (-461.453) (-462.411) * [-459.830] (-458.605) (-458.962) (-458.969) -- 0:00:28
561500 -- (-465.825) [-459.348] (-460.316) (-458.071) * [-458.313] (-461.545) (-460.297) (-459.217) -- 0:00:28
562000 -- (-465.063) [-462.158] (-460.800) (-458.243) * (-459.022) (-459.761) [-460.258] (-460.360) -- 0:00:28
562500 -- [-458.472] (-464.720) (-460.340) (-460.987) * (-461.657) (-463.422) [-460.385] (-460.653) -- 0:00:28
563000 -- [-464.417] (-458.064) (-460.135) (-460.591) * (-462.759) [-460.144] (-460.178) (-459.450) -- 0:00:27
563500 -- [-462.780] (-458.801) (-459.668) (-458.377) * [-460.535] (-458.340) (-461.445) (-458.488) -- 0:00:27
564000 -- [-459.503] (-460.275) (-458.370) (-459.981) * (-459.646) (-461.510) (-457.972) [-460.323] -- 0:00:27
564500 -- (-458.193) (-459.964) (-458.519) [-458.951] * (-459.032) (-460.676) [-458.473] (-458.426) -- 0:00:27
565000 -- [-457.476] (-459.630) (-459.893) (-458.347) * (-458.765) (-460.492) [-460.421] (-458.041) -- 0:00:27
Average standard deviation of split frequencies: 0.013586
565500 -- (-457.729) (-460.266) [-458.582] (-458.725) * [-462.512] (-457.648) (-460.237) (-458.833) -- 0:00:27
566000 -- [-459.125] (-461.239) (-458.372) (-458.653) * (-463.498) (-460.005) (-458.649) [-460.773] -- 0:00:27
566500 -- (-459.948) (-459.293) (-460.794) [-459.817] * (-459.971) (-459.888) (-458.953) [-459.770] -- 0:00:27
567000 -- [-458.420] (-462.341) (-462.671) (-459.400) * (-465.421) [-460.398] (-463.381) (-458.860) -- 0:00:27
567500 -- [-457.791] (-458.089) (-460.728) (-460.115) * (-461.932) (-460.206) [-461.321] (-459.334) -- 0:00:27
568000 -- (-458.093) (-459.201) (-460.493) [-460.283] * (-461.438) [-458.279] (-459.514) (-458.672) -- 0:00:27
568500 -- (-460.967) [-457.975] (-458.551) (-459.036) * (-458.862) (-459.526) (-459.177) [-458.310] -- 0:00:27
569000 -- (-458.177) (-458.576) (-458.507) [-458.639] * (-457.782) (-459.604) [-458.544] (-460.870) -- 0:00:27
569500 -- [-459.679] (-462.665) (-460.885) (-457.428) * (-462.338) [-458.351] (-458.434) (-458.130) -- 0:00:27
570000 -- [-459.152] (-463.814) (-460.302) (-461.621) * (-460.895) (-458.494) (-457.963) [-458.236] -- 0:00:27
Average standard deviation of split frequencies: 0.013475
570500 -- (-459.661) [-462.869] (-461.700) (-461.281) * (-459.166) (-457.770) [-458.022] (-461.639) -- 0:00:27
571000 -- (-463.799) (-459.767) (-460.510) [-460.043] * (-458.500) (-462.378) (-458.252) [-458.771] -- 0:00:27
571500 -- [-459.235] (-460.048) (-460.229) (-458.256) * (-459.223) (-458.130) (-459.831) [-458.211] -- 0:00:27
572000 -- (-458.432) (-460.694) (-458.301) [-460.910] * [-459.894] (-457.983) (-459.977) (-458.882) -- 0:00:27
572500 -- (-462.575) (-459.762) (-460.276) [-459.756] * (-458.055) [-459.055] (-460.111) (-459.139) -- 0:00:27
573000 -- (-459.821) (-458.965) (-460.162) [-460.228] * (-461.552) (-460.209) (-458.174) [-458.686] -- 0:00:27
573500 -- (-465.414) [-458.527] (-462.053) (-464.877) * [-465.439] (-460.927) (-460.672) (-460.379) -- 0:00:27
574000 -- (-463.792) [-458.996] (-458.669) (-459.426) * (-461.251) [-461.480] (-458.492) (-460.204) -- 0:00:27
574500 -- (-463.670) (-459.922) [-457.945] (-459.148) * (-458.985) [-458.387] (-459.674) (-458.381) -- 0:00:27
575000 -- [-459.380] (-461.577) (-458.063) (-463.702) * [-460.976] (-459.870) (-458.908) (-460.680) -- 0:00:27
Average standard deviation of split frequencies: 0.013760
575500 -- [-458.457] (-460.988) (-459.040) (-460.528) * (-459.538) (-464.257) [-458.560] (-465.160) -- 0:00:27
576000 -- (-458.496) [-462.121] (-459.264) (-462.406) * [-460.993] (-459.928) (-459.438) (-459.505) -- 0:00:27
576500 -- (-459.855) [-458.793] (-459.979) (-465.054) * (-458.686) (-457.738) [-458.370] (-458.654) -- 0:00:27
577000 -- (-458.841) (-462.555) (-461.977) [-465.243] * [-459.246] (-459.764) (-460.626) (-460.225) -- 0:00:27
577500 -- (-459.989) [-462.712] (-459.929) (-462.281) * (-458.479) (-459.412) [-460.421] (-462.152) -- 0:00:27
578000 -- [-459.264] (-461.539) (-457.674) (-458.633) * (-459.961) [-460.770] (-459.148) (-461.124) -- 0:00:27
578500 -- (-462.000) (-460.425) (-459.768) [-459.013] * (-459.355) (-464.315) (-460.512) [-460.069] -- 0:00:26
579000 -- [-461.352] (-460.355) (-459.770) (-459.317) * (-458.871) [-460.655] (-460.240) (-460.135) -- 0:00:26
579500 -- (-460.107) (-465.067) [-459.048] (-466.477) * [-460.518] (-458.112) (-458.927) (-460.746) -- 0:00:26
580000 -- (-461.564) (-458.719) (-460.314) [-459.968] * (-459.487) (-461.008) [-458.864] (-459.958) -- 0:00:26
Average standard deviation of split frequencies: 0.013142
580500 -- (-460.163) (-457.813) [-459.540] (-460.970) * [-459.359] (-460.490) (-459.248) (-462.638) -- 0:00:26
581000 -- (-458.371) (-458.424) (-464.850) [-462.427] * (-460.910) [-458.969] (-460.664) (-463.388) -- 0:00:26
581500 -- [-459.047] (-458.862) (-460.410) (-459.769) * [-459.535] (-461.604) (-462.107) (-467.108) -- 0:00:26
582000 -- (-460.299) [-458.989] (-459.346) (-459.518) * (-464.768) [-458.722] (-459.269) (-460.105) -- 0:00:26
582500 -- [-459.616] (-459.056) (-466.327) (-459.196) * [-458.444] (-460.621) (-460.136) (-459.699) -- 0:00:26
583000 -- (-462.369) (-458.507) (-468.353) [-459.708] * (-461.167) (-463.991) [-458.308] (-460.185) -- 0:00:26
583500 -- [-460.282] (-457.946) (-459.096) (-461.793) * [-460.017] (-459.957) (-457.792) (-459.279) -- 0:00:26
584000 -- (-460.912) (-459.106) (-462.304) [-463.115] * (-465.468) [-463.676] (-460.142) (-457.621) -- 0:00:26
584500 -- (-458.755) [-460.859] (-461.570) (-463.104) * (-468.320) (-460.826) (-460.364) [-460.429] -- 0:00:26
585000 -- (-458.760) (-459.943) [-460.832] (-461.141) * (-460.092) [-462.055] (-461.433) (-459.054) -- 0:00:26
Average standard deviation of split frequencies: 0.013155
585500 -- [-459.042] (-459.917) (-458.088) (-458.392) * (-460.057) (-460.459) [-458.859] (-462.197) -- 0:00:26
586000 -- [-457.448] (-460.463) (-458.573) (-459.698) * (-459.021) [-458.203] (-459.554) (-460.359) -- 0:00:26
586500 -- (-458.983) (-461.006) (-460.582) [-460.199] * (-460.387) (-465.339) [-457.811] (-458.767) -- 0:00:26
587000 -- (-460.821) (-459.947) (-461.900) [-461.141] * [-459.295] (-463.267) (-464.453) (-459.697) -- 0:00:26
587500 -- (-463.076) (-459.226) [-458.811] (-459.540) * (-461.425) [-460.472] (-460.775) (-460.912) -- 0:00:26
588000 -- (-459.264) (-459.434) (-458.498) [-461.598] * (-461.105) [-462.747] (-460.139) (-463.416) -- 0:00:26
588500 -- (-460.865) (-459.895) [-459.269] (-457.786) * (-460.240) [-459.747] (-460.877) (-461.467) -- 0:00:26
589000 -- (-457.743) (-459.142) [-460.519] (-461.563) * (-461.124) [-460.138] (-462.376) (-463.331) -- 0:00:26
589500 -- (-460.417) (-458.480) (-458.943) [-459.928] * (-461.002) (-462.110) (-459.719) [-458.790] -- 0:00:26
590000 -- [-458.309] (-459.307) (-457.947) (-459.001) * (-461.500) (-461.568) [-458.760] (-459.744) -- 0:00:26
Average standard deviation of split frequencies: 0.012271
590500 -- [-459.962] (-461.641) (-459.448) (-461.641) * [-460.130] (-458.816) (-458.652) (-458.515) -- 0:00:26
591000 -- (-458.416) (-459.272) (-459.509) [-460.289] * (-459.367) [-459.147] (-462.737) (-467.421) -- 0:00:26
591500 -- (-464.479) (-459.046) [-460.347] (-460.299) * (-459.711) (-458.807) [-459.205] (-457.903) -- 0:00:26
592000 -- (-462.199) (-460.051) [-458.515] (-461.574) * [-460.961] (-461.197) (-462.589) (-459.029) -- 0:00:26
592500 -- (-458.764) (-459.874) [-462.914] (-461.607) * (-464.552) (-460.727) (-457.958) [-458.899] -- 0:00:26
593000 -- (-461.308) (-459.740) [-457.654] (-461.977) * (-459.971) (-458.389) [-460.996] (-458.575) -- 0:00:26
593500 -- (-462.137) (-457.652) (-459.084) [-459.610] * [-459.244] (-463.275) (-458.196) (-463.150) -- 0:00:26
594000 -- (-459.138) (-460.076) (-461.296) [-459.052] * [-458.111] (-458.324) (-458.109) (-461.140) -- 0:00:25
594500 -- (-460.112) (-463.686) [-459.490] (-460.952) * (-459.950) [-458.345] (-461.359) (-475.217) -- 0:00:25
595000 -- (-462.139) [-464.853] (-461.374) (-464.123) * [-459.961] (-462.248) (-460.206) (-458.849) -- 0:00:25
Average standard deviation of split frequencies: 0.012556
595500 -- (-459.259) [-459.017] (-460.148) (-461.159) * (-458.986) [-460.430] (-457.922) (-459.526) -- 0:00:25
596000 -- (-461.781) (-457.863) (-459.989) [-459.913] * [-460.323] (-461.146) (-462.315) (-458.527) -- 0:00:25
596500 -- (-457.591) (-461.797) [-458.441] (-459.801) * (-458.260) (-461.788) (-458.938) [-459.340] -- 0:00:25
597000 -- (-460.551) (-461.519) (-459.170) [-458.837] * (-458.558) (-459.261) (-458.629) [-458.541] -- 0:00:25
597500 -- (-458.865) (-462.722) [-458.683] (-462.632) * (-458.745) (-460.700) (-460.675) [-457.683] -- 0:00:25
598000 -- (-458.099) [-461.422] (-459.146) (-462.570) * (-460.788) [-457.870] (-462.433) (-459.500) -- 0:00:25
598500 -- (-457.831) [-459.648] (-458.472) (-458.999) * (-459.178) [-458.365] (-466.019) (-460.155) -- 0:00:25
599000 -- (-459.676) (-458.767) [-458.469] (-459.817) * (-459.736) (-459.378) [-459.721] (-459.966) -- 0:00:25
599500 -- (-458.476) [-459.281] (-458.878) (-461.027) * [-459.528] (-458.207) (-461.632) (-458.772) -- 0:00:25
600000 -- (-459.768) (-459.078) (-460.035) [-460.699] * (-463.509) (-461.599) [-458.274] (-458.817) -- 0:00:25
Average standard deviation of split frequencies: 0.012557
600500 -- (-462.496) (-460.992) [-459.361] (-464.533) * [-460.750] (-459.266) (-457.922) (-458.829) -- 0:00:25
601000 -- (-464.798) [-460.072] (-460.942) (-465.949) * (-462.803) (-460.541) [-460.999] (-457.914) -- 0:00:25
601500 -- (-461.484) [-458.891] (-458.441) (-460.694) * (-459.408) [-461.518] (-463.738) (-464.780) -- 0:00:25
602000 -- (-462.121) (-462.044) [-460.627] (-460.399) * (-459.725) [-459.810] (-458.650) (-459.499) -- 0:00:25
602500 -- (-460.138) [-459.717] (-459.785) (-461.165) * (-458.761) [-459.140] (-459.201) (-458.381) -- 0:00:25
603000 -- (-460.103) (-458.658) [-460.007] (-461.295) * (-460.294) [-459.598] (-459.606) (-459.107) -- 0:00:25
603500 -- (-462.710) [-460.038] (-463.754) (-460.852) * (-461.570) [-459.331] (-462.879) (-463.000) -- 0:00:25
604000 -- (-466.996) [-462.765] (-462.297) (-458.348) * (-459.044) [-461.068] (-460.731) (-459.925) -- 0:00:25
604500 -- (-459.016) [-464.271] (-462.172) (-458.135) * [-458.945] (-461.042) (-460.039) (-460.445) -- 0:00:25
605000 -- (-459.921) (-458.467) [-459.759] (-459.756) * (-458.287) [-459.109] (-461.806) (-461.597) -- 0:00:25
Average standard deviation of split frequencies: 0.012031
605500 -- (-459.355) [-459.645] (-459.854) (-460.877) * (-462.866) (-462.888) [-461.700] (-460.845) -- 0:00:25
606000 -- [-460.848] (-466.355) (-459.173) (-464.720) * (-459.644) [-459.699] (-459.211) (-459.062) -- 0:00:25
606500 -- (-459.624) (-459.432) (-459.820) [-459.894] * [-461.786] (-461.186) (-459.637) (-458.754) -- 0:00:25
607000 -- [-462.242] (-459.586) (-460.961) (-462.691) * (-460.917) [-458.536] (-459.584) (-458.277) -- 0:00:25
607500 -- (-461.551) (-461.667) [-460.333] (-462.310) * (-461.590) (-458.186) [-460.151] (-460.131) -- 0:00:25
608000 -- (-459.304) (-461.468) [-461.887] (-461.854) * (-459.374) (-459.752) (-457.978) [-463.185] -- 0:00:25
608500 -- (-460.927) [-460.352] (-461.459) (-460.821) * [-457.982] (-457.967) (-464.581) (-459.294) -- 0:00:25
609000 -- (-460.088) (-457.795) (-460.659) [-460.506] * (-458.284) (-458.640) (-464.462) [-459.691] -- 0:00:25
609500 -- (-459.478) [-459.440] (-462.348) (-467.610) * (-460.022) (-458.016) (-458.820) [-461.123] -- 0:00:24
610000 -- [-459.027] (-458.748) (-460.706) (-462.886) * [-460.241] (-460.640) (-460.673) (-461.117) -- 0:00:24
Average standard deviation of split frequencies: 0.011270
610500 -- [-458.395] (-458.930) (-460.407) (-463.085) * (-460.075) (-458.077) (-460.431) [-459.994] -- 0:00:24
611000 -- (-462.186) (-462.880) [-460.874] (-460.772) * (-459.823) (-461.173) (-460.449) [-458.505] -- 0:00:24
611500 -- (-462.166) (-461.054) [-458.740] (-462.669) * (-460.083) [-460.015] (-464.232) (-461.417) -- 0:00:24
612000 -- (-460.649) [-460.722] (-458.904) (-462.431) * (-462.454) (-460.956) (-463.052) [-462.514] -- 0:00:24
612500 -- [-459.994] (-458.644) (-458.809) (-460.309) * (-459.486) (-460.831) [-460.832] (-469.655) -- 0:00:24
613000 -- (-460.418) (-459.537) [-460.048] (-462.429) * (-461.214) [-461.304] (-460.465) (-459.654) -- 0:00:24
613500 -- (-460.994) (-462.198) (-459.095) [-458.849] * (-461.286) (-459.000) [-459.212] (-463.476) -- 0:00:24
614000 -- (-459.529) (-459.767) [-458.389] (-459.283) * (-462.099) [-458.375] (-459.424) (-459.080) -- 0:00:24
614500 -- (-462.072) [-458.881] (-461.529) (-459.837) * (-460.887) (-458.372) (-460.141) [-458.150] -- 0:00:24
615000 -- [-459.159] (-460.688) (-459.132) (-466.018) * (-462.263) [-458.331] (-458.207) (-459.948) -- 0:00:24
Average standard deviation of split frequencies: 0.010867
615500 -- [-458.348] (-461.650) (-458.063) (-459.055) * (-463.265) (-458.467) [-458.478] (-458.870) -- 0:00:24
616000 -- (-457.602) [-457.868] (-459.059) (-461.017) * (-461.895) (-457.988) (-460.066) [-458.677] -- 0:00:24
616500 -- (-461.081) [-458.641] (-459.743) (-461.350) * (-461.995) (-458.514) [-460.969] (-459.740) -- 0:00:24
617000 -- (-457.850) [-461.061] (-457.829) (-459.455) * (-459.568) (-460.129) (-463.378) [-458.275] -- 0:00:24
617500 -- [-458.277] (-459.588) (-460.682) (-458.617) * (-462.498) (-460.193) [-460.506] (-458.245) -- 0:00:24
618000 -- (-458.919) (-460.603) [-459.350] (-462.970) * (-459.089) (-457.930) (-458.674) [-460.002] -- 0:00:24
618500 -- [-458.633] (-459.252) (-459.997) (-458.087) * (-463.217) (-459.208) [-460.024] (-459.669) -- 0:00:24
619000 -- (-458.936) (-460.496) (-458.916) [-463.990] * (-462.164) [-459.393] (-458.840) (-460.611) -- 0:00:24
619500 -- (-458.934) [-463.155] (-458.912) (-462.369) * [-465.401] (-458.281) (-458.534) (-461.309) -- 0:00:24
620000 -- (-460.105) [-458.681] (-457.883) (-459.420) * (-467.290) (-458.728) (-462.196) [-462.170] -- 0:00:24
Average standard deviation of split frequencies: 0.011443
620500 -- (-462.679) (-459.345) (-457.903) [-458.859] * (-466.598) (-459.638) (-459.257) [-461.030] -- 0:00:24
621000 -- [-464.568] (-459.767) (-462.301) (-459.680) * (-461.668) (-461.041) [-459.931] (-458.584) -- 0:00:24
621500 -- (-457.648) (-462.349) [-459.835] (-459.066) * (-458.467) (-464.822) (-461.186) [-458.166] -- 0:00:24
622000 -- [-460.763] (-458.664) (-460.603) (-459.077) * (-458.172) (-464.113) (-461.126) [-458.105] -- 0:00:24
622500 -- [-459.572] (-458.310) (-459.173) (-459.605) * [-458.901] (-465.860) (-458.658) (-458.172) -- 0:00:24
623000 -- (-458.800) (-462.948) [-461.293] (-459.661) * (-465.296) (-458.332) [-459.961] (-462.201) -- 0:00:24
623500 -- (-459.063) (-458.223) [-459.498] (-462.404) * [-459.207] (-458.948) (-462.405) (-461.652) -- 0:00:24
624000 -- (-459.105) [-457.961] (-459.060) (-459.449) * (-459.849) [-460.597] (-463.201) (-459.085) -- 0:00:24
624500 -- (-464.303) (-459.133) [-461.076] (-463.021) * (-460.399) (-458.970) (-462.472) [-458.160] -- 0:00:24
625000 -- (-460.209) (-458.503) (-463.163) [-460.200] * (-460.734) (-462.307) [-458.307] (-458.375) -- 0:00:24
Average standard deviation of split frequencies: 0.011798
625500 -- (-460.690) [-459.776] (-459.917) (-458.179) * (-462.195) (-459.234) (-460.920) [-459.964] -- 0:00:23
626000 -- [-458.142] (-459.563) (-457.775) (-457.871) * (-459.373) (-460.630) [-461.198] (-458.698) -- 0:00:23
626500 -- (-458.579) (-458.823) [-460.661] (-458.433) * (-461.532) (-463.605) (-457.596) [-458.769] -- 0:00:23
627000 -- (-459.861) (-460.088) (-458.897) [-458.333] * (-465.935) (-462.464) [-458.243] (-464.892) -- 0:00:23
627500 -- (-459.749) (-458.513) (-458.492) [-466.954] * (-468.402) (-460.663) [-458.759] (-459.069) -- 0:00:23
628000 -- [-457.424] (-461.496) (-458.470) (-460.582) * (-463.602) [-460.754] (-458.126) (-459.327) -- 0:00:23
628500 -- (-458.061) (-464.549) [-459.533] (-458.586) * (-458.112) (-461.561) [-459.799] (-459.005) -- 0:00:23
629000 -- (-459.084) (-464.747) [-461.196] (-462.343) * [-458.901] (-460.538) (-459.710) (-458.630) -- 0:00:23
629500 -- (-460.141) (-461.732) (-459.141) [-460.087] * (-461.077) [-457.915] (-460.776) (-460.536) -- 0:00:23
630000 -- [-461.169] (-463.947) (-458.487) (-459.118) * (-463.119) (-458.770) (-459.393) [-460.184] -- 0:00:23
Average standard deviation of split frequencies: 0.012009
630500 -- (-459.921) (-459.687) [-463.142] (-458.358) * (-466.100) (-460.024) (-458.231) [-460.230] -- 0:00:23
631000 -- (-460.147) (-459.137) (-466.864) [-460.267] * (-459.245) (-459.200) (-458.634) [-459.928] -- 0:00:23
631500 -- (-459.416) [-459.647] (-466.050) (-462.756) * (-460.112) (-459.194) [-462.412] (-459.007) -- 0:00:23
632000 -- [-458.181] (-467.252) (-459.587) (-459.865) * [-459.616] (-463.075) (-461.275) (-458.227) -- 0:00:23
632500 -- (-459.148) (-461.846) [-460.586] (-459.805) * [-458.865] (-464.201) (-460.553) (-459.421) -- 0:00:23
633000 -- (-458.523) [-460.412] (-458.849) (-461.333) * [-458.170] (-461.572) (-459.789) (-459.943) -- 0:00:23
633500 -- (-458.182) (-463.432) (-458.427) [-458.205] * (-458.881) [-459.987] (-459.338) (-460.810) -- 0:00:23
634000 -- (-458.931) [-459.167] (-457.522) (-459.318) * [-458.794] (-461.651) (-461.606) (-458.902) -- 0:00:23
634500 -- (-459.188) (-459.674) (-457.785) [-459.755] * (-458.677) [-460.594] (-461.452) (-459.866) -- 0:00:23
635000 -- (-458.036) (-458.562) (-458.713) [-458.657] * (-459.915) (-461.018) (-461.219) [-458.104] -- 0:00:23
Average standard deviation of split frequencies: 0.012551
635500 -- (-458.591) (-461.247) [-460.792] (-457.613) * (-459.415) (-459.369) (-461.821) [-460.991] -- 0:00:23
636000 -- [-459.720] (-464.482) (-459.122) (-458.727) * [-460.730] (-459.106) (-459.107) (-459.525) -- 0:00:23
636500 -- [-458.337] (-462.552) (-459.322) (-461.585) * (-458.598) (-460.243) [-458.448] (-459.127) -- 0:00:23
637000 -- [-459.542] (-462.976) (-463.530) (-461.892) * [-459.571] (-462.153) (-462.260) (-458.924) -- 0:00:23
637500 -- (-461.581) (-461.345) (-462.089) [-461.488] * (-459.200) [-458.147] (-460.139) (-462.809) -- 0:00:23
638000 -- (-458.037) (-462.484) [-459.927] (-464.586) * (-463.166) (-457.821) [-459.396] (-459.200) -- 0:00:23
638500 -- (-462.777) (-462.251) (-464.238) [-458.601] * (-464.239) [-458.301] (-461.046) (-459.693) -- 0:00:23
639000 -- (-459.307) [-462.756] (-462.842) (-461.546) * (-460.458) (-462.792) [-460.584] (-458.282) -- 0:00:23
639500 -- [-459.747] (-461.046) (-460.307) (-462.667) * (-460.422) (-459.505) [-462.183] (-461.233) -- 0:00:23
640000 -- (-461.293) (-459.425) (-463.746) [-463.438] * (-458.642) (-459.117) [-460.362] (-461.451) -- 0:00:23
Average standard deviation of split frequencies: 0.012999
640500 -- [-458.501] (-458.225) (-461.489) (-466.920) * (-459.734) [-460.197] (-459.969) (-460.405) -- 0:00:23
641000 -- (-459.600) (-458.781) [-459.017] (-463.106) * [-458.810] (-463.437) (-459.798) (-459.995) -- 0:00:22
641500 -- (-460.730) (-459.702) (-459.263) [-461.045] * (-459.508) (-459.051) (-459.215) [-460.536] -- 0:00:22
642000 -- [-458.761] (-460.161) (-458.097) (-458.430) * (-463.071) (-459.158) [-458.743] (-460.482) -- 0:00:22
642500 -- (-458.785) (-463.778) [-457.660] (-459.574) * (-457.497) (-460.290) [-457.882] (-459.516) -- 0:00:22
643000 -- (-461.133) (-461.018) (-459.285) [-458.377] * (-461.333) [-459.108] (-459.603) (-460.855) -- 0:00:22
643500 -- (-460.392) (-458.542) (-458.908) [-458.962] * [-459.935] (-465.345) (-460.890) (-459.501) -- 0:00:22
644000 -- (-459.866) (-460.083) (-463.588) [-460.340] * (-461.895) [-458.149] (-459.024) (-460.403) -- 0:00:22
644500 -- [-458.661] (-459.833) (-457.858) (-460.040) * [-463.528] (-463.078) (-459.786) (-460.905) -- 0:00:22
645000 -- [-460.391] (-465.494) (-457.940) (-459.172) * (-462.721) [-459.975] (-459.406) (-457.914) -- 0:00:22
Average standard deviation of split frequencies: 0.013135
645500 -- (-461.431) (-465.135) [-457.982] (-461.178) * [-463.985] (-460.215) (-462.829) (-460.848) -- 0:00:22
646000 -- (-458.672) (-460.548) (-458.272) [-460.673] * (-464.423) (-460.007) (-464.401) [-458.376] -- 0:00:22
646500 -- [-458.926] (-464.220) (-459.760) (-460.257) * (-465.131) (-457.937) [-458.054] (-459.262) -- 0:00:22
647000 -- (-460.346) [-459.280] (-460.010) (-457.700) * (-458.315) [-458.336] (-460.130) (-459.231) -- 0:00:22
647500 -- (-460.024) [-461.910] (-460.463) (-459.655) * (-458.699) (-460.367) [-460.717] (-462.697) -- 0:00:22
648000 -- [-460.007] (-464.026) (-461.259) (-460.359) * (-462.782) [-462.356] (-458.830) (-473.057) -- 0:00:22
648500 -- (-458.842) (-461.825) [-459.088] (-461.033) * [-460.304] (-461.185) (-460.328) (-464.426) -- 0:00:22
649000 -- (-461.968) [-460.122] (-458.482) (-459.533) * (-459.532) [-461.172] (-460.698) (-462.779) -- 0:00:22
649500 -- [-459.505] (-458.611) (-460.852) (-459.141) * (-458.611) (-459.184) [-461.184] (-458.741) -- 0:00:22
650000 -- [-458.530] (-458.384) (-460.749) (-461.589) * (-457.686) [-457.972] (-462.928) (-460.184) -- 0:00:22
Average standard deviation of split frequencies: 0.013814
650500 -- (-457.902) (-461.090) [-459.848] (-461.573) * [-459.231] (-459.357) (-460.276) (-465.504) -- 0:00:22
651000 -- (-458.630) (-458.542) (-457.732) [-460.431] * (-458.740) (-460.983) [-461.220] (-461.419) -- 0:00:22
651500 -- (-459.184) (-458.763) [-464.491] (-461.326) * (-460.349) (-459.765) (-457.669) [-458.452] -- 0:00:22
652000 -- [-460.073] (-458.815) (-461.436) (-462.706) * (-457.753) (-458.112) (-461.194) [-459.043] -- 0:00:22
652500 -- (-459.952) [-459.492] (-459.335) (-459.112) * (-458.090) [-460.227] (-462.469) (-458.495) -- 0:00:22
653000 -- (-463.626) (-458.202) (-462.538) [-458.454] * (-463.421) [-459.990] (-460.981) (-460.057) -- 0:00:22
653500 -- (-460.620) (-460.058) (-461.276) [-459.584] * (-460.505) [-458.958] (-459.093) (-458.855) -- 0:00:22
654000 -- (-459.471) (-460.451) (-459.336) [-458.986] * [-459.150] (-460.301) (-461.422) (-461.378) -- 0:00:22
654500 -- (-457.907) (-459.414) [-459.204] (-465.005) * [-458.755] (-459.280) (-459.717) (-461.131) -- 0:00:22
655000 -- (-458.423) (-465.143) [-464.559] (-460.800) * [-459.546] (-466.568) (-461.200) (-459.221) -- 0:00:22
Average standard deviation of split frequencies: 0.013893
655500 -- (-458.285) [-458.382] (-462.490) (-458.375) * (-460.034) (-462.100) [-463.867] (-459.420) -- 0:00:22
656000 -- (-457.795) (-458.377) [-459.687] (-461.360) * [-459.431] (-460.422) (-458.535) (-458.227) -- 0:00:22
656500 -- (-458.396) (-459.775) (-458.278) [-460.032] * (-458.785) (-460.432) [-461.361] (-460.262) -- 0:00:21
657000 -- [-458.646] (-460.802) (-461.353) (-459.248) * [-457.972] (-459.008) (-459.251) (-459.579) -- 0:00:21
657500 -- (-458.722) (-458.999) (-462.605) [-459.343] * (-460.157) (-458.427) (-461.252) [-458.027] -- 0:00:21
658000 -- (-458.415) [-460.099] (-459.651) (-458.065) * [-459.075] (-457.753) (-460.810) (-458.590) -- 0:00:21
658500 -- [-459.032] (-465.929) (-460.718) (-461.234) * [-461.249] (-458.878) (-460.904) (-459.351) -- 0:00:21
659000 -- (-459.694) (-462.112) [-459.029] (-461.310) * (-460.839) (-460.464) (-461.511) [-461.352] -- 0:00:21
659500 -- (-459.742) [-459.316] (-462.760) (-461.618) * (-464.013) [-459.895] (-462.672) (-458.508) -- 0:00:21
660000 -- [-459.969] (-460.209) (-459.250) (-460.774) * (-464.167) (-458.835) (-462.248) [-459.269] -- 0:00:21
Average standard deviation of split frequencies: 0.014080
660500 -- (-461.022) (-462.217) [-459.577] (-459.378) * [-459.323] (-458.901) (-460.675) (-462.187) -- 0:00:21
661000 -- (-460.898) (-458.859) (-460.244) [-459.841] * (-457.969) (-457.628) [-461.340] (-459.626) -- 0:00:21
661500 -- (-459.634) [-459.318] (-458.636) (-460.561) * (-457.816) [-458.486] (-461.264) (-459.539) -- 0:00:21
662000 -- (-459.773) (-458.620) [-461.030] (-459.906) * [-459.758] (-460.305) (-460.869) (-460.954) -- 0:00:21
662500 -- [-458.681] (-462.617) (-460.073) (-459.452) * [-461.290] (-458.574) (-461.441) (-464.017) -- 0:00:21
663000 -- (-458.041) (-459.815) [-459.255] (-459.147) * (-458.647) (-462.730) [-458.079] (-459.542) -- 0:00:21
663500 -- (-459.487) [-459.535] (-461.089) (-459.244) * (-462.590) [-458.479] (-459.251) (-462.324) -- 0:00:21
664000 -- [-459.520] (-458.767) (-462.417) (-458.605) * [-459.152] (-459.237) (-460.012) (-458.601) -- 0:00:21
664500 -- [-459.851] (-459.831) (-460.867) (-461.445) * (-457.625) (-458.262) [-459.488] (-459.466) -- 0:00:21
665000 -- [-458.089] (-458.712) (-461.660) (-460.320) * (-459.308) [-459.075] (-459.459) (-462.349) -- 0:00:21
Average standard deviation of split frequencies: 0.014109
665500 -- (-459.100) (-457.751) (-459.978) [-458.954] * (-461.901) (-460.248) (-459.644) [-457.795] -- 0:00:21
666000 -- (-459.790) [-462.443] (-458.340) (-459.666) * [-459.561] (-458.946) (-462.074) (-458.635) -- 0:00:21
666500 -- (-461.431) (-462.950) [-458.116] (-461.985) * (-459.830) [-458.983] (-460.981) (-459.667) -- 0:00:21
667000 -- (-459.041) [-461.518] (-461.064) (-458.917) * (-461.824) [-461.149] (-461.061) (-464.381) -- 0:00:21
667500 -- [-460.308] (-462.660) (-458.996) (-458.394) * [-458.626] (-461.282) (-458.895) (-460.065) -- 0:00:21
668000 -- (-460.024) [-459.380] (-461.037) (-459.116) * (-459.334) (-460.163) (-458.588) [-458.787] -- 0:00:21
668500 -- [-462.875] (-461.252) (-459.873) (-461.103) * (-458.969) [-465.222] (-459.692) (-461.966) -- 0:00:21
669000 -- (-462.112) [-460.308] (-461.587) (-460.041) * (-460.429) [-459.591] (-457.654) (-461.219) -- 0:00:21
669500 -- (-472.101) (-460.367) [-462.501] (-461.541) * (-460.766) (-463.048) [-457.460] (-462.792) -- 0:00:21
670000 -- (-464.229) (-459.952) (-461.741) [-461.164] * (-465.872) (-458.015) [-459.978] (-462.449) -- 0:00:21
Average standard deviation of split frequencies: 0.013311
670500 -- (-459.177) (-461.215) (-462.734) [-462.125] * (-459.862) (-459.938) (-461.198) [-459.279] -- 0:00:21
671000 -- (-459.158) (-461.230) (-459.604) [-458.370] * (-459.073) (-460.403) [-460.671] (-459.233) -- 0:00:21
671500 -- (-460.784) (-459.497) (-459.222) [-460.342] * (-461.692) (-459.315) [-460.102] (-462.054) -- 0:00:21
672000 -- (-460.262) (-462.692) [-459.151] (-468.339) * [-459.844] (-458.208) (-460.223) (-461.422) -- 0:00:20
672500 -- (-459.766) (-461.421) (-461.507) [-458.051] * (-459.481) (-460.931) [-459.371] (-463.782) -- 0:00:20
673000 -- [-459.758] (-461.304) (-458.562) (-458.256) * (-459.538) (-460.583) (-458.980) [-461.871] -- 0:00:20
673500 -- (-459.816) (-464.536) [-458.929] (-458.711) * (-459.618) [-459.228] (-458.498) (-459.027) -- 0:00:20
674000 -- (-460.797) [-459.463] (-460.345) (-463.402) * (-458.338) [-458.384] (-459.608) (-459.901) -- 0:00:20
674500 -- (-459.924) (-460.433) [-458.933] (-458.971) * [-459.558] (-459.942) (-459.267) (-458.856) -- 0:00:20
675000 -- (-459.509) [-458.693] (-459.739) (-460.136) * (-466.223) [-459.143] (-459.175) (-460.555) -- 0:00:20
Average standard deviation of split frequencies: 0.013343
675500 -- (-460.389) (-458.933) [-458.503] (-461.408) * [-459.606] (-460.627) (-460.204) (-460.621) -- 0:00:20
676000 -- (-458.743) [-458.216] (-459.119) (-461.579) * (-460.244) (-463.328) [-458.655] (-462.728) -- 0:00:20
676500 -- (-460.451) [-458.080] (-459.052) (-463.038) * [-458.741] (-459.525) (-457.970) (-459.480) -- 0:00:20
677000 -- (-459.908) (-457.913) (-459.109) [-459.567] * (-459.539) (-459.146) (-457.558) [-458.342] -- 0:00:20
677500 -- (-459.134) (-460.008) [-458.588] (-461.834) * (-461.388) [-457.876] (-460.076) (-458.090) -- 0:00:20
678000 -- (-458.206) (-460.093) [-457.991] (-462.197) * (-459.074) (-458.340) [-458.121] (-459.892) -- 0:00:20
678500 -- [-458.377] (-458.551) (-458.638) (-464.031) * (-462.490) (-465.476) (-458.878) [-460.036] -- 0:00:20
679000 -- (-460.313) (-460.433) (-458.640) [-460.692] * (-460.010) (-459.641) (-457.844) [-459.094] -- 0:00:20
679500 -- [-461.863] (-459.286) (-462.987) (-460.096) * (-464.999) [-458.717] (-460.992) (-460.257) -- 0:00:20
680000 -- (-459.091) [-459.320] (-463.187) (-463.521) * (-459.298) (-458.657) [-459.481] (-460.371) -- 0:00:20
Average standard deviation of split frequencies: 0.013113
680500 -- [-460.634] (-461.096) (-459.343) (-460.490) * (-461.431) (-460.242) (-459.196) [-463.545] -- 0:00:20
681000 -- (-458.624) (-459.279) (-464.088) [-457.598] * (-465.221) (-460.923) (-459.779) [-458.468] -- 0:00:20
681500 -- (-460.356) (-460.162) (-462.806) [-458.132] * (-470.031) (-460.394) [-462.165] (-459.166) -- 0:00:20
682000 -- (-460.276) [-458.522] (-460.124) (-458.284) * (-464.153) (-458.766) (-461.707) [-458.498] -- 0:00:20
682500 -- (-464.591) (-458.379) (-459.887) [-460.038] * (-463.524) [-463.611] (-460.286) (-460.911) -- 0:00:20
683000 -- (-462.054) (-459.115) (-459.528) [-461.352] * (-458.830) (-460.305) (-459.470) [-458.528] -- 0:00:20
683500 -- (-459.570) [-461.806] (-459.825) (-460.867) * (-460.358) (-460.147) [-460.205] (-461.801) -- 0:00:20
684000 -- [-464.154] (-459.345) (-458.716) (-462.076) * (-462.573) (-458.214) [-461.130] (-460.518) -- 0:00:20
684500 -- [-461.579] (-459.827) (-458.010) (-458.483) * (-459.008) (-459.157) (-463.939) [-459.436] -- 0:00:20
685000 -- (-463.233) [-460.476] (-460.093) (-459.129) * [-460.380] (-463.743) (-463.207) (-461.063) -- 0:00:20
Average standard deviation of split frequencies: 0.013011
685500 -- (-458.273) (-465.719) (-459.258) [-458.980] * [-458.400] (-461.923) (-460.187) (-465.149) -- 0:00:20
686000 -- [-459.644] (-460.111) (-458.771) (-458.535) * (-460.725) [-458.755] (-459.734) (-461.232) -- 0:00:20
686500 -- (-463.626) (-463.306) [-460.261] (-459.734) * (-458.873) [-461.874] (-458.944) (-461.379) -- 0:00:20
687000 -- (-460.897) (-464.852) (-460.145) [-460.531] * (-458.941) (-460.230) [-457.419] (-460.283) -- 0:00:20
687500 -- [-460.858] (-458.679) (-460.266) (-459.532) * (-458.132) (-462.845) [-459.481] (-459.561) -- 0:00:20
688000 -- (-458.047) (-460.302) (-459.300) [-461.434] * [-458.892] (-463.632) (-459.754) (-459.469) -- 0:00:19
688500 -- (-460.133) (-461.146) [-460.847] (-460.683) * (-460.956) (-462.210) (-463.903) [-458.269] -- 0:00:19
689000 -- (-459.245) [-458.895] (-459.265) (-459.210) * [-458.451] (-461.671) (-458.217) (-461.543) -- 0:00:19
689500 -- (-458.355) (-458.322) [-458.805] (-461.955) * [-459.379] (-458.921) (-459.349) (-461.586) -- 0:00:19
690000 -- (-458.990) [-460.614] (-460.425) (-459.580) * [-458.524] (-461.546) (-458.746) (-459.065) -- 0:00:19
Average standard deviation of split frequencies: 0.012968
690500 -- (-459.165) [-459.929] (-459.661) (-459.381) * (-458.377) (-460.309) [-458.740] (-458.345) -- 0:00:19
691000 -- (-459.579) (-459.454) [-459.702] (-463.059) * (-457.652) [-461.215] (-459.653) (-458.315) -- 0:00:19
691500 -- [-460.527] (-457.994) (-462.640) (-462.283) * [-461.066] (-458.154) (-465.299) (-459.633) -- 0:00:19
692000 -- (-460.666) (-458.651) (-459.515) [-462.813] * [-459.529] (-460.184) (-461.185) (-459.472) -- 0:00:19
692500 -- (-462.527) (-457.706) [-460.593] (-465.746) * (-467.495) (-462.231) (-457.800) [-458.421] -- 0:00:19
693000 -- (-462.854) [-459.160] (-463.389) (-462.011) * (-458.356) (-460.498) (-458.506) [-461.808] -- 0:00:19
693500 -- (-460.449) [-459.571] (-464.119) (-463.092) * (-458.078) [-462.307] (-460.826) (-461.299) -- 0:00:19
694000 -- [-459.111] (-459.397) (-459.242) (-458.001) * [-458.840] (-459.572) (-458.920) (-462.654) -- 0:00:19
694500 -- (-457.877) [-460.141] (-458.964) (-458.079) * (-458.874) (-461.690) (-458.347) [-460.696] -- 0:00:19
695000 -- (-460.480) [-458.769] (-468.145) (-458.645) * (-459.623) (-458.396) [-462.631] (-459.835) -- 0:00:19
Average standard deviation of split frequencies: 0.012914
695500 -- [-458.362] (-461.056) (-458.390) (-460.193) * (-462.055) (-461.034) (-463.940) [-460.848] -- 0:00:19
696000 -- (-458.928) [-461.368] (-459.789) (-459.462) * (-460.546) [-460.514] (-463.863) (-460.126) -- 0:00:19
696500 -- (-458.649) (-460.367) [-458.519] (-459.083) * [-457.906] (-458.911) (-458.984) (-460.909) -- 0:00:19
697000 -- (-462.583) (-465.024) [-459.048] (-458.649) * (-458.011) (-457.998) [-459.371] (-465.772) -- 0:00:19
697500 -- (-459.829) [-462.218] (-459.231) (-462.985) * (-462.101) [-461.402] (-460.278) (-460.371) -- 0:00:19
698000 -- (-460.684) [-460.108] (-460.461) (-458.878) * [-461.185] (-459.594) (-458.900) (-462.216) -- 0:00:19
698500 -- (-460.537) [-458.485] (-459.139) (-459.570) * (-463.584) [-462.090] (-459.973) (-461.936) -- 0:00:19
699000 -- (-459.023) (-458.371) [-460.916] (-459.080) * (-460.407) (-465.248) [-457.972] (-458.690) -- 0:00:19
699500 -- (-458.365) [-460.511] (-457.919) (-460.714) * (-458.752) [-460.723] (-460.274) (-460.243) -- 0:00:19
700000 -- [-460.032] (-458.503) (-459.737) (-460.371) * (-459.875) (-461.111) (-460.491) [-459.385] -- 0:00:19
Average standard deviation of split frequencies: 0.012649
700500 -- [-458.354] (-457.529) (-460.069) (-458.315) * [-457.812] (-459.693) (-459.667) (-460.111) -- 0:00:19
701000 -- (-463.064) (-461.499) (-458.780) [-458.509] * (-459.376) (-458.742) [-460.299] (-459.378) -- 0:00:19
701500 -- (-462.386) (-460.528) [-457.920] (-462.786) * [-459.309] (-459.971) (-464.487) (-459.158) -- 0:00:19
702000 -- [-461.258] (-458.361) (-457.736) (-459.887) * [-458.381] (-458.481) (-465.621) (-460.825) -- 0:00:19
702500 -- (-463.328) (-459.855) (-458.232) [-459.865] * (-458.382) (-467.491) (-458.220) [-459.741] -- 0:00:19
703000 -- (-459.889) (-465.636) [-459.632] (-461.724) * (-462.363) (-465.236) [-461.673] (-464.139) -- 0:00:19
703500 -- (-458.876) (-460.900) [-458.840] (-458.037) * (-460.414) [-460.362] (-458.916) (-459.942) -- 0:00:18
704000 -- [-459.598] (-462.061) (-463.966) (-457.663) * (-461.788) [-459.894] (-457.960) (-459.661) -- 0:00:18
704500 -- (-461.729) [-459.250] (-458.962) (-459.296) * (-465.510) (-462.456) (-459.597) [-457.958] -- 0:00:18
705000 -- (-461.448) (-459.598) (-460.834) [-459.559] * (-463.137) (-458.932) (-460.292) [-458.502] -- 0:00:18
Average standard deviation of split frequencies: 0.012375
705500 -- (-462.744) [-458.226] (-461.055) (-459.978) * [-461.020] (-458.095) (-462.175) (-459.819) -- 0:00:18
706000 -- [-458.131] (-462.064) (-467.634) (-459.106) * [-461.031] (-459.069) (-461.154) (-458.826) -- 0:00:18
706500 -- [-460.900] (-461.134) (-457.612) (-461.202) * (-458.267) (-458.216) (-462.341) [-463.430] -- 0:00:18
707000 -- [-458.782] (-459.351) (-457.647) (-462.925) * (-459.472) (-459.038) [-460.799] (-461.479) -- 0:00:18
707500 -- (-460.665) (-458.418) [-458.422] (-461.192) * [-459.198] (-461.529) (-461.609) (-460.572) -- 0:00:18
708000 -- (-461.285) [-458.081] (-458.577) (-462.614) * [-458.637] (-458.881) (-464.735) (-459.634) -- 0:00:18
708500 -- (-459.041) (-459.111) (-463.369) [-463.628] * [-458.866] (-459.307) (-463.532) (-459.829) -- 0:00:18
709000 -- (-461.136) (-459.873) (-459.098) [-461.041] * (-458.681) (-458.059) [-459.583] (-458.412) -- 0:00:18
709500 -- (-461.029) (-459.840) [-459.932] (-458.093) * (-461.961) [-458.458] (-460.092) (-459.342) -- 0:00:18
710000 -- [-459.372] (-460.384) (-464.260) (-458.457) * (-458.523) (-458.895) (-460.498) [-461.104] -- 0:00:18
Average standard deviation of split frequencies: 0.012205
710500 -- (-463.767) (-460.096) [-458.693] (-461.451) * (-459.417) (-459.153) (-459.840) [-457.998] -- 0:00:18
711000 -- (-458.596) [-457.890] (-459.783) (-459.293) * (-460.714) (-459.625) [-458.252] (-458.078) -- 0:00:18
711500 -- [-459.939] (-461.535) (-459.730) (-461.787) * (-463.477) (-461.426) [-457.701] (-459.669) -- 0:00:18
712000 -- (-463.798) (-460.324) [-459.477] (-459.719) * [-460.123] (-460.325) (-461.464) (-460.490) -- 0:00:18
712500 -- (-458.706) (-462.202) [-459.160] (-458.472) * (-462.163) (-462.681) [-458.198] (-459.717) -- 0:00:18
713000 -- [-458.288] (-460.435) (-463.083) (-460.227) * (-458.621) (-459.408) [-461.352] (-461.333) -- 0:00:18
713500 -- [-460.532] (-458.610) (-460.206) (-458.563) * (-460.628) (-459.223) [-461.989] (-460.416) -- 0:00:18
714000 -- (-460.497) (-460.652) [-459.347] (-460.694) * (-459.068) (-460.078) [-458.533] (-459.887) -- 0:00:18
714500 -- [-460.579] (-459.867) (-463.530) (-460.247) * (-459.897) [-459.044] (-460.195) (-460.555) -- 0:00:18
715000 -- (-459.401) (-458.632) (-462.694) [-459.366] * (-458.113) [-459.859] (-460.364) (-459.772) -- 0:00:18
Average standard deviation of split frequencies: 0.012114
715500 -- (-458.390) [-461.739] (-465.910) (-459.403) * [-458.283] (-459.510) (-463.854) (-461.142) -- 0:00:18
716000 -- [-459.637] (-459.253) (-461.487) (-460.783) * (-459.280) (-459.266) (-461.255) [-459.523] -- 0:00:18
716500 -- (-462.171) [-458.488] (-461.663) (-461.949) * (-461.503) [-460.612] (-460.708) (-458.177) -- 0:00:18
717000 -- (-458.450) (-458.393) (-458.306) [-459.743] * (-460.605) (-461.402) [-459.687] (-458.817) -- 0:00:18
717500 -- (-459.052) (-458.691) [-458.781] (-459.664) * [-460.433] (-460.595) (-460.051) (-457.583) -- 0:00:18
718000 -- [-460.702] (-463.029) (-460.081) (-461.108) * (-460.672) (-464.113) [-460.005] (-466.606) -- 0:00:18
718500 -- [-459.133] (-462.407) (-459.371) (-459.416) * [-459.345] (-459.741) (-457.500) (-465.452) -- 0:00:18
719000 -- (-463.768) (-462.821) [-459.984] (-460.298) * (-459.630) (-461.929) [-458.498] (-464.728) -- 0:00:17
719500 -- (-461.900) (-460.092) [-459.809] (-459.785) * (-461.411) (-460.034) [-461.877] (-463.605) -- 0:00:17
720000 -- (-458.651) (-457.609) [-462.007] (-460.713) * (-472.408) [-460.862] (-460.014) (-459.050) -- 0:00:17
Average standard deviation of split frequencies: 0.012385
720500 -- (-459.210) [-458.641] (-458.082) (-459.702) * [-458.075] (-460.616) (-461.832) (-461.426) -- 0:00:17
721000 -- (-460.158) [-458.142] (-466.226) (-461.538) * (-461.775) (-460.286) [-458.690] (-459.855) -- 0:00:17
721500 -- (-462.084) (-460.819) (-459.751) [-463.835] * [-460.184] (-459.242) (-457.654) (-462.906) -- 0:00:17
722000 -- [-458.894] (-461.598) (-460.164) (-460.722) * (-460.376) [-459.917] (-458.773) (-459.431) -- 0:00:17
722500 -- (-459.046) (-464.304) (-460.018) [-459.436] * (-458.924) (-460.403) [-458.312] (-461.569) -- 0:00:17
723000 -- (-458.892) (-460.729) (-464.850) [-458.725] * (-459.928) (-458.485) (-458.393) [-459.895] -- 0:00:17
723500 -- [-459.015] (-459.083) (-462.426) (-458.928) * (-458.527) (-458.218) [-459.074] (-458.094) -- 0:00:17
724000 -- (-458.498) [-458.121] (-459.018) (-461.212) * (-458.654) [-459.172] (-459.347) (-460.987) -- 0:00:17
724500 -- (-459.738) (-460.916) [-459.586] (-460.235) * (-458.572) [-460.030] (-460.745) (-458.110) -- 0:00:17
725000 -- [-458.883] (-460.001) (-462.305) (-459.182) * (-460.356) (-459.863) (-461.325) [-461.007] -- 0:00:17
Average standard deviation of split frequencies: 0.012337
725500 -- (-460.902) (-459.411) (-458.751) [-458.256] * [-461.090] (-458.323) (-459.583) (-459.388) -- 0:00:17
726000 -- (-458.819) (-461.969) (-462.513) [-459.068] * (-459.391) (-458.346) (-463.621) [-460.286] -- 0:00:17
726500 -- [-458.940] (-461.764) (-459.652) (-459.549) * (-458.691) [-458.540] (-460.224) (-460.115) -- 0:00:17
727000 -- (-460.343) [-458.779] (-461.060) (-457.979) * (-458.808) (-458.111) (-464.292) [-460.700] -- 0:00:17
727500 -- (-458.787) (-461.279) (-459.446) [-458.411] * (-458.633) [-458.014] (-459.558) (-465.929) -- 0:00:17
728000 -- [-460.795] (-458.235) (-458.535) (-459.691) * (-460.265) (-459.193) (-460.963) [-461.021] -- 0:00:17
728500 -- [-461.171] (-463.594) (-460.981) (-458.130) * (-459.985) (-458.398) (-461.147) [-461.479] -- 0:00:17
729000 -- (-458.940) (-459.170) (-461.835) [-459.378] * [-465.732] (-457.824) (-458.887) (-461.997) -- 0:00:17
729500 -- [-460.269] (-460.820) (-461.726) (-458.546) * (-460.325) [-459.995] (-458.656) (-460.132) -- 0:00:17
730000 -- (-460.564) (-460.858) [-460.127] (-458.152) * (-461.696) (-458.513) (-459.609) [-459.409] -- 0:00:17
Average standard deviation of split frequencies: 0.012602
730500 -- (-460.553) [-461.573] (-458.792) (-459.012) * (-462.124) [-458.898] (-461.574) (-458.551) -- 0:00:17
731000 -- (-460.438) [-465.687] (-457.822) (-458.882) * (-459.061) [-460.686] (-458.703) (-458.785) -- 0:00:17
731500 -- [-462.066] (-467.622) (-458.693) (-460.429) * [-460.938] (-458.887) (-458.196) (-459.005) -- 0:00:17
732000 -- (-465.390) (-460.632) (-458.141) [-460.386] * (-464.595) [-459.167] (-463.597) (-459.757) -- 0:00:17
732500 -- [-458.271] (-459.289) (-461.353) (-461.802) * [-460.758] (-459.347) (-461.995) (-460.879) -- 0:00:17
733000 -- (-462.552) [-458.048] (-462.894) (-458.742) * (-457.712) [-459.606] (-458.670) (-457.445) -- 0:00:17
733500 -- (-460.405) [-460.980] (-463.270) (-457.906) * [-458.992] (-461.501) (-457.621) (-458.151) -- 0:00:17
734000 -- (-460.264) (-459.925) (-462.686) [-460.784] * (-460.421) [-459.191] (-459.911) (-459.710) -- 0:00:17
734500 -- [-459.264] (-460.422) (-458.450) (-461.161) * (-460.639) [-458.644] (-457.643) (-460.619) -- 0:00:16
735000 -- [-461.477] (-458.600) (-460.902) (-457.538) * (-460.574) (-458.376) [-458.607] (-462.640) -- 0:00:16
Average standard deviation of split frequencies: 0.012426
735500 -- (-458.242) (-462.892) (-458.542) [-460.270] * (-459.260) (-458.239) [-460.046] (-460.904) -- 0:00:16
736000 -- (-461.692) [-460.956] (-459.622) (-457.495) * (-459.494) (-459.796) [-459.213] (-458.788) -- 0:00:16
736500 -- (-458.504) (-458.556) (-459.167) [-459.699] * (-459.906) [-459.908] (-458.989) (-459.652) -- 0:00:16
737000 -- [-459.327] (-462.543) (-459.102) (-460.746) * [-458.346] (-459.039) (-461.277) (-458.990) -- 0:00:16
737500 -- (-458.805) (-464.411) (-459.114) [-457.568] * (-462.409) (-461.916) [-461.703] (-461.670) -- 0:00:16
738000 -- [-459.976] (-458.992) (-457.880) (-458.277) * (-459.564) (-459.516) (-459.034) [-458.619] -- 0:00:16
738500 -- (-464.164) [-457.673] (-458.148) (-457.843) * (-460.048) (-462.592) (-458.107) [-462.840] -- 0:00:16
739000 -- (-465.250) [-459.606] (-460.573) (-460.243) * (-462.798) (-459.277) [-459.275] (-461.709) -- 0:00:16
739500 -- (-462.900) (-459.684) (-464.272) [-462.370] * (-464.852) (-459.360) [-462.745] (-460.040) -- 0:00:16
740000 -- (-460.453) (-463.828) [-459.803] (-463.192) * [-460.196] (-464.464) (-461.568) (-463.540) -- 0:00:16
Average standard deviation of split frequencies: 0.011711
740500 -- (-458.558) (-459.863) (-459.829) [-457.932] * (-458.794) [-458.962] (-460.603) (-459.747) -- 0:00:16
741000 -- (-465.164) [-461.610] (-459.149) (-460.082) * (-460.868) (-460.909) (-458.250) [-460.988] -- 0:00:16
741500 -- (-463.046) (-463.349) (-460.923) [-457.479] * (-459.147) (-460.037) [-460.316] (-458.335) -- 0:00:16
742000 -- (-459.161) [-461.711] (-461.051) (-458.673) * (-458.287) [-458.295] (-459.157) (-458.996) -- 0:00:16
742500 -- (-458.626) (-460.511) (-457.813) [-461.018] * (-458.314) [-458.698] (-461.095) (-459.051) -- 0:00:16
743000 -- [-458.486] (-461.259) (-458.155) (-459.801) * (-458.524) (-459.193) (-458.788) [-459.286] -- 0:00:16
743500 -- [-458.621] (-461.172) (-459.587) (-461.076) * (-458.180) (-464.402) [-462.906] (-461.692) -- 0:00:16
744000 -- [-459.285] (-458.794) (-458.269) (-460.393) * [-460.170] (-461.038) (-459.994) (-461.718) -- 0:00:16
744500 -- (-459.236) (-460.681) [-465.481] (-459.174) * (-458.287) [-460.168] (-461.371) (-459.718) -- 0:00:16
745000 -- (-459.398) [-459.655] (-458.890) (-458.420) * (-460.447) (-461.497) (-461.446) [-458.750] -- 0:00:16
Average standard deviation of split frequencies: 0.011711
745500 -- (-459.177) [-460.881] (-461.128) (-460.125) * (-459.944) (-457.989) (-460.791) [-460.652] -- 0:00:16
746000 -- (-463.445) (-459.954) (-461.145) [-457.595] * [-459.730] (-458.858) (-458.222) (-460.342) -- 0:00:16
746500 -- (-458.545) [-459.792] (-469.924) (-458.730) * (-458.715) (-458.301) [-459.427] (-463.269) -- 0:00:16
747000 -- [-459.074] (-460.546) (-460.695) (-458.593) * (-460.245) (-458.095) (-469.566) [-459.117] -- 0:00:16
747500 -- [-458.816] (-460.124) (-458.458) (-461.534) * (-463.768) [-457.654] (-464.865) (-460.770) -- 0:00:16
748000 -- (-461.794) [-462.777] (-459.855) (-460.936) * (-460.810) [-458.236] (-461.657) (-460.212) -- 0:00:16
748500 -- (-462.057) [-459.733] (-460.183) (-458.159) * (-458.657) (-460.979) (-459.506) [-460.532] -- 0:00:16
749000 -- (-459.066) (-458.855) [-462.381] (-457.839) * (-461.772) (-458.862) (-462.223) [-458.158] -- 0:00:16
749500 -- (-458.679) (-459.928) (-459.712) [-459.873] * [-461.056] (-460.304) (-458.358) (-460.825) -- 0:00:16
750000 -- [-459.174] (-464.338) (-459.010) (-460.056) * (-462.812) (-460.258) (-458.433) [-459.943] -- 0:00:16
Average standard deviation of split frequencies: 0.011262
750500 -- (-459.046) (-461.743) [-457.594] (-459.236) * (-462.446) (-467.999) [-461.067] (-460.156) -- 0:00:15
751000 -- (-459.210) [-459.926] (-458.684) (-460.012) * (-460.429) (-460.161) (-458.983) [-459.551] -- 0:00:15
751500 -- [-459.640] (-460.334) (-461.429) (-458.655) * (-459.383) (-459.959) [-457.854] (-459.335) -- 0:00:15
752000 -- (-460.654) [-459.065] (-464.800) (-461.825) * (-462.246) [-459.578] (-458.635) (-459.136) -- 0:00:15
752500 -- [-459.406] (-457.723) (-458.414) (-459.750) * [-463.092] (-459.955) (-461.386) (-460.581) -- 0:00:15
753000 -- (-459.529) (-457.949) (-458.012) [-460.812] * [-458.763] (-461.599) (-464.123) (-459.386) -- 0:00:15
753500 -- (-460.340) (-458.228) [-457.363] (-458.473) * (-459.567) (-459.272) (-465.129) [-461.149] -- 0:00:15
754000 -- (-458.870) (-461.345) (-457.426) [-463.484] * (-459.281) [-457.524] (-461.503) (-461.886) -- 0:00:15
754500 -- (-459.150) [-459.146] (-458.128) (-461.323) * (-459.281) [-458.063] (-459.093) (-461.966) -- 0:00:15
755000 -- (-459.949) (-459.599) (-458.046) [-459.301] * [-459.293] (-458.152) (-459.040) (-459.858) -- 0:00:15
Average standard deviation of split frequencies: 0.011141
755500 -- (-460.368) [-459.928] (-457.650) (-460.380) * (-458.624) [-459.957] (-461.184) (-459.561) -- 0:00:15
756000 -- [-459.802] (-459.623) (-457.679) (-460.746) * (-459.116) [-459.306] (-460.273) (-459.473) -- 0:00:15
756500 -- (-460.653) (-459.038) [-457.636] (-460.227) * [-459.562] (-458.963) (-465.977) (-460.985) -- 0:00:15
757000 -- (-462.927) (-461.283) [-457.794] (-458.783) * (-460.791) (-459.962) [-460.355] (-458.859) -- 0:00:15
757500 -- (-459.649) [-461.213] (-459.325) (-459.231) * (-459.115) (-460.672) [-458.427] (-458.374) -- 0:00:15
758000 -- (-459.415) [-461.507] (-458.640) (-465.244) * (-458.506) (-458.225) [-458.210] (-458.964) -- 0:00:15
758500 -- (-458.836) (-459.683) (-462.143) [-462.594] * [-458.135] (-458.899) (-459.808) (-459.217) -- 0:00:15
759000 -- (-462.258) (-458.097) [-458.176] (-460.860) * [-457.849] (-459.307) (-459.145) (-460.889) -- 0:00:15
759500 -- (-458.903) (-460.184) (-458.043) [-458.781] * (-458.897) (-459.114) [-458.889] (-461.973) -- 0:00:15
760000 -- (-459.895) (-460.575) [-458.001] (-460.536) * (-457.740) [-459.527] (-459.549) (-461.796) -- 0:00:15
Average standard deviation of split frequencies: 0.011072
760500 -- [-458.399] (-459.862) (-457.693) (-459.728) * (-460.303) [-457.983] (-458.355) (-463.012) -- 0:00:15
761000 -- [-458.898] (-459.942) (-459.107) (-458.876) * (-460.218) (-459.143) [-458.745] (-457.956) -- 0:00:15
761500 -- [-459.155] (-458.608) (-460.242) (-459.609) * (-458.748) (-459.979) (-460.121) [-464.312] -- 0:00:15
762000 -- (-460.584) (-462.452) (-459.988) [-459.031] * (-461.516) (-460.480) [-462.193] (-458.089) -- 0:00:14
762500 -- (-462.628) (-461.865) [-458.244] (-458.981) * (-464.985) [-458.710] (-460.736) (-458.561) -- 0:00:15
763000 -- (-462.293) (-462.376) [-458.062] (-460.324) * (-464.640) [-461.937] (-460.697) (-458.804) -- 0:00:15
763500 -- (-462.096) (-460.661) [-457.510] (-458.763) * (-463.742) [-458.711] (-459.599) (-459.049) -- 0:00:15
764000 -- (-460.525) (-460.115) (-460.307) [-461.815] * [-460.928] (-460.166) (-464.304) (-460.282) -- 0:00:15
764500 -- (-461.997) (-457.883) (-458.925) [-461.217] * (-462.083) (-460.545) [-460.369] (-459.621) -- 0:00:15
765000 -- (-459.857) (-458.224) (-460.072) [-458.640] * (-461.838) (-458.455) [-458.439] (-462.376) -- 0:00:15
Average standard deviation of split frequencies: 0.011077
765500 -- (-460.021) (-460.448) [-458.943] (-458.202) * [-458.731] (-459.811) (-458.752) (-458.631) -- 0:00:15
766000 -- (-461.418) (-459.517) (-459.098) [-459.766] * [-458.315] (-458.686) (-460.314) (-458.025) -- 0:00:14
766500 -- (-459.759) (-460.210) (-460.523) [-459.574] * (-459.815) [-458.680] (-458.376) (-458.002) -- 0:00:14
767000 -- (-463.651) (-458.349) [-459.176] (-459.834) * (-459.763) [-459.800] (-460.499) (-458.136) -- 0:00:14
767500 -- (-460.208) (-459.458) (-462.109) [-459.078] * (-462.904) (-463.448) (-459.581) [-458.427] -- 0:00:14
768000 -- [-458.445] (-460.271) (-459.629) (-463.017) * (-461.868) (-459.935) [-458.926] (-459.804) -- 0:00:14
768500 -- [-459.102] (-458.215) (-458.894) (-461.211) * (-462.382) [-459.163] (-460.691) (-460.030) -- 0:00:14
769000 -- (-459.382) [-458.042] (-459.800) (-460.889) * [-463.373] (-458.916) (-459.574) (-462.847) -- 0:00:14
769500 -- (-457.918) (-457.390) [-460.800] (-460.212) * (-461.173) [-462.265] (-459.831) (-459.166) -- 0:00:14
770000 -- (-459.609) (-457.519) [-462.501] (-460.487) * (-459.564) [-459.064] (-458.948) (-459.393) -- 0:00:14
Average standard deviation of split frequencies: 0.010888
770500 -- (-457.858) (-460.032) [-462.190] (-459.896) * (-461.659) (-462.790) [-457.624] (-457.569) -- 0:00:14
771000 -- (-459.571) [-461.584] (-459.740) (-457.783) * (-459.747) (-461.432) [-459.568] (-458.040) -- 0:00:14
771500 -- [-464.097] (-462.920) (-460.135) (-458.499) * (-459.913) (-459.235) (-462.414) [-458.548] -- 0:00:14
772000 -- (-460.035) (-459.099) (-458.352) [-457.511] * (-460.000) [-460.284] (-458.236) (-459.743) -- 0:00:14
772500 -- (-461.761) (-459.178) [-459.938] (-458.043) * (-458.836) (-459.484) (-462.663) [-459.658] -- 0:00:14
773000 -- (-460.429) (-461.470) (-458.205) [-458.960] * (-459.788) [-459.879] (-463.756) (-463.620) -- 0:00:14
773500 -- (-457.783) [-459.011] (-457.989) (-458.962) * (-462.473) (-460.965) [-458.579] (-460.684) -- 0:00:14
774000 -- [-461.185] (-466.502) (-458.889) (-459.562) * (-459.158) (-459.507) (-459.930) [-459.016] -- 0:00:14
774500 -- [-460.446] (-460.621) (-459.127) (-462.788) * (-459.227) (-461.826) [-459.396] (-458.853) -- 0:00:14
775000 -- (-459.713) (-461.584) [-460.704] (-458.588) * (-462.331) [-459.917] (-458.891) (-459.556) -- 0:00:14
Average standard deviation of split frequencies: 0.011178
775500 -- (-462.134) [-460.265] (-458.539) (-458.946) * [-460.656] (-459.499) (-458.688) (-462.595) -- 0:00:14
776000 -- (-461.701) [-459.345] (-458.191) (-457.662) * (-459.244) (-459.705) (-459.566) [-460.522] -- 0:00:14
776500 -- (-459.116) [-464.840] (-459.092) (-458.785) * (-462.934) (-458.793) [-458.312] (-458.714) -- 0:00:14
777000 -- (-460.751) (-459.705) [-459.328] (-462.798) * (-461.363) (-458.662) [-458.429] (-460.370) -- 0:00:14
777500 -- (-460.603) (-461.550) [-464.601] (-463.302) * (-458.705) (-467.893) (-459.758) [-457.949] -- 0:00:14
778000 -- (-459.137) [-458.344] (-459.564) (-460.179) * (-461.279) [-461.439] (-462.312) (-458.773) -- 0:00:13
778500 -- [-460.202] (-458.260) (-459.471) (-459.120) * (-459.952) [-461.269] (-464.407) (-457.534) -- 0:00:13
779000 -- (-460.276) (-460.850) [-458.579] (-461.520) * (-460.866) (-462.213) [-460.122] (-460.740) -- 0:00:13
779500 -- (-459.468) [-460.617] (-460.465) (-458.707) * (-461.837) (-464.376) (-459.378) [-460.821] -- 0:00:14
780000 -- (-460.551) (-458.482) (-463.206) [-462.121] * [-458.795] (-460.749) (-458.513) (-459.122) -- 0:00:14
Average standard deviation of split frequencies: 0.010386
780500 -- (-458.764) (-459.277) (-468.661) [-458.461] * [-459.494] (-462.536) (-459.905) (-462.962) -- 0:00:14
781000 -- (-459.084) [-458.540] (-460.897) (-459.508) * [-458.324] (-469.334) (-459.171) (-460.842) -- 0:00:14
781500 -- [-460.458] (-459.616) (-458.926) (-459.796) * (-459.205) [-461.367] (-459.905) (-462.052) -- 0:00:13
782000 -- [-460.985] (-461.868) (-459.843) (-458.727) * (-462.598) (-463.772) [-457.614] (-460.216) -- 0:00:13
782500 -- (-459.289) (-464.200) (-460.678) [-461.335] * [-458.705] (-466.708) (-458.473) (-459.588) -- 0:00:13
783000 -- (-458.022) [-464.362] (-460.892) (-458.516) * (-459.378) [-459.241] (-459.520) (-459.756) -- 0:00:13
783500 -- (-461.301) (-461.885) (-459.443) [-460.345] * (-458.401) (-458.401) [-457.880] (-461.814) -- 0:00:13
784000 -- (-461.358) (-458.828) (-457.813) [-460.128] * [-458.115] (-458.421) (-457.770) (-459.920) -- 0:00:13
784500 -- (-459.371) (-460.707) [-463.621] (-465.007) * (-459.830) [-460.147] (-460.685) (-459.219) -- 0:00:13
785000 -- (-459.470) [-459.287] (-463.692) (-461.350) * (-460.184) [-460.049] (-465.997) (-458.338) -- 0:00:13
Average standard deviation of split frequencies: 0.010356
785500 -- (-462.143) [-459.735] (-459.128) (-459.430) * [-462.800] (-459.790) (-459.345) (-459.737) -- 0:00:13
786000 -- (-459.368) (-458.310) (-459.491) [-461.485] * [-461.245] (-462.171) (-458.583) (-458.285) -- 0:00:13
786500 -- (-459.328) [-458.447] (-462.007) (-459.688) * (-459.072) [-461.218] (-458.905) (-460.371) -- 0:00:13
787000 -- (-458.436) [-460.363] (-468.269) (-458.199) * (-458.518) (-460.367) (-460.365) [-457.981] -- 0:00:13
787500 -- (-458.300) (-462.753) [-463.688] (-467.471) * (-460.291) (-465.770) [-458.542] (-460.892) -- 0:00:13
788000 -- (-460.080) (-460.896) (-461.471) [-459.800] * (-457.786) (-466.458) (-460.537) [-459.153] -- 0:00:13
788500 -- (-460.132) (-459.958) (-459.504) [-460.521] * (-461.212) (-460.625) [-461.072] (-459.840) -- 0:00:13
789000 -- [-459.925] (-460.599) (-463.248) (-461.163) * (-460.917) [-461.746] (-458.310) (-458.952) -- 0:00:13
789500 -- (-460.476) (-458.440) [-461.982] (-460.643) * (-461.238) (-457.873) (-459.649) [-462.707] -- 0:00:13
790000 -- [-461.952] (-459.296) (-459.364) (-464.101) * (-461.403) [-460.556] (-458.164) (-459.831) -- 0:00:13
Average standard deviation of split frequencies: 0.010175
790500 -- (-462.142) [-459.715] (-460.155) (-462.454) * [-458.779] (-461.513) (-461.147) (-460.154) -- 0:00:13
791000 -- (-462.927) (-465.538) [-459.257] (-460.443) * (-460.421) (-461.820) [-461.597] (-458.656) -- 0:00:13
791500 -- (-459.524) (-461.064) (-462.028) [-463.828] * (-461.354) (-459.020) (-461.225) [-459.057] -- 0:00:13
792000 -- (-460.515) (-460.524) (-458.540) [-460.834] * (-458.706) (-461.862) [-459.046] (-463.243) -- 0:00:13
792500 -- (-461.309) (-460.529) [-458.286] (-459.504) * [-459.160] (-460.135) (-457.645) (-461.346) -- 0:00:13
793000 -- (-459.588) (-460.602) [-458.809] (-463.369) * (-458.859) (-459.520) (-459.439) [-459.814] -- 0:00:13
793500 -- (-458.411) (-462.955) [-459.327] (-458.940) * (-458.924) [-458.849] (-460.484) (-459.678) -- 0:00:13
794000 -- (-461.304) [-460.173] (-460.370) (-462.328) * (-459.766) (-459.301) (-458.799) [-459.479] -- 0:00:12
794500 -- (-459.219) (-460.446) [-458.952] (-462.377) * (-461.247) (-459.084) [-458.527] (-458.253) -- 0:00:12
795000 -- (-461.408) (-458.595) [-458.886] (-463.112) * (-459.280) (-460.940) [-458.373] (-463.402) -- 0:00:13
Average standard deviation of split frequencies: 0.010068
795500 -- (-459.545) (-458.890) (-460.736) [-461.828] * (-459.529) [-460.662] (-460.145) (-462.153) -- 0:00:13
796000 -- (-459.078) [-460.452] (-458.458) (-460.622) * (-458.979) (-462.890) [-458.116] (-459.194) -- 0:00:13
796500 -- [-458.172] (-459.000) (-457.941) (-463.102) * (-459.053) (-459.874) [-459.348] (-461.006) -- 0:00:13
797000 -- (-458.552) (-458.959) (-459.424) [-464.157] * [-462.572] (-460.592) (-460.503) (-459.563) -- 0:00:12
797500 -- (-460.733) (-459.210) [-459.476] (-458.430) * [-457.790] (-461.917) (-462.919) (-458.671) -- 0:00:12
798000 -- (-461.623) (-458.728) [-460.809] (-461.918) * (-458.514) [-458.935] (-461.376) (-460.191) -- 0:00:12
798500 -- (-462.354) (-460.147) (-458.883) [-460.297] * (-460.364) (-458.942) (-458.472) [-457.453] -- 0:00:12
799000 -- (-458.877) (-459.262) (-460.940) [-460.395] * [-458.743] (-459.191) (-459.003) (-460.905) -- 0:00:12
799500 -- (-464.044) [-461.033] (-460.111) (-458.535) * [-459.158] (-462.141) (-459.311) (-457.674) -- 0:00:12
800000 -- (-461.973) [-458.243] (-459.256) (-457.431) * (-459.150) (-461.864) [-460.150] (-459.526) -- 0:00:12
Average standard deviation of split frequencies: 0.010284
800500 -- (-460.995) [-459.257] (-460.484) (-459.662) * (-458.857) (-460.507) (-459.098) [-460.255] -- 0:00:12
801000 -- (-461.006) (-458.365) (-462.565) [-459.770] * (-462.797) (-459.647) [-460.861] (-460.260) -- 0:00:12
801500 -- (-460.389) [-459.013] (-458.133) (-458.738) * (-460.993) [-459.146] (-462.822) (-458.798) -- 0:00:12
802000 -- (-463.103) [-462.455] (-458.929) (-463.378) * [-457.994] (-460.035) (-459.957) (-457.840) -- 0:00:12
802500 -- (-459.361) [-460.269] (-459.472) (-458.613) * [-458.287] (-457.746) (-460.110) (-461.717) -- 0:00:12
803000 -- [-459.369] (-457.870) (-460.039) (-458.895) * (-460.621) (-460.217) (-460.179) [-460.936] -- 0:00:12
803500 -- [-458.978] (-457.462) (-459.918) (-460.024) * [-458.527] (-460.800) (-459.134) (-459.517) -- 0:00:12
804000 -- (-460.489) [-460.782] (-459.903) (-461.111) * (-459.333) (-458.065) (-462.261) [-459.377] -- 0:00:12
804500 -- (-458.105) (-458.869) (-463.733) [-460.159] * (-458.146) [-461.711] (-462.123) (-459.633) -- 0:00:12
805000 -- (-464.748) (-458.409) (-460.648) [-459.923] * [-459.647] (-461.039) (-458.217) (-458.294) -- 0:00:12
Average standard deviation of split frequencies: 0.010606
805500 -- (-461.770) (-458.214) (-459.912) [-459.300] * (-459.768) (-458.872) [-459.442] (-460.687) -- 0:00:12
806000 -- [-462.987] (-458.072) (-458.442) (-460.317) * (-459.645) (-459.943) (-460.018) [-463.069] -- 0:00:12
806500 -- (-459.836) [-458.226] (-461.557) (-463.372) * (-460.119) [-459.595] (-458.497) (-460.965) -- 0:00:12
807000 -- (-459.661) [-458.942] (-463.677) (-460.621) * (-460.257) [-458.561] (-462.670) (-457.598) -- 0:00:12
807500 -- [-459.488] (-459.194) (-460.759) (-460.000) * (-461.598) [-459.213] (-460.548) (-460.216) -- 0:00:12
808000 -- (-462.286) [-464.203] (-461.910) (-460.241) * [-462.126] (-460.848) (-461.047) (-459.492) -- 0:00:12
808500 -- [-464.731] (-459.028) (-460.914) (-458.994) * (-460.981) [-461.338] (-457.815) (-458.050) -- 0:00:12
809000 -- (-461.011) [-458.645] (-460.783) (-459.848) * (-460.030) (-461.164) [-459.518] (-458.177) -- 0:00:12
809500 -- [-458.271] (-458.826) (-465.309) (-458.468) * (-462.825) (-459.733) (-460.687) [-458.837] -- 0:00:12
810000 -- (-458.372) [-460.857] (-466.830) (-459.402) * [-465.646] (-458.509) (-461.107) (-458.411) -- 0:00:11
Average standard deviation of split frequencies: 0.010777
810500 -- (-458.992) (-462.687) (-469.691) [-459.165] * (-460.432) (-460.619) (-462.760) [-458.502] -- 0:00:11
811000 -- [-460.379] (-461.517) (-470.121) (-458.696) * (-458.610) [-459.997] (-462.236) (-459.452) -- 0:00:11
811500 -- [-457.765] (-458.771) (-459.585) (-460.097) * (-460.087) [-457.842] (-459.542) (-458.562) -- 0:00:11
812000 -- [-460.064] (-460.333) (-461.552) (-460.746) * (-458.613) (-458.323) [-458.929] (-459.507) -- 0:00:12
812500 -- [-460.356] (-462.373) (-460.391) (-461.399) * (-460.994) (-459.257) (-457.704) [-457.881] -- 0:00:12
813000 -- (-460.780) (-461.003) [-458.996] (-461.592) * (-460.424) (-458.673) [-459.439] (-457.676) -- 0:00:11
813500 -- (-458.440) (-460.133) [-459.343] (-458.711) * [-461.932] (-463.952) (-459.761) (-459.230) -- 0:00:11
814000 -- [-458.022] (-461.925) (-459.167) (-458.672) * (-458.252) (-460.708) [-459.066] (-458.779) -- 0:00:11
814500 -- (-459.084) [-462.622] (-460.259) (-459.761) * (-459.740) (-458.623) [-459.583] (-457.937) -- 0:00:11
815000 -- (-458.625) (-459.478) [-458.671] (-458.466) * (-457.840) (-462.543) (-458.671) [-461.838] -- 0:00:11
Average standard deviation of split frequencies: 0.010707
815500 -- [-458.946] (-458.495) (-459.524) (-459.172) * (-462.019) [-459.698] (-458.251) (-462.015) -- 0:00:11
816000 -- (-459.230) (-458.862) (-458.738) [-458.821] * [-458.485] (-460.094) (-459.343) (-457.658) -- 0:00:11
816500 -- (-459.817) (-460.211) (-458.301) [-459.584] * (-459.256) (-459.397) [-459.596] (-458.960) -- 0:00:11
817000 -- (-463.551) [-458.396] (-458.599) (-458.898) * [-459.207] (-457.900) (-461.378) (-459.557) -- 0:00:11
817500 -- (-459.519) [-458.515] (-458.449) (-458.956) * [-458.351] (-461.523) (-459.318) (-457.752) -- 0:00:11
818000 -- (-458.758) (-458.057) [-460.369] (-457.699) * (-461.969) (-458.903) (-462.064) [-459.475] -- 0:00:11
818500 -- (-461.709) [-457.596] (-459.407) (-459.870) * (-457.452) (-460.382) (-459.418) [-458.901] -- 0:00:11
819000 -- [-459.643] (-459.299) (-459.335) (-457.981) * (-457.680) (-458.917) (-458.663) [-459.620] -- 0:00:11
819500 -- (-458.108) (-459.546) [-460.076] (-458.018) * (-457.850) (-462.344) (-459.719) [-458.479] -- 0:00:11
820000 -- (-459.492) (-460.719) (-458.747) [-459.211] * (-460.658) [-459.065] (-460.800) (-458.640) -- 0:00:11
Average standard deviation of split frequencies: 0.010608
820500 -- [-461.635] (-460.923) (-461.668) (-458.611) * (-458.894) (-463.716) [-458.459] (-458.898) -- 0:00:11
821000 -- (-460.755) (-459.428) [-463.401] (-460.418) * (-457.960) (-462.445) (-460.786) [-458.176] -- 0:00:11
821500 -- (-459.600) (-458.577) (-459.350) [-461.654] * (-458.241) (-459.909) [-460.545] (-465.880) -- 0:00:11
822000 -- [-458.469] (-461.124) (-461.265) (-459.981) * (-460.705) (-459.926) [-461.970] (-462.032) -- 0:00:11
822500 -- [-463.271] (-463.090) (-458.500) (-462.580) * (-460.224) (-460.884) [-458.820] (-457.972) -- 0:00:11
823000 -- (-460.773) [-461.097] (-458.676) (-462.105) * (-464.254) [-457.973] (-458.635) (-460.160) -- 0:00:11
823500 -- [-459.806] (-461.106) (-460.409) (-459.173) * [-459.953] (-460.301) (-458.514) (-460.960) -- 0:00:11
824000 -- (-461.679) [-458.783] (-459.560) (-460.953) * (-460.772) (-459.064) (-465.053) [-460.156] -- 0:00:11
824500 -- (-459.815) (-461.087) [-458.882] (-460.282) * (-459.690) (-461.310) (-462.785) [-459.631] -- 0:00:11
825000 -- (-458.785) [-462.423] (-461.195) (-461.563) * (-459.056) (-458.805) (-462.219) [-459.406] -- 0:00:11
Average standard deviation of split frequencies: 0.010615
825500 -- (-462.656) (-459.952) (-460.136) [-459.801] * (-459.880) (-460.118) (-459.231) [-458.714] -- 0:00:10
826000 -- (-460.049) (-462.011) (-459.026) [-458.962] * (-459.558) (-461.790) [-459.256] (-458.489) -- 0:00:10
826500 -- (-459.641) (-458.563) [-458.117] (-457.535) * (-460.512) [-461.008] (-458.505) (-459.615) -- 0:00:10
827000 -- (-460.649) (-458.231) (-460.393) [-459.526] * (-461.907) (-460.214) [-462.093] (-459.850) -- 0:00:10
827500 -- [-459.003] (-458.252) (-460.790) (-459.391) * (-459.731) (-461.085) (-465.253) [-458.083] -- 0:00:10
828000 -- (-461.109) (-458.957) [-459.641] (-458.087) * (-460.197) [-459.234] (-460.552) (-460.534) -- 0:00:10
828500 -- (-459.311) (-458.373) (-458.352) [-458.394] * (-460.989) (-459.525) [-460.415] (-461.583) -- 0:00:10
829000 -- (-460.224) [-458.739] (-459.186) (-459.904) * [-461.449] (-462.360) (-457.989) (-467.632) -- 0:00:10
829500 -- (-459.719) (-459.929) [-459.678] (-461.210) * [-461.194] (-461.923) (-458.586) (-459.323) -- 0:00:10
830000 -- (-458.037) (-462.668) [-458.945] (-460.321) * [-460.825] (-460.771) (-462.947) (-457.449) -- 0:00:10
Average standard deviation of split frequencies: 0.010820
830500 -- (-459.106) [-459.421] (-459.022) (-460.764) * (-461.275) (-459.018) (-460.609) [-459.892] -- 0:00:10
831000 -- (-459.650) (-461.752) (-460.346) [-459.108] * (-458.085) (-459.269) [-458.653] (-461.018) -- 0:00:10
831500 -- [-459.473] (-458.458) (-462.623) (-459.703) * (-458.298) (-460.728) [-459.061] (-462.223) -- 0:00:10
832000 -- [-459.443] (-459.923) (-461.860) (-459.834) * (-458.459) [-462.298] (-460.279) (-459.729) -- 0:00:10
832500 -- (-461.420) (-463.873) (-458.945) [-459.254] * [-459.530] (-463.038) (-459.550) (-458.976) -- 0:00:10
833000 -- [-458.580] (-466.422) (-460.821) (-459.606) * (-462.516) (-462.290) [-458.059] (-461.923) -- 0:00:10
833500 -- (-461.187) (-462.610) [-461.413] (-461.786) * (-458.677) (-462.484) (-461.929) [-459.554] -- 0:00:10
834000 -- (-459.390) (-458.041) (-459.410) [-459.710] * (-458.026) (-463.626) (-458.922) [-460.856] -- 0:00:10
834500 -- (-459.175) (-459.880) [-458.654] (-460.073) * (-458.699) [-459.539] (-459.798) (-460.534) -- 0:00:10
835000 -- (-459.185) (-461.006) [-462.328] (-459.683) * (-460.335) [-459.993] (-460.947) (-464.846) -- 0:00:10
Average standard deviation of split frequencies: 0.010187
835500 -- (-463.081) (-461.090) (-462.685) [-459.383] * (-461.375) [-458.912] (-466.729) (-461.099) -- 0:00:10
836000 -- (-460.162) (-458.999) (-460.759) [-458.572] * (-460.602) [-460.887] (-464.382) (-461.318) -- 0:00:10
836500 -- (-461.689) [-460.535] (-462.935) (-461.757) * (-461.389) (-457.413) (-462.270) [-462.455] -- 0:00:10
837000 -- (-460.844) (-459.639) [-461.300] (-461.772) * (-462.068) (-457.828) [-459.233] (-458.790) -- 0:00:10
837500 -- (-460.516) (-458.704) [-457.689] (-460.719) * [-460.968] (-457.961) (-461.089) (-458.971) -- 0:00:10
838000 -- (-461.410) [-461.410] (-458.133) (-461.033) * [-461.439] (-459.969) (-460.286) (-458.040) -- 0:00:10
838500 -- (-458.893) (-458.949) (-459.000) [-464.014] * [-458.478] (-462.282) (-461.205) (-458.246) -- 0:00:10
839000 -- (-458.343) (-457.439) [-460.511] (-460.438) * (-457.811) (-457.869) (-461.261) [-460.581] -- 0:00:10
839500 -- (-463.948) [-458.691] (-460.535) (-464.069) * [-459.118] (-459.587) (-460.611) (-458.575) -- 0:00:10
840000 -- (-457.807) (-462.150) [-460.703] (-462.430) * (-461.611) (-461.017) [-457.812] (-461.947) -- 0:00:10
Average standard deviation of split frequencies: 0.010206
840500 -- (-458.082) (-459.137) [-459.344] (-464.899) * (-460.195) (-461.866) [-458.460] (-459.701) -- 0:00:10
841000 -- (-459.385) (-458.795) (-461.974) [-459.622] * [-458.159] (-460.429) (-462.586) (-457.953) -- 0:00:10
841500 -- [-460.812] (-457.853) (-460.664) (-459.702) * (-457.826) (-459.195) (-459.624) [-458.335] -- 0:00:09
842000 -- (-463.436) (-457.938) [-460.895] (-463.309) * (-458.283) [-458.208] (-458.182) (-458.626) -- 0:00:09
842500 -- (-462.222) [-459.169] (-459.053) (-460.455) * (-463.087) (-462.734) [-457.888] (-459.212) -- 0:00:09
843000 -- (-464.667) (-459.802) [-459.213] (-459.624) * (-461.231) [-460.051] (-461.879) (-460.641) -- 0:00:09
843500 -- (-458.301) (-461.267) [-459.354] (-458.406) * [-459.765] (-461.125) (-457.768) (-460.863) -- 0:00:09
844000 -- [-458.702] (-459.292) (-461.111) (-460.104) * [-460.743] (-459.930) (-458.978) (-458.500) -- 0:00:09
844500 -- (-459.183) (-460.333) (-459.119) [-460.141] * (-458.409) (-468.447) [-459.553] (-466.190) -- 0:00:09
845000 -- (-458.072) (-461.165) (-460.809) [-460.306] * (-458.495) (-462.440) (-465.215) [-461.982] -- 0:00:09
Average standard deviation of split frequencies: 0.010290
845500 -- [-457.717] (-465.485) (-458.364) (-458.307) * (-458.914) (-458.684) [-459.824] (-462.658) -- 0:00:09
846000 -- [-458.027] (-460.153) (-459.791) (-461.521) * [-458.273] (-458.732) (-458.646) (-461.572) -- 0:00:09
846500 -- (-457.583) (-461.315) [-458.975] (-460.965) * (-460.531) (-459.383) [-460.636] (-460.672) -- 0:00:09
847000 -- (-458.827) [-458.851] (-460.844) (-459.303) * (-458.707) (-465.353) [-458.036] (-458.838) -- 0:00:09
847500 -- [-462.035] (-460.373) (-463.114) (-462.138) * (-458.708) (-458.603) [-461.141] (-459.328) -- 0:00:09
848000 -- [-460.721] (-462.759) (-460.959) (-460.412) * (-462.257) (-460.952) [-459.436] (-468.252) -- 0:00:09
848500 -- (-460.757) (-461.866) (-459.804) [-459.460] * (-458.566) (-459.130) [-462.459] (-461.616) -- 0:00:09
849000 -- (-457.890) (-459.615) [-458.607] (-461.127) * (-458.983) (-458.359) (-462.031) [-461.284] -- 0:00:09
849500 -- (-458.462) (-459.510) [-460.445] (-460.076) * (-460.549) [-459.323] (-462.151) (-460.969) -- 0:00:09
850000 -- (-458.465) [-459.136] (-464.359) (-457.754) * (-459.438) (-459.229) (-464.196) [-463.029] -- 0:00:09
Average standard deviation of split frequencies: 0.009716
850500 -- [-459.359] (-459.152) (-459.577) (-461.194) * [-459.302] (-458.769) (-459.355) (-466.232) -- 0:00:09
851000 -- (-458.253) [-458.393] (-460.192) (-458.661) * (-458.521) (-459.114) (-459.191) [-460.358] -- 0:00:09
851500 -- (-460.381) (-460.327) [-458.467] (-459.969) * (-458.659) (-458.328) (-460.057) [-459.512] -- 0:00:09
852000 -- (-460.570) [-458.760] (-458.968) (-458.915) * (-460.274) (-458.289) [-461.881] (-458.386) -- 0:00:09
852500 -- (-458.755) (-458.254) (-460.625) [-460.997] * [-459.965] (-459.105) (-464.181) (-459.467) -- 0:00:09
853000 -- (-461.197) [-460.876] (-459.544) (-458.678) * (-457.580) (-460.881) (-459.720) [-459.140] -- 0:00:09
853500 -- (-458.628) (-462.022) [-459.961] (-458.532) * [-458.897] (-460.450) (-459.899) (-457.872) -- 0:00:09
854000 -- [-462.887] (-457.825) (-459.602) (-463.225) * [-459.423] (-459.326) (-460.435) (-459.158) -- 0:00:09
854500 -- (-460.658) [-457.548] (-459.865) (-461.855) * (-459.576) (-459.991) (-460.495) [-458.381] -- 0:00:09
855000 -- (-461.727) [-459.068] (-461.037) (-461.663) * (-459.995) (-461.104) (-460.881) [-459.117] -- 0:00:09
Average standard deviation of split frequencies: 0.009913
855500 -- (-458.508) [-459.418] (-458.502) (-463.223) * [-460.456] (-458.809) (-459.187) (-458.213) -- 0:00:09
856000 -- (-458.810) (-463.806) (-458.192) [-458.734] * (-461.663) [-460.171] (-461.949) (-459.037) -- 0:00:09
856500 -- (-459.636) (-460.232) [-458.240] (-458.189) * [-461.193] (-458.337) (-460.355) (-460.510) -- 0:00:09
857000 -- (-460.749) (-458.825) [-458.771] (-459.028) * [-460.092] (-458.695) (-458.809) (-459.364) -- 0:00:09
857500 -- [-462.704] (-458.490) (-458.670) (-458.196) * (-460.954) (-462.641) [-462.927] (-461.139) -- 0:00:08
858000 -- (-462.091) [-460.149] (-461.645) (-458.782) * (-458.000) (-460.012) (-461.714) [-458.417] -- 0:00:08
858500 -- (-463.667) (-459.337) (-459.242) [-463.856] * (-459.980) [-462.005] (-460.636) (-461.418) -- 0:00:08
859000 -- (-460.015) [-458.422] (-461.810) (-458.475) * (-462.291) (-462.830) (-461.179) [-464.084] -- 0:00:08
859500 -- (-460.890) (-459.558) [-464.148] (-459.397) * (-461.465) [-458.559] (-460.976) (-458.989) -- 0:00:08
860000 -- (-459.564) (-458.348) (-466.191) [-460.459] * (-457.920) [-458.852] (-460.420) (-460.156) -- 0:00:08
Average standard deviation of split frequencies: 0.009969
860500 -- (-457.929) [-459.644] (-461.287) (-460.207) * (-458.106) (-458.890) (-460.829) [-461.213] -- 0:00:08
861000 -- (-458.498) (-458.193) (-458.752) [-463.146] * [-459.604] (-459.329) (-459.383) (-461.219) -- 0:00:08
861500 -- [-460.591] (-460.141) (-458.091) (-464.206) * (-459.609) [-460.584] (-459.092) (-460.457) -- 0:00:08
862000 -- (-458.271) (-461.031) (-459.323) [-462.606] * (-457.806) (-459.547) (-460.901) [-461.433] -- 0:00:08
862500 -- (-462.045) (-458.637) [-458.755] (-462.138) * (-457.677) [-459.949] (-462.339) (-463.190) -- 0:00:08
863000 -- (-458.116) (-457.993) [-461.830] (-462.772) * (-457.670) (-458.691) [-459.064] (-466.059) -- 0:00:08
863500 -- (-458.578) [-459.667] (-462.697) (-459.014) * (-458.360) (-459.563) [-459.310] (-462.545) -- 0:00:08
864000 -- (-459.493) (-459.346) [-459.462] (-458.341) * [-461.695] (-461.566) (-460.450) (-459.215) -- 0:00:08
864500 -- (-466.404) (-459.033) (-458.865) [-459.631] * (-459.849) (-458.527) (-459.073) [-458.416] -- 0:00:08
865000 -- (-457.510) (-458.524) (-458.764) [-458.367] * (-460.609) [-457.670] (-459.112) (-460.198) -- 0:00:08
Average standard deviation of split frequencies: 0.010560
865500 -- (-460.246) [-458.048] (-461.036) (-457.991) * [-459.753] (-460.612) (-461.650) (-461.288) -- 0:00:08
866000 -- (-467.161) (-458.902) (-457.963) [-458.050] * [-458.973] (-462.023) (-463.237) (-459.825) -- 0:00:08
866500 -- (-458.058) (-460.620) (-457.947) [-457.687] * (-457.550) (-462.225) (-460.653) [-458.024] -- 0:00:08
867000 -- (-458.178) (-459.130) [-458.363] (-461.270) * (-458.683) (-459.730) [-466.403] (-458.475) -- 0:00:08
867500 -- (-461.369) [-458.163] (-460.542) (-463.663) * (-461.188) [-459.077] (-460.265) (-459.081) -- 0:00:08
868000 -- (-463.633) [-458.772] (-459.349) (-461.099) * (-460.540) (-461.914) [-459.945] (-459.830) -- 0:00:08
868500 -- (-463.820) [-459.224] (-462.112) (-460.082) * (-458.597) [-457.602] (-459.479) (-458.018) -- 0:00:08
869000 -- [-468.216] (-459.018) (-458.340) (-458.242) * (-458.424) [-459.118] (-460.073) (-459.549) -- 0:00:08
869500 -- (-467.088) (-458.320) [-458.252] (-460.087) * (-459.824) [-462.513] (-458.465) (-461.428) -- 0:00:08
870000 -- [-465.263] (-458.548) (-461.306) (-462.763) * (-461.245) [-459.465] (-457.637) (-459.459) -- 0:00:08
Average standard deviation of split frequencies: 0.010829
870500 -- (-464.231) (-460.063) [-461.804] (-459.761) * (-459.139) (-460.266) [-459.810] (-462.178) -- 0:00:08
871000 -- (-462.385) (-459.055) [-459.643] (-458.700) * [-463.345] (-458.414) (-460.841) (-459.932) -- 0:00:08
871500 -- [-459.905] (-459.698) (-458.623) (-459.720) * (-458.955) (-459.010) (-461.148) [-462.068] -- 0:00:08
872000 -- (-460.430) (-459.222) [-462.326] (-460.796) * [-460.527] (-462.536) (-459.080) (-459.503) -- 0:00:08
872500 -- (-459.855) [-458.533] (-462.961) (-461.341) * (-458.701) [-462.413] (-459.604) (-460.793) -- 0:00:08
873000 -- (-461.084) (-458.078) [-462.502] (-460.643) * (-465.318) (-460.032) [-459.280] (-458.476) -- 0:00:08
873500 -- (-464.404) [-457.989] (-459.273) (-458.551) * [-466.244] (-461.361) (-459.605) (-458.323) -- 0:00:07
874000 -- (-460.748) (-459.427) (-461.301) [-461.255] * [-462.391] (-462.707) (-463.159) (-461.496) -- 0:00:07
874500 -- [-460.167] (-463.526) (-458.769) (-457.787) * (-461.465) (-458.984) [-463.334] (-461.159) -- 0:00:07
875000 -- (-458.660) (-462.955) [-458.043] (-461.585) * (-459.375) [-458.913] (-466.149) (-459.994) -- 0:00:07
Average standard deviation of split frequencies: 0.011014
875500 -- (-460.694) (-458.664) [-461.963] (-461.878) * (-461.412) (-463.343) (-463.363) [-463.530] -- 0:00:07
876000 -- (-464.353) [-460.070] (-458.570) (-459.358) * (-462.969) (-458.414) (-458.960) [-461.112] -- 0:00:07
876500 -- (-459.572) (-458.660) (-462.492) [-458.326] * (-463.202) (-458.949) (-463.074) [-460.981] -- 0:00:07
877000 -- (-459.274) (-461.134) (-459.736) [-460.136] * (-461.020) (-459.308) [-459.729] (-460.802) -- 0:00:07
877500 -- (-460.979) (-458.226) [-459.392] (-460.101) * (-460.129) (-458.532) [-458.832] (-460.833) -- 0:00:07
878000 -- (-460.665) (-461.262) (-462.268) [-460.603] * (-458.938) (-458.953) [-458.525] (-463.941) -- 0:00:07
878500 -- (-458.527) (-464.157) [-460.662] (-462.283) * (-459.907) (-463.784) [-457.958] (-460.015) -- 0:00:07
879000 -- (-459.094) (-459.119) (-457.769) [-458.637] * (-461.021) (-459.814) (-458.505) [-460.402] -- 0:00:07
879500 -- (-458.808) (-459.270) (-459.246) [-460.125] * (-460.599) (-460.343) [-458.471] (-461.893) -- 0:00:07
880000 -- (-458.626) (-460.336) (-459.767) [-457.775] * (-459.271) [-457.816] (-459.115) (-460.866) -- 0:00:07
Average standard deviation of split frequencies: 0.010599
880500 -- (-458.453) [-458.173] (-461.110) (-460.965) * (-460.487) (-458.910) (-459.946) [-461.343] -- 0:00:07
881000 -- (-459.109) [-459.008] (-460.208) (-460.005) * (-460.768) [-460.231] (-461.659) (-459.911) -- 0:00:07
881500 -- (-459.267) [-458.475] (-458.221) (-459.552) * (-458.265) (-460.482) [-460.601] (-459.646) -- 0:00:07
882000 -- (-459.024) (-459.183) (-459.696) [-460.120] * (-458.647) (-460.356) [-458.000] (-464.581) -- 0:00:07
882500 -- [-458.512] (-458.710) (-460.819) (-464.635) * [-458.712] (-460.013) (-459.919) (-461.928) -- 0:00:07
883000 -- (-466.610) [-459.174] (-460.599) (-460.026) * (-457.713) (-457.913) [-459.809] (-460.326) -- 0:00:07
883500 -- [-458.031] (-459.098) (-460.933) (-459.198) * (-457.999) (-461.542) (-458.756) [-460.751] -- 0:00:07
884000 -- (-459.629) (-460.995) [-460.813] (-460.012) * (-458.444) (-463.515) [-459.617] (-460.548) -- 0:00:07
884500 -- (-458.825) (-460.206) [-457.609] (-457.964) * (-460.865) [-460.553] (-464.182) (-459.354) -- 0:00:07
885000 -- (-459.038) (-459.472) [-458.836] (-459.141) * (-460.897) [-457.603] (-459.287) (-459.846) -- 0:00:07
Average standard deviation of split frequencies: 0.010641
885500 -- (-462.782) (-460.159) (-461.994) [-458.863] * (-460.190) [-461.905] (-459.231) (-459.103) -- 0:00:07
886000 -- (-459.021) (-459.941) (-458.743) [-461.319] * (-459.382) (-459.845) (-461.870) [-459.000] -- 0:00:07
886500 -- (-461.322) (-459.671) [-459.109] (-459.019) * [-459.628] (-458.922) (-467.653) (-463.335) -- 0:00:07
887000 -- (-460.510) (-459.331) [-460.236] (-459.233) * (-459.468) (-461.070) (-462.885) [-459.918] -- 0:00:07
887500 -- (-457.926) [-459.778] (-460.411) (-459.891) * (-461.402) (-459.119) [-464.312] (-458.917) -- 0:00:07
888000 -- [-458.121] (-459.310) (-460.753) (-459.812) * (-460.115) (-459.944) [-466.505] (-462.615) -- 0:00:07
888500 -- (-458.769) [-459.611] (-459.792) (-461.265) * (-459.920) [-458.327] (-461.510) (-460.155) -- 0:00:07
889000 -- [-459.606] (-462.735) (-459.073) (-461.337) * (-459.727) [-459.021] (-459.388) (-459.960) -- 0:00:06
889500 -- [-457.682] (-460.837) (-458.377) (-459.420) * (-458.159) (-459.253) [-459.871] (-459.874) -- 0:00:06
890000 -- (-460.854) (-459.562) [-458.393] (-458.293) * (-461.238) [-461.757] (-459.265) (-461.571) -- 0:00:06
Average standard deviation of split frequencies: 0.010268
890500 -- (-460.511) [-461.102] (-460.366) (-458.310) * (-459.162) [-460.988] (-461.528) (-458.863) -- 0:00:06
891000 -- (-461.445) [-459.463] (-460.005) (-461.080) * (-459.277) [-461.211] (-458.149) (-462.085) -- 0:00:06
891500 -- [-460.725] (-459.691) (-460.312) (-461.209) * [-460.681] (-466.326) (-458.032) (-459.738) -- 0:00:06
892000 -- (-463.416) (-459.327) (-457.781) [-460.557] * [-458.803] (-457.683) (-459.491) (-460.851) -- 0:00:06
892500 -- (-459.054) [-458.179] (-457.840) (-459.555) * (-459.240) (-459.791) (-459.357) [-457.858] -- 0:00:06
893000 -- (-461.358) (-459.978) (-460.239) [-463.200] * (-457.995) [-458.907] (-459.432) (-460.435) -- 0:00:06
893500 -- (-461.711) (-464.532) (-458.040) [-465.360] * (-463.214) (-460.070) (-458.027) [-463.410] -- 0:00:06
894000 -- (-459.031) [-461.075] (-459.299) (-461.390) * (-458.543) [-460.807] (-459.530) (-460.724) -- 0:00:06
894500 -- (-459.768) [-458.509] (-457.736) (-468.818) * (-460.832) [-462.655] (-458.422) (-461.426) -- 0:00:06
895000 -- (-463.822) [-458.822] (-459.323) (-458.284) * (-461.829) (-458.859) (-459.279) [-460.362] -- 0:00:06
Average standard deviation of split frequencies: 0.010391
895500 -- (-459.818) (-458.755) [-461.214] (-459.996) * (-460.494) (-458.309) (-458.388) [-459.735] -- 0:00:06
896000 -- (-458.637) [-458.419] (-459.545) (-459.845) * (-459.390) [-458.987] (-458.827) (-461.943) -- 0:00:06
896500 -- [-458.501] (-460.941) (-460.422) (-460.015) * (-460.386) (-458.378) (-462.827) [-458.335] -- 0:00:06
897000 -- [-458.813] (-463.074) (-460.650) (-459.127) * [-459.087] (-458.924) (-462.931) (-466.786) -- 0:00:06
897500 -- (-460.133) (-461.015) (-461.057) [-461.562] * (-458.337) (-458.232) [-459.118] (-461.574) -- 0:00:06
898000 -- (-459.117) [-460.084] (-461.423) (-461.156) * (-458.454) (-458.463) [-459.261] (-459.564) -- 0:00:06
898500 -- (-460.487) [-458.824] (-460.699) (-458.783) * (-459.700) [-459.756] (-460.108) (-468.451) -- 0:00:06
899000 -- [-460.393] (-458.282) (-459.144) (-458.107) * [-461.693] (-460.579) (-459.343) (-462.009) -- 0:00:06
899500 -- (-464.159) (-458.605) (-459.061) [-458.003] * [-458.651] (-458.779) (-460.207) (-459.725) -- 0:00:06
900000 -- (-462.595) (-459.238) [-459.112] (-463.004) * (-458.532) (-459.120) [-460.047] (-459.074) -- 0:00:06
Average standard deviation of split frequencies: 0.010141
900500 -- [-458.837] (-459.122) (-462.230) (-461.661) * (-459.978) [-460.627] (-459.643) (-459.564) -- 0:00:06
901000 -- (-460.598) [-459.687] (-462.794) (-458.940) * [-459.189] (-460.692) (-458.915) (-459.550) -- 0:00:06
901500 -- (-458.832) [-460.432] (-463.538) (-459.511) * (-458.057) [-458.181] (-462.646) (-459.034) -- 0:00:06
902000 -- [-457.869] (-457.954) (-460.133) (-458.208) * (-460.137) [-462.209] (-457.857) (-460.162) -- 0:00:06
902500 -- [-458.597] (-463.156) (-461.059) (-457.848) * (-460.070) (-459.430) [-461.810] (-461.591) -- 0:00:06
903000 -- (-461.903) (-460.296) [-460.037] (-457.915) * (-462.428) (-461.439) (-459.843) [-459.378] -- 0:00:06
903500 -- [-465.104] (-461.777) (-461.162) (-457.847) * (-457.944) (-461.551) [-459.487] (-461.996) -- 0:00:06
904000 -- (-465.892) [-460.442] (-461.625) (-460.996) * (-459.260) [-462.087] (-464.562) (-459.645) -- 0:00:06
904500 -- (-460.265) (-464.040) [-461.228] (-461.106) * (-460.064) [-457.560] (-463.205) (-459.639) -- 0:00:06
905000 -- (-462.606) (-461.133) [-458.636] (-459.534) * [-462.599] (-458.095) (-458.958) (-460.414) -- 0:00:05
Average standard deviation of split frequencies: 0.010309
905500 -- (-462.737) [-459.567] (-460.611) (-461.784) * (-460.914) (-463.103) (-460.472) [-460.053] -- 0:00:05
906000 -- (-460.619) [-459.062] (-461.429) (-461.481) * (-457.952) [-458.214] (-460.275) (-459.497) -- 0:00:05
906500 -- (-460.924) [-459.671] (-460.346) (-458.494) * [-460.892] (-460.918) (-458.538) (-461.505) -- 0:00:05
907000 -- (-458.064) (-460.723) (-463.815) [-458.326] * (-460.430) [-458.769] (-459.163) (-460.670) -- 0:00:05
907500 -- (-459.565) (-462.821) (-459.222) [-458.437] * [-461.474] (-458.379) (-460.915) (-459.264) -- 0:00:05
908000 -- (-462.142) [-459.832] (-461.875) (-460.031) * [-457.965] (-460.015) (-460.112) (-458.335) -- 0:00:05
908500 -- (-460.441) [-458.670] (-460.476) (-459.771) * (-459.795) [-459.489] (-458.644) (-458.784) -- 0:00:05
909000 -- [-458.098] (-459.850) (-458.767) (-459.972) * (-458.113) (-464.264) (-458.731) [-459.052] -- 0:00:05
909500 -- (-459.022) (-460.620) (-460.351) [-458.829] * [-457.591] (-460.519) (-460.404) (-459.367) -- 0:00:05
910000 -- [-460.222] (-462.950) (-461.334) (-458.337) * (-458.491) [-459.650] (-459.629) (-458.949) -- 0:00:05
Average standard deviation of split frequencies: 0.009868
910500 -- (-464.921) (-457.899) [-458.514] (-458.339) * (-460.315) [-458.574] (-460.209) (-460.083) -- 0:00:05
911000 -- (-463.913) (-460.077) (-459.705) [-459.846] * (-457.872) (-461.111) (-460.296) [-458.773] -- 0:00:05
911500 -- (-459.264) [-458.548] (-458.514) (-458.785) * [-457.818] (-460.909) (-458.560) (-459.105) -- 0:00:05
912000 -- [-458.111] (-458.954) (-458.737) (-458.054) * (-459.215) [-458.355] (-458.794) (-460.053) -- 0:00:05
912500 -- [-458.207] (-458.482) (-459.302) (-459.181) * (-460.090) [-458.287] (-459.844) (-457.976) -- 0:00:05
913000 -- [-458.931] (-459.361) (-459.204) (-459.646) * [-458.588] (-459.660) (-459.909) (-458.639) -- 0:00:05
913500 -- [-458.525] (-457.927) (-458.766) (-458.527) * (-464.060) (-457.961) [-458.574] (-461.460) -- 0:00:05
914000 -- [-460.352] (-459.461) (-459.350) (-459.712) * (-459.741) [-457.699] (-458.051) (-459.482) -- 0:00:05
914500 -- [-460.136] (-460.573) (-460.275) (-459.541) * (-458.223) (-458.437) (-460.737) [-458.553] -- 0:00:05
915000 -- [-459.672] (-461.915) (-462.837) (-461.855) * (-458.644) [-460.822] (-461.898) (-459.151) -- 0:00:05
Average standard deviation of split frequencies: 0.009401
915500 -- (-461.135) [-461.713] (-459.422) (-459.524) * (-461.941) (-461.249) [-458.367] (-460.752) -- 0:00:05
916000 -- (-458.311) (-458.117) (-465.581) [-458.381] * (-464.610) [-460.147] (-458.311) (-460.490) -- 0:00:05
916500 -- [-458.911] (-458.589) (-459.494) (-459.803) * (-459.036) (-462.717) (-459.328) [-458.370] -- 0:00:05
917000 -- (-459.339) (-459.457) (-459.718) [-457.942] * (-458.174) (-461.753) [-457.795] (-461.014) -- 0:00:05
917500 -- (-459.512) (-459.434) (-459.415) [-458.319] * (-460.776) (-459.878) (-458.981) [-458.314] -- 0:00:05
918000 -- (-459.615) (-461.246) [-459.062] (-459.402) * (-459.676) (-458.914) (-459.774) [-459.912] -- 0:00:05
918500 -- [-460.339] (-458.483) (-458.068) (-461.798) * (-459.221) (-458.795) (-458.866) [-460.469] -- 0:00:05
919000 -- [-460.809] (-460.708) (-459.415) (-462.522) * (-458.417) [-460.231] (-459.283) (-467.364) -- 0:00:05
919500 -- (-458.913) (-459.697) [-461.245] (-460.536) * (-459.586) [-459.705] (-461.259) (-458.134) -- 0:00:05
920000 -- (-461.671) (-459.371) [-457.795] (-464.731) * (-458.518) (-459.293) [-462.170] (-460.210) -- 0:00:05
Average standard deviation of split frequencies: 0.009251
920500 -- (-460.197) (-459.333) (-461.611) [-458.416] * (-460.832) [-458.301] (-462.729) (-461.368) -- 0:00:05
921000 -- (-460.351) [-459.486] (-459.118) (-459.896) * (-462.204) [-458.380] (-458.538) (-459.967) -- 0:00:04
921500 -- (-463.406) (-458.977) (-460.275) [-459.282] * (-459.677) [-465.245] (-459.275) (-460.364) -- 0:00:04
922000 -- (-459.858) [-458.895] (-463.110) (-458.110) * (-458.098) [-458.247] (-463.362) (-460.385) -- 0:00:04
922500 -- [-458.040] (-459.766) (-459.587) (-458.290) * (-458.463) [-458.643] (-462.999) (-459.019) -- 0:00:04
923000 -- (-457.707) [-461.963] (-459.560) (-458.943) * (-459.754) (-459.779) (-461.331) [-458.327] -- 0:00:04
923500 -- (-459.118) (-458.220) (-460.180) [-460.012] * (-458.779) [-461.015] (-458.481) (-458.662) -- 0:00:04
924000 -- (-459.646) [-457.507] (-459.972) (-461.499) * (-462.749) (-458.341) (-462.865) [-458.461] -- 0:00:04
924500 -- (-458.863) (-461.236) [-458.220] (-462.463) * [-458.604] (-459.873) (-461.367) (-458.286) -- 0:00:04
925000 -- (-464.621) [-459.791] (-458.394) (-459.880) * (-459.899) (-462.710) [-459.760] (-459.349) -- 0:00:04
Average standard deviation of split frequencies: 0.009401
925500 -- (-459.283) (-459.715) (-458.995) [-461.820] * (-460.638) (-460.398) [-461.383] (-460.692) -- 0:00:04
926000 -- (-458.499) (-459.425) (-463.664) [-460.163] * (-460.174) (-458.493) [-461.314] (-458.425) -- 0:00:04
926500 -- (-458.210) (-458.952) (-462.913) [-461.684] * (-461.258) [-460.898] (-460.459) (-458.264) -- 0:00:04
927000 -- (-465.085) (-457.873) (-461.221) [-459.346] * (-458.632) (-463.267) (-461.017) [-460.177] -- 0:00:04
927500 -- (-463.287) (-459.031) (-458.740) [-458.003] * (-460.571) (-462.377) (-460.018) [-460.281] -- 0:00:04
928000 -- [-460.057] (-457.973) (-457.933) (-458.092) * (-459.925) (-458.678) (-458.209) [-460.179] -- 0:00:04
928500 -- (-461.183) [-457.874] (-462.964) (-458.607) * [-460.298] (-460.834) (-464.655) (-460.002) -- 0:00:04
929000 -- (-459.716) (-459.817) [-458.435] (-458.587) * (-460.860) (-459.553) [-461.676] (-457.475) -- 0:00:04
929500 -- (-459.385) (-458.427) (-458.106) [-458.616] * (-469.235) [-463.508] (-460.323) (-458.443) -- 0:00:04
930000 -- (-458.085) [-458.676] (-460.851) (-460.868) * (-459.531) (-461.887) (-459.756) [-458.680] -- 0:00:04
Average standard deviation of split frequencies: 0.009320
930500 -- (-457.798) (-461.692) (-458.573) [-459.455] * (-459.727) (-458.984) [-457.921] (-461.188) -- 0:00:04
931000 -- (-458.017) (-462.552) [-460.400] (-461.027) * (-461.086) [-458.170] (-459.952) (-458.441) -- 0:00:04
931500 -- (-458.287) (-459.546) [-458.731] (-458.901) * (-458.056) (-458.615) (-461.226) [-458.992] -- 0:00:04
932000 -- (-460.604) (-458.543) [-459.808] (-459.852) * [-461.761] (-458.202) (-458.403) (-461.039) -- 0:00:04
932500 -- (-461.401) [-459.020] (-461.412) (-459.644) * (-461.509) [-458.359] (-459.077) (-459.893) -- 0:00:04
933000 -- (-457.883) [-460.746] (-461.075) (-459.611) * (-459.927) (-461.725) (-459.386) [-461.954] -- 0:00:04
933500 -- [-461.581] (-459.389) (-459.652) (-463.812) * (-461.074) (-467.083) (-459.090) [-459.808] -- 0:00:04
934000 -- (-458.524) (-459.849) [-460.798] (-463.025) * (-462.401) [-464.713] (-459.288) (-463.305) -- 0:00:04
934500 -- (-457.971) (-459.746) [-460.420] (-460.314) * (-462.883) (-463.806) [-459.148] (-457.893) -- 0:00:04
935000 -- (-459.019) [-457.520] (-461.865) (-460.462) * (-457.603) (-459.301) [-458.950] (-457.585) -- 0:00:04
Average standard deviation of split frequencies: 0.009670
935500 -- (-459.869) [-460.914] (-463.414) (-458.570) * [-457.664] (-457.767) (-460.232) (-457.466) -- 0:00:04
936000 -- (-459.304) (-462.069) (-461.473) [-459.458] * [-460.101] (-459.884) (-461.553) (-459.572) -- 0:00:04
936500 -- [-459.060] (-460.000) (-461.451) (-459.447) * [-460.313] (-459.407) (-458.693) (-461.541) -- 0:00:04
937000 -- [-458.313] (-459.289) (-460.902) (-460.238) * [-460.598] (-461.225) (-460.611) (-459.911) -- 0:00:03
937500 -- [-459.736] (-459.383) (-465.795) (-462.123) * (-460.988) [-459.050] (-461.279) (-458.753) -- 0:00:03
938000 -- (-460.172) [-460.718] (-459.796) (-458.696) * (-462.998) (-459.191) (-459.306) [-458.247] -- 0:00:03
938500 -- (-459.348) (-458.744) [-457.663] (-464.102) * (-462.931) [-458.822] (-464.488) (-460.890) -- 0:00:03
939000 -- [-459.808] (-459.629) (-460.910) (-469.328) * [-461.782] (-459.387) (-459.413) (-461.304) -- 0:00:03
939500 -- (-460.794) (-459.094) [-459.530] (-467.496) * (-458.904) (-459.406) [-460.116] (-462.841) -- 0:00:03
940000 -- [-459.204] (-458.831) (-462.000) (-462.953) * (-458.700) [-459.794] (-458.224) (-462.356) -- 0:00:03
Average standard deviation of split frequencies: 0.009388
940500 -- [-459.605] (-461.065) (-460.653) (-459.439) * (-458.288) (-459.572) [-458.051] (-459.217) -- 0:00:03
941000 -- (-459.439) [-460.633] (-459.017) (-459.073) * [-458.276] (-461.989) (-460.993) (-458.737) -- 0:00:03
941500 -- (-459.923) (-460.659) [-458.461] (-463.852) * [-461.475] (-463.119) (-459.066) (-461.403) -- 0:00:03
942000 -- [-458.334] (-460.172) (-459.127) (-463.233) * (-458.633) (-462.266) (-459.566) [-459.858] -- 0:00:03
942500 -- [-461.372] (-459.903) (-462.278) (-459.991) * (-462.744) [-464.366] (-458.388) (-458.378) -- 0:00:03
943000 -- (-460.848) [-461.426] (-461.219) (-458.730) * [-463.180] (-460.197) (-463.331) (-459.967) -- 0:00:03
943500 -- [-460.557] (-460.007) (-462.829) (-460.622) * (-467.620) [-458.251] (-466.117) (-460.858) -- 0:00:03
944000 -- (-460.391) (-464.270) [-458.907] (-460.263) * (-466.267) (-458.370) [-462.336] (-461.190) -- 0:00:03
944500 -- [-461.519] (-461.757) (-458.166) (-458.556) * (-463.218) [-463.007] (-461.723) (-460.994) -- 0:00:03
945000 -- (-458.629) [-464.971] (-460.836) (-458.205) * (-463.508) (-460.618) (-459.315) [-458.931] -- 0:00:03
Average standard deviation of split frequencies: 0.009202
945500 -- (-458.364) [-462.234] (-463.089) (-459.199) * (-463.267) (-459.859) (-462.176) [-459.221] -- 0:00:03
946000 -- [-458.877] (-462.696) (-459.783) (-459.678) * (-463.146) (-459.715) (-460.144) [-457.875] -- 0:00:03
946500 -- (-458.738) [-459.131] (-458.718) (-465.339) * (-458.155) (-461.277) [-459.386] (-458.857) -- 0:00:03
947000 -- (-461.537) (-460.966) (-458.709) [-463.814] * (-459.742) (-458.935) (-458.020) [-460.710] -- 0:00:03
947500 -- (-460.076) [-460.406] (-461.050) (-462.892) * (-460.707) (-460.873) [-458.246] (-458.701) -- 0:00:03
948000 -- (-457.569) (-462.429) [-459.707] (-462.943) * [-463.706] (-459.023) (-460.115) (-459.767) -- 0:00:03
948500 -- (-462.192) [-460.106] (-461.205) (-461.044) * (-460.217) (-460.328) (-459.039) [-459.459] -- 0:00:03
949000 -- [-460.035] (-459.649) (-459.423) (-461.652) * [-467.738] (-459.247) (-458.968) (-460.348) -- 0:00:03
949500 -- (-460.254) (-459.113) [-459.643] (-462.688) * (-461.333) (-459.073) [-460.282] (-462.735) -- 0:00:03
950000 -- [-459.580] (-462.298) (-462.518) (-460.124) * (-460.051) [-463.506] (-459.130) (-458.088) -- 0:00:03
Average standard deviation of split frequencies: 0.009157
950500 -- (-461.556) (-460.803) [-460.345] (-461.940) * (-459.273) [-458.327] (-460.036) (-460.202) -- 0:00:03
951000 -- (-459.559) (-458.937) [-458.569] (-463.013) * (-459.356) (-458.317) [-457.855] (-459.150) -- 0:00:03
951500 -- (-459.192) (-460.521) (-459.038) [-458.489] * [-458.500] (-458.916) (-459.649) (-466.696) -- 0:00:03
952000 -- (-460.887) [-459.490] (-464.441) (-457.674) * (-458.106) (-459.020) (-462.097) [-459.115] -- 0:00:03
952500 -- (-458.232) [-460.561] (-464.668) (-459.387) * (-460.430) (-459.104) (-459.036) [-459.452] -- 0:00:02
953000 -- (-462.085) (-457.997) [-460.445] (-458.204) * (-459.272) (-461.407) (-459.669) [-460.052] -- 0:00:02
953500 -- (-460.817) (-457.765) (-461.664) [-459.104] * (-459.090) (-458.862) [-459.341] (-462.527) -- 0:00:02
954000 -- (-457.879) (-457.762) [-461.089] (-461.399) * (-459.009) (-459.399) [-458.871] (-461.248) -- 0:00:02
954500 -- (-459.462) [-458.137] (-458.476) (-460.181) * (-459.106) [-457.722] (-463.885) (-459.672) -- 0:00:02
955000 -- (-464.656) (-459.990) (-459.005) [-459.485] * (-459.353) [-457.752] (-459.198) (-459.857) -- 0:00:02
Average standard deviation of split frequencies: 0.009599
955500 -- (-459.251) (-461.114) (-462.125) [-458.762] * (-461.807) (-458.425) (-461.929) [-459.259] -- 0:00:02
956000 -- (-458.474) [-460.405] (-459.825) (-459.429) * (-461.352) (-458.114) [-457.981] (-461.572) -- 0:00:02
956500 -- [-459.626] (-461.155) (-458.739) (-459.640) * (-459.740) (-458.256) (-460.076) [-458.256] -- 0:00:02
957000 -- (-459.684) [-459.048] (-464.461) (-459.269) * [-463.177] (-462.390) (-461.367) (-460.331) -- 0:00:02
957500 -- (-459.593) (-459.691) [-458.606] (-461.514) * (-459.233) (-460.235) (-464.012) [-459.330] -- 0:00:02
958000 -- (-459.534) (-458.861) (-459.892) [-459.614] * (-461.508) [-462.343] (-461.544) (-459.309) -- 0:00:02
958500 -- (-460.704) [-457.735] (-458.935) (-461.537) * (-459.024) (-458.634) [-458.838] (-460.344) -- 0:00:02
959000 -- (-459.892) (-457.543) [-458.513] (-458.698) * (-458.686) (-457.518) (-462.955) [-460.273] -- 0:00:02
959500 -- [-459.816] (-458.692) (-459.292) (-462.844) * (-460.031) (-459.841) [-460.407] (-458.174) -- 0:00:02
960000 -- (-459.096) [-458.678] (-459.517) (-458.749) * (-461.040) (-459.812) (-459.602) [-458.735] -- 0:00:02
Average standard deviation of split frequencies: 0.009487
960500 -- (-460.543) [-460.944] (-460.142) (-458.735) * (-460.619) (-459.056) [-458.562] (-459.119) -- 0:00:02
961000 -- (-464.452) [-459.609] (-457.722) (-460.329) * (-459.997) (-459.159) (-458.959) [-458.757] -- 0:00:02
961500 -- (-460.037) [-458.824] (-461.835) (-459.295) * [-459.589] (-459.302) (-457.990) (-461.196) -- 0:00:02
962000 -- (-459.850) [-459.048] (-463.353) (-460.216) * (-460.086) (-460.987) [-458.394] (-457.883) -- 0:00:02
962500 -- (-459.024) [-458.180] (-463.281) (-460.446) * [-458.763] (-458.001) (-461.391) (-458.708) -- 0:00:02
963000 -- (-460.779) [-459.807] (-464.617) (-463.252) * (-458.966) [-458.000] (-459.216) (-459.478) -- 0:00:02
963500 -- (-460.112) (-459.031) [-462.526] (-458.856) * (-461.525) (-459.731) [-462.953] (-459.814) -- 0:00:02
964000 -- (-459.414) [-459.375] (-458.012) (-459.996) * (-461.165) (-459.265) (-458.952) [-458.360] -- 0:00:02
964500 -- [-459.539] (-461.332) (-460.923) (-458.290) * (-462.464) (-459.697) (-461.553) [-459.377] -- 0:00:02
965000 -- [-458.636] (-458.394) (-464.130) (-460.072) * (-459.125) (-460.924) (-462.542) [-458.802] -- 0:00:02
Average standard deviation of split frequencies: 0.009500
965500 -- (-458.260) (-458.429) (-460.262) [-460.089] * (-459.206) (-458.875) (-458.869) [-459.088] -- 0:00:02
966000 -- (-458.319) (-458.966) (-460.521) [-457.693] * (-460.135) (-457.676) [-458.848] (-460.957) -- 0:00:02
966500 -- (-460.249) [-460.996] (-460.600) (-457.669) * (-459.442) (-462.671) [-461.829] (-461.207) -- 0:00:02
967000 -- (-459.650) [-462.017] (-458.850) (-458.574) * (-459.664) [-459.096] (-463.599) (-457.984) -- 0:00:02
967500 -- (-464.291) (-460.121) [-459.549] (-457.586) * (-458.586) (-459.002) (-462.884) [-458.198] -- 0:00:02
968000 -- (-460.770) [-459.064] (-459.170) (-460.344) * (-459.837) (-461.766) (-461.198) [-458.630] -- 0:00:02
968500 -- [-460.917] (-460.193) (-458.854) (-461.599) * (-459.957) (-463.846) [-460.174] (-458.407) -- 0:00:01
969000 -- (-460.744) (-462.392) (-458.963) [-458.407] * (-458.586) [-465.917] (-459.990) (-461.647) -- 0:00:01
969500 -- (-458.929) (-463.568) [-459.805] (-461.743) * (-463.160) [-460.166] (-461.705) (-459.239) -- 0:00:01
970000 -- (-459.164) [-466.129] (-461.248) (-459.030) * (-459.438) [-464.634] (-461.742) (-459.699) -- 0:00:01
Average standard deviation of split frequencies: 0.009379
970500 -- (-459.969) (-460.224) (-461.637) [-458.441] * (-460.444) (-463.487) (-461.725) [-459.564] -- 0:00:01
971000 -- (-458.538) [-462.526] (-459.918) (-459.887) * (-457.745) [-462.260] (-460.380) (-458.897) -- 0:00:01
971500 -- [-458.466] (-460.150) (-460.802) (-459.265) * (-461.466) [-464.130] (-458.046) (-457.880) -- 0:00:01
972000 -- (-457.864) (-459.077) (-461.997) [-462.479] * (-460.178) [-458.057] (-458.026) (-459.679) -- 0:00:01
972500 -- [-458.420] (-460.124) (-465.956) (-459.411) * (-460.403) (-458.200) (-457.938) [-459.540] -- 0:00:01
973000 -- [-459.776] (-463.326) (-458.968) (-457.965) * (-459.732) (-460.456) [-460.238] (-462.706) -- 0:00:01
973500 -- [-460.440] (-464.656) (-458.476) (-459.919) * (-462.739) [-460.031] (-459.954) (-461.898) -- 0:00:01
974000 -- (-460.493) (-458.852) (-458.021) [-462.475] * [-460.354] (-459.398) (-458.323) (-460.440) -- 0:00:01
974500 -- (-461.142) (-458.595) [-459.142] (-463.471) * (-457.823) (-461.677) (-458.354) [-461.424] -- 0:00:01
975000 -- (-458.589) (-460.255) (-460.725) [-461.410] * (-459.112) [-458.947] (-462.663) (-464.488) -- 0:00:01
Average standard deviation of split frequencies: 0.008823
975500 -- (-458.039) (-458.588) [-460.209] (-462.346) * (-457.924) (-461.891) [-459.446] (-463.688) -- 0:00:01
976000 -- (-459.903) (-459.548) (-460.558) [-460.387] * (-459.759) (-460.365) [-459.983] (-467.667) -- 0:00:01
976500 -- (-463.056) [-462.418] (-459.108) (-461.393) * (-458.724) [-458.537] (-460.075) (-461.297) -- 0:00:01
977000 -- (-460.524) (-459.631) [-457.989] (-458.838) * (-459.835) [-459.860] (-461.239) (-461.530) -- 0:00:01
977500 -- (-461.016) (-460.250) [-459.607] (-458.019) * (-458.865) (-458.714) (-460.732) [-457.728] -- 0:00:01
978000 -- [-458.488] (-460.267) (-459.300) (-457.899) * (-462.532) [-458.578] (-458.302) (-459.653) -- 0:00:01
978500 -- (-461.304) (-460.718) [-462.613] (-460.285) * (-460.588) [-459.902] (-461.580) (-460.150) -- 0:00:01
979000 -- [-458.797] (-459.482) (-464.710) (-458.735) * [-458.370] (-459.890) (-463.490) (-461.061) -- 0:00:01
979500 -- (-459.937) (-459.586) (-459.630) [-460.918] * [-462.172] (-465.635) (-460.327) (-458.598) -- 0:00:01
980000 -- (-464.730) [-458.131] (-465.708) (-458.208) * (-462.277) [-458.736] (-459.656) (-458.794) -- 0:00:01
Average standard deviation of split frequencies: 0.008909
980500 -- [-459.762] (-463.573) (-457.677) (-459.479) * (-457.867) [-458.760] (-459.710) (-459.066) -- 0:00:01
981000 -- [-457.937] (-458.091) (-460.157) (-461.864) * (-459.629) (-458.882) [-459.725] (-460.006) -- 0:00:01
981500 -- [-457.971] (-459.445) (-458.775) (-457.742) * (-460.447) (-464.926) (-458.085) [-459.096] -- 0:00:01
982000 -- (-459.840) (-460.196) (-458.053) [-458.891] * [-459.504] (-458.117) (-459.420) (-461.104) -- 0:00:01
982500 -- (-458.696) (-464.799) (-457.769) [-458.669] * [-458.381] (-459.518) (-458.916) (-460.522) -- 0:00:01
983000 -- (-461.661) (-459.864) [-460.989] (-459.004) * [-458.102] (-464.565) (-462.226) (-459.205) -- 0:00:01
983500 -- (-458.052) [-459.827] (-458.533) (-461.276) * (-458.886) (-459.564) (-461.413) [-460.141] -- 0:00:01
984000 -- (-460.582) (-458.295) [-461.781] (-466.702) * (-458.792) [-458.175] (-461.055) (-460.326) -- 0:00:01
984500 -- [-459.029] (-462.269) (-458.543) (-463.883) * [-463.061] (-458.168) (-461.613) (-459.018) -- 0:00:00
985000 -- (-459.300) [-459.402] (-459.230) (-458.891) * (-460.539) (-459.951) [-458.433] (-458.132) -- 0:00:00
Average standard deviation of split frequencies: 0.009020
985500 -- (-458.066) [-459.036] (-458.084) (-461.626) * [-459.545] (-460.109) (-459.796) (-458.597) -- 0:00:00
986000 -- [-460.564] (-460.646) (-458.221) (-460.278) * (-466.013) (-459.059) (-460.131) [-459.482] -- 0:00:00
986500 -- (-460.563) [-459.487] (-462.554) (-458.214) * (-461.934) (-461.185) (-460.830) [-457.881] -- 0:00:00
987000 -- (-463.278) (-462.003) (-461.081) [-458.937] * (-462.400) (-457.990) [-460.271] (-460.767) -- 0:00:00
987500 -- [-459.712] (-461.543) (-461.145) (-458.295) * [-459.137] (-457.967) (-458.147) (-460.842) -- 0:00:00
988000 -- [-459.743] (-462.388) (-463.230) (-458.283) * (-461.763) [-463.974] (-465.502) (-458.868) -- 0:00:00
988500 -- (-461.028) (-458.775) (-458.832) [-459.696] * [-460.543] (-459.848) (-464.277) (-460.297) -- 0:00:00
989000 -- (-459.096) (-457.446) (-463.385) [-462.526] * [-460.206] (-459.880) (-459.294) (-458.423) -- 0:00:00
989500 -- (-457.776) (-457.461) [-457.525] (-462.939) * (-459.777) [-458.769] (-457.688) (-459.123) -- 0:00:00
990000 -- [-457.849] (-457.826) (-457.544) (-459.136) * [-459.088] (-459.354) (-457.666) (-459.100) -- 0:00:00
Average standard deviation of split frequencies: 0.009422
990500 -- (-459.169) (-458.775) (-463.399) [-458.925] * [-459.024] (-459.433) (-459.600) (-461.813) -- 0:00:00
991000 -- (-458.292) [-459.689] (-458.801) (-459.744) * (-461.318) (-459.520) [-460.420] (-459.691) -- 0:00:00
991500 -- (-461.098) (-461.005) [-461.073] (-459.614) * (-459.425) (-457.452) [-461.079] (-461.429) -- 0:00:00
992000 -- [-462.451] (-459.948) (-459.869) (-458.769) * (-462.363) (-458.719) (-458.973) [-461.134] -- 0:00:00
992500 -- [-461.192] (-459.880) (-464.334) (-459.065) * (-459.737) (-458.448) (-460.598) [-459.550] -- 0:00:00
993000 -- (-459.752) (-463.410) (-457.895) [-459.940] * (-458.295) (-461.040) (-458.020) [-461.418] -- 0:00:00
993500 -- (-459.476) (-463.128) (-458.343) [-459.270] * (-458.548) (-458.372) (-458.490) [-460.457] -- 0:00:00
994000 -- (-462.107) (-461.727) [-463.461] (-459.071) * [-459.305] (-461.428) (-458.000) (-458.777) -- 0:00:00
994500 -- [-459.287] (-457.778) (-457.502) (-461.219) * (-461.515) [-460.910] (-464.627) (-460.332) -- 0:00:00
995000 -- [-460.159] (-458.278) (-458.588) (-467.774) * (-458.459) (-462.795) [-458.896] (-460.330) -- 0:00:00
Average standard deviation of split frequencies: 0.009592
995500 -- (-459.395) (-460.123) (-457.795) [-459.104] * (-463.423) (-458.723) (-461.042) [-458.589] -- 0:00:00
996000 -- (-461.948) (-459.616) [-458.499] (-460.809) * (-460.281) (-457.600) (-459.726) [-458.343] -- 0:00:00
996500 -- (-460.095) (-461.178) [-458.215] (-458.339) * (-460.809) (-459.598) [-459.131] (-461.591) -- 0:00:00
997000 -- [-460.545] (-459.110) (-460.147) (-460.393) * [-457.959] (-460.887) (-460.578) (-460.077) -- 0:00:00
997500 -- (-459.554) (-460.100) [-460.246] (-459.643) * (-458.978) [-459.961] (-459.897) (-462.775) -- 0:00:00
998000 -- (-459.209) (-463.045) [-459.133] (-459.326) * (-464.762) (-457.543) [-458.834] (-460.007) -- 0:00:00
998500 -- (-460.590) (-460.691) (-460.680) [-461.322] * (-461.502) (-459.985) [-459.754] (-459.080) -- 0:00:00
999000 -- (-460.683) (-457.795) (-459.008) [-458.245] * [-460.080] (-458.557) (-466.207) (-458.917) -- 0:00:00
999500 -- (-459.320) [-457.593] (-459.350) (-458.742) * [-458.259] (-464.286) (-463.369) (-458.494) -- 0:00:00
1000000 -- [-459.694] (-458.486) (-457.987) (-458.519) * (-458.347) (-459.162) (-464.659) [-457.434] -- 0:00:00
Average standard deviation of split frequencies: 0.009233
Analysis completed in 1 mins 3 seconds
Analysis used 61.47 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -457.31
Likelihood of best state for "cold" chain of run 2 was -457.31
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.5 % ( 31 %) Dirichlet(Pi{all})
37.1 % ( 28 %) Slider(Pi{all})
78.9 % ( 54 %) Multiplier(Alpha{1,2})
77.8 % ( 52 %) Multiplier(Alpha{3})
25.4 % ( 29 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 32 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.3 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.0 % ( 28 %) Dirichlet(Pi{all})
37.3 % ( 27 %) Slider(Pi{all})
78.7 % ( 53 %) Multiplier(Alpha{1,2})
78.2 % ( 60 %) Multiplier(Alpha{3})
25.8 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % ( 99 %) NNI(Tau{all},V{all})
89.7 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.3 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166629 0.82 0.67
3 | 167120 166357 0.84
4 | 166762 167032 166100
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166821 0.82 0.67
3 | 166598 167052 0.84
4 | 166460 166808 166261
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -459.29
| 1 1 1 * * 2 |
| 2 12 1 1 2 1 |
| 2 1 21 2 2 2 22 2 |
|11 1211 21 1 22 * 12 2 1 |
| 2 2 2 21 1221 2 2 1 2 2 12|
| 22 22 1 1 11 1 1 1 1 1|
| 2 2 1 1 1 * 2 |
|2 1 1 1 1 1 2 2 * 2 1 2 1 |
| 1 1 2 2 1 1 |
| 112 12 1 1 21 |
| 2 1 2 2 2 |
| 2 1 2 |
| 2 |
| 1 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -460.82
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -459.09 -462.23
2 -459.07 -462.43
--------------------------------------
TOTAL -459.08 -462.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895426 0.089591 0.366414 1.495390 0.853962 1249.62 1375.31 1.000
r(A<->C){all} 0.194486 0.024437 0.000006 0.507161 0.155575 185.69 189.89 1.002
r(A<->G){all} 0.144894 0.015791 0.000013 0.401036 0.113176 203.22 247.27 1.001
r(A<->T){all} 0.155837 0.018822 0.000044 0.439840 0.116869 252.55 257.27 1.004
r(C<->G){all} 0.170429 0.022262 0.000026 0.485363 0.129907 151.83 247.02 1.004
r(C<->T){all} 0.169443 0.020034 0.000156 0.452559 0.134375 219.83 267.86 1.000
r(G<->T){all} 0.164911 0.020000 0.000038 0.457748 0.132201 235.00 343.22 1.011
pi(A){all} 0.210733 0.000510 0.168053 0.256718 0.210814 1194.46 1329.74 1.000
pi(C){all} 0.243578 0.000545 0.199730 0.290982 0.242850 1313.13 1327.57 1.001
pi(G){all} 0.317479 0.000640 0.270772 0.367700 0.316638 1013.66 1220.45 1.001
pi(T){all} 0.228211 0.000513 0.187026 0.275745 0.227585 1309.31 1347.75 1.000
alpha{1,2} 0.421294 0.227407 0.000261 1.414232 0.250565 1273.84 1333.57 1.000
alpha{3} 0.449548 0.220823 0.000108 1.372784 0.293569 1450.49 1475.75 1.000
pinvar{all} 0.995082 0.000034 0.983973 0.999993 0.996920 1218.43 1230.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- ..**..
9 -- ...**.
10 -- ....**
11 -- .***.*
12 -- .*.***
13 -- .*...*
14 -- ..*.*.
15 -- ..*..*
16 -- ...*.*
17 -- .**.**
18 -- .**...
19 -- .*.*..
20 -- .****.
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.029208 0.130580 0.171885 2
8 446 0.148568 0.002827 0.146569 0.150566 2
9 443 0.147568 0.012719 0.138574 0.156562 2
10 442 0.147235 0.006595 0.142572 0.151899 2
11 438 0.145903 0.018844 0.132578 0.159227 2
12 436 0.145237 0.016959 0.133245 0.157229 2
13 429 0.142905 0.009893 0.135909 0.149900 2
14 422 0.140573 0.000000 0.140573 0.140573 2
15 422 0.140573 0.004711 0.137242 0.143904 2
16 421 0.140240 0.006124 0.135909 0.144570 2
17 420 0.139907 0.004711 0.136576 0.143238 2
18 417 0.138907 0.012719 0.129913 0.147901 2
19 417 0.138907 0.009893 0.131912 0.145903 2
20 417 0.138907 0.001413 0.137908 0.139907 2
21 412 0.137242 0.001884 0.135909 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098934 0.009828 0.000004 0.297180 0.069115 1.000 2
length{all}[2] 0.098004 0.009061 0.000056 0.290234 0.068184 1.002 2
length{all}[3] 0.099949 0.010246 0.000060 0.299242 0.068626 1.000 2
length{all}[4] 0.098981 0.010261 0.000010 0.297945 0.068390 1.000 2
length{all}[5] 0.100705 0.010275 0.000083 0.304668 0.068911 1.000 2
length{all}[6] 0.097959 0.009590 0.000054 0.287380 0.066485 1.001 2
length{all}[7] 0.096118 0.008188 0.000514 0.268897 0.072490 1.001 2
length{all}[8] 0.097246 0.009239 0.000162 0.302942 0.073370 0.999 2
length{all}[9] 0.109368 0.010852 0.000266 0.336064 0.076901 1.003 2
length{all}[10] 0.107836 0.011199 0.000465 0.319172 0.073071 0.998 2
length{all}[11] 0.105581 0.010978 0.000006 0.310976 0.075112 1.019 2
length{all}[12] 0.102595 0.011348 0.000200 0.301551 0.071180 0.998 2
length{all}[13] 0.097550 0.008923 0.000118 0.291556 0.069994 1.001 2
length{all}[14] 0.090775 0.006726 0.000098 0.235772 0.069086 0.998 2
length{all}[15] 0.098750 0.011138 0.000292 0.289767 0.062138 0.998 2
length{all}[16] 0.099564 0.010193 0.000445 0.289738 0.066583 0.999 2
length{all}[17] 0.102360 0.010559 0.000238 0.289188 0.071400 0.998 2
length{all}[18] 0.096159 0.008477 0.000370 0.278528 0.068020 0.998 2
length{all}[19] 0.103933 0.011068 0.000037 0.311074 0.072834 1.000 2
length{all}[20] 0.082734 0.007491 0.000073 0.268795 0.054597 1.001 2
length{all}[21] 0.097231 0.010249 0.000052 0.292950 0.062764 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009233
Maximum standard deviation of split frequencies = 0.029208
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.019
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 333
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 111 / 111 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 111 / 111 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081874 0.061086 0.090908 0.035212 0.010441 0.068178 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -482.446265
Iterating by ming2
Initial: fx= 482.446265
x= 0.08187 0.06109 0.09091 0.03521 0.01044 0.06818 0.30000 1.30000
1 h-m-p 0.0000 0.0001 266.2040 ++ 475.690305 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0193 31.7912 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 243.0453 +++ 462.250212 m 0.0002 45 | 2/8
4 h-m-p 0.0019 0.0284 26.0403 ------------.. | 2/8
5 h-m-p 0.0000 0.0002 218.0137 +++ 450.902697 m 0.0002 78 | 3/8
6 h-m-p 0.0022 0.0710 20.3937 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 189.4949 ++ 448.553765 m 0.0001 110 | 4/8
8 h-m-p 0.0006 0.0937 15.5570 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 154.7489 ++ 445.519612 m 0.0001 141 | 5/8
10 h-m-p 0.0013 0.1396 10.5863 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 109.5982 ++ 444.514505 m 0.0001 172 | 6/8
12 h-m-p 0.3993 8.0000 0.0000 +++ 444.514505 m 8.0000 184 | 6/8
13 h-m-p 0.3015 8.0000 0.0000 +++ 444.514505 m 8.0000 198 | 6/8
14 h-m-p 0.0038 1.8774 0.1604 -----Y 444.514505 0 0.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 +++++ 444.514505 m 8.0000 232 | 6/8
16 h-m-p 0.0160 8.0000 0.1437 +++++ 444.514504 m 8.0000 248 | 6/8
17 h-m-p 0.2174 8.0000 5.2857 +++ 444.514490 m 8.0000 262 | 6/8
18 h-m-p 1.6000 8.0000 6.9578 ++ 444.514487 m 8.0000 273 | 6/8
19 h-m-p 1.6000 8.0000 10.9534 ++ 444.514485 m 8.0000 284 | 6/8
20 h-m-p 1.6000 8.0000 27.6708 ++ 444.514484 m 8.0000 295 | 6/8
21 h-m-p 1.4902 7.4511 79.7110 ++ 444.514483 m 7.4511 306 | 6/8
22 h-m-p 0.0000 0.0000 191.7704
h-m-p: 0.00000000e+00 0.00000000e+00 1.91770399e+02 444.514483
.. | 6/8
23 h-m-p 0.0160 8.0000 0.0000 C 444.514483 0 0.0160 325 | 7/8
24 h-m-p 1.1885 8.0000 0.0000 -------Y 444.514483 0 0.0000 345
Out..
lnL = -444.514483
346 lfun, 346 eigenQcodon, 2076 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022163 0.011431 0.026816 0.040294 0.107115 0.057366 999.000000 0.708389 0.588091
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.023439
np = 9
lnL0 = -473.101985
Iterating by ming2
Initial: fx= 473.101985
x= 0.02216 0.01143 0.02682 0.04029 0.10712 0.05737 951.42857 0.70839 0.58809
1 h-m-p 0.0000 0.0001 261.9055 ++ 465.851992 m 0.0001 14 | 1/9
2 h-m-p 0.0006 0.0080 43.3677 ++ 458.019409 m 0.0080 26 | 2/9
3 h-m-p 0.0000 0.0000 44076.9913 ++ 455.574427 m 0.0000 38 | 3/9
4 h-m-p 0.0001 0.0004 65.9905 ++ 453.237018 m 0.0004 50 | 4/9
5 h-m-p 0.0006 0.0035 42.1908 ++ 448.852425 m 0.0035 62 | 5/9
6 h-m-p 0.0000 0.0001 5398.6901 ++ 444.514509 m 0.0001 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ----Y 444.514509 0 0.0011 90 | 6/9
8 h-m-p 0.0160 8.0000 0.0000 +++++ 444.514509 m 8.0000 108 | 6/9
9 h-m-p 0.0035 1.7387 0.3728 +++++ 444.514502 m 1.7387 126 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 -Y 444.514502 0 0.1000 142 | 7/9
11 h-m-p 1.5000 8.0000 0.0000 Y 444.514502 0 1.5000 156
Out..
lnL = -444.514502
157 lfun, 471 eigenQcodon, 1884 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095281 0.058557 0.066707 0.039334 0.102004 0.044309 951.428903 1.789434 0.215134 0.269100 96.754977
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.002212
np = 11
lnL0 = -459.991161
Iterating by ming2
Initial: fx= 459.991161
x= 0.09528 0.05856 0.06671 0.03933 0.10200 0.04431 951.42890 1.78943 0.21513 0.26910 96.75498
1 h-m-p 0.0000 0.0026 35.9506 +++++ 455.167429 m 0.0026 19 | 1/11
2 h-m-p 0.0072 0.0359 9.9799 ++ 451.727344 m 0.0359 33 | 2/11
3 h-m-p 0.0000 0.0002 341.4707 ++ 451.527973 m 0.0002 47 | 3/11
4 h-m-p 0.0001 0.0005 450.8724 ++ 450.651717 m 0.0005 61 | 4/11
5 h-m-p 0.0000 0.0000 802848.9163 ++ 449.625117 m 0.0000 75 | 5/11
6 h-m-p 0.0001 0.0005 494.9519 ++ 448.652467 m 0.0005 89 | 6/11
7 h-m-p 0.1290 0.6450 1.5460 ++ 444.514485 m 0.6450 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 -C 444.514485 0 0.1000 118
Out..
lnL = -444.514485
119 lfun, 476 eigenQcodon, 2142 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -444.512568 S = -444.511997 -0.000218
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:01
did 20 / 47 patterns 0:01
did 30 / 47 patterns 0:01
did 40 / 47 patterns 0:01
did 47 / 47 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099605 0.024292 0.043587 0.020102 0.047384 0.077504 951.428906 0.300294 1.236519
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.041385
np = 9
lnL0 = -477.451054
Iterating by ming2
Initial: fx= 477.451054
x= 0.09960 0.02429 0.04359 0.02010 0.04738 0.07750 951.42891 0.30029 1.23652
1 h-m-p 0.0000 0.0002 249.2856 +++ 465.294387 m 0.0002 15 | 1/9
2 h-m-p 0.0054 0.1564 8.0205 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 233.4677 ++ 463.124826 m 0.0000 49 | 2/9
4 h-m-p 0.0015 0.2130 5.5739 -----------.. | 2/9
5 h-m-p 0.0000 0.0002 208.6397 +++ 454.966715 m 0.0002 83 | 3/9
6 h-m-p 0.0084 0.1781 3.9645 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 184.2381 ++ 453.737535 m 0.0000 118 | 4/9
8 h-m-p 0.0020 0.2003 2.6582 ------------.. | 4/9
9 h-m-p 0.0000 0.0003 149.4334 +++ 447.083457 m 0.0003 153 | 5/9
10 h-m-p 0.0183 0.2662 1.6760 -------------.. | 5/9
11 h-m-p 0.0000 0.0002 108.2236 +++ 444.514525 m 0.0002 189 | 6/9
12 h-m-p 0.2582 8.0000 0.0000 +++ 444.514525 m 8.0000 202 | 6/9
13 h-m-p 0.0172 8.0000 0.0048 +++++ 444.514525 m 8.0000 220 | 6/9
14 h-m-p 0.0896 8.0000 0.4276 ++++ 444.514518 m 8.0000 237 | 6/9
15 h-m-p 1.6000 8.0000 0.1640 ++ 444.514517 m 8.0000 252 | 6/9
16 h-m-p 0.6859 8.0000 1.9126 ++ 444.514516 m 8.0000 267 | 6/9
17 h-m-p 1.6000 8.0000 3.9851 ++ 444.514516 m 8.0000 279 | 6/9
18 h-m-p 1.6000 8.0000 0.2163 ++ 444.514516 m 8.0000 291 | 6/9
19 h-m-p 0.8657 8.0000 1.9990 ------C 444.514516 0 0.0001 312 | 6/9
20 h-m-p 1.1703 8.0000 0.0001 ++ 444.514516 m 8.0000 324 | 6/9
21 h-m-p 1.6000 8.0000 0.0001 --N 444.514516 0 0.0250 341
Out..
lnL = -444.514516
342 lfun, 3762 eigenQcodon, 20520 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.024704 0.093669 0.024796 0.053478 0.098694 0.046310 951.431997 0.900000 0.832977 1.097417 82.887290
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.003041
np = 11
lnL0 = -458.244991
Iterating by ming2
Initial: fx= 458.244991
x= 0.02470 0.09367 0.02480 0.05348 0.09869 0.04631 951.43200 0.90000 0.83298 1.09742 82.88729
1 h-m-p 0.0000 0.0013 67.7435 ++++ 453.434346 m 0.0013 18 | 1/11
2 h-m-p 0.0000 0.0000 171.2755 ++ 453.422844 m 0.0000 32 | 2/11
3 h-m-p 0.0000 0.0031 20.5420 +++YCYCCC 452.891345 5 0.0015 57 | 2/11
4 h-m-p 0.0038 0.0188 6.6920 ++ 451.933223 m 0.0188 71 | 3/11
5 h-m-p 0.0000 0.0001 1400.5026 ++ 448.969010 m 0.0001 85 | 4/11
6 h-m-p 0.0001 0.0007 176.9709 ++ 446.703240 m 0.0007 99 | 5/11
7 h-m-p 0.0035 0.0174 10.9549 ++ 444.514491 m 0.0174 113 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 444.514491 m 8.0000 127 | 6/11
9 h-m-p 0.0160 8.0000 0.0461 +++++ 444.514489 m 8.0000 149 | 6/11
10 h-m-p 0.7212 3.6059 0.4214 +
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
+ 444.514486 m 3.6059 168
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49494, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49468, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49481, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
11 h-m-p 1.6000 8.0000 0.3630
QuantileBeta(0.85, 3.07486, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.81504, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
+ 444.514484 m 8.0000 187
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39529, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39490, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.39510, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
12 h-m-p 1.6000 8.0000 0.8606
QuantileBeta(0.85, 6.77043, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.89643, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
+ 444.514484 m 8.0000 205
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27208, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27144, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.27176, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 1.4589 7.2943 1.7100
QuantileBeta(0.85, 14.76351, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.23874, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
+ 444.514483 m 7.2943 223
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.73049, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
14 h-m-p 0.0427 0.2134 115.9071
QuantileBeta(0.85, 19.78539, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.95010, 0.00500) = 1.000000e+00 2000 rounds
++ 444.514483 m 0.2134 237 | 8/11
15 h-m-p -0.0000 -0.0000 12.2397
h-m-p: -1.62614329e-17 -8.13071647e-17 1.22396643e+01 444.514483
.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 Y 444.514483 0 0.0160 262 | 8/11
17 h-m-p 0.0536 8.0000 0.0000 ----N 444.514483 0 0.0001 283
Out..
lnL = -444.514483
284 lfun, 3408 eigenQcodon, 18744 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -444.511988 S = -444.511888 -0.000044
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:12
did 20 / 47 patterns 0:13
did 30 / 47 patterns 0:13
did 40 / 47 patterns 0:13
did 47 / 47 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=111
NC_011896_1_WP_010908251_1_1364_MLBR_RS06420 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
NC_002677_1_NP_301930_1_802_ML1296 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF
**************************************************
NC_011896_1_WP_010908251_1_1364_MLBR_RS06420 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
NC_002677_1_NP_301930_1_802_ML1296 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200 HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR
**************************************************
NC_011896_1_WP_010908251_1_1364_MLBR_RS06420 DLVARTLTVSG
NC_002677_1_NP_301930_1_802_ML1296 DLVARTLTVSG
NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910 DLVARTLTVSG
NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905 DLVARTLTVSG
NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040 DLVARTLTVSG
NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200 DLVARTLTVSG
***********
>NC_011896_1_WP_010908251_1_1364_MLBR_RS06420 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA GATTTGGTCGCACGCACGTTAACGGTCTCAGGT >NC_002677_1_NP_301930_1_802_ML1296 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA GATTTGGTCGCACGCACGTTAACGGTCTCAGGT >NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA GATTTGGTCGCACGCACGTTAACGGTCTCAGGT >NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA GATTTGGTCGCACGCACGTTAACGGTCTCAGGT >NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA GATTTGGTCGCACGCACGTTAACGGTCTCAGGT >NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200 ATGTACCGGTTCGGGATGAGGTATCTTGACAGTATGACTGTCACCGTTGA CCGGCATGTGGCAGGCAACGAGTTTACCGTCGAGGAGATTTCGACGGGAA TTTTCGCCAGCGGGTATGGACAAGTCGGTGATGGACGCAGTTTTTCATTC CACATCGAGCACTGGTCGTTAGTCGTAGAAATTTACCGGACACGATTGGC CGGGCTTGTTCCGCAGACTGAAGAAGTAGTCCCGAGGGCGATCCGCGGGC TGGTCAACATCGACCTCACCGACGAACGCAGCCTGGCTGCGGCGGTGCGA GATTTGGTCGCACGCACGTTAACGGTCTCAGGT
>NC_011896_1_WP_010908251_1_1364_MLBR_RS06420 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR DLVARTLTVSG >NC_002677_1_NP_301930_1_802_ML1296 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR DLVARTLTVSG >NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR DLVARTLTVSG >NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR DLVARTLTVSG >NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR DLVARTLTVSG >NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200 MYRFGMRYLDSMTVTVDRHVAGNEFTVEEISTGIFASGYGQVGDGRSFSF HIEHWSLVVEIYRTRLAGLVPQTEEVVPRAIRGLVNIDLTDERSLAAAVR DLVARTLTVSG
#NEXUS
[ID: 5574132892]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908251_1_1364_MLBR_RS06420
NC_002677_1_NP_301930_1_802_ML1296
NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910
NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905
NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040
NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908251_1_1364_MLBR_RS06420,
2 NC_002677_1_NP_301930_1_802_ML1296,
3 NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910,
4 NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905,
5 NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040,
6 NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06911452,2:0.06818433,3:0.06862569,4:0.06838969,5:0.06891123,6:0.06648549);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06911452,2:0.06818433,3:0.06862569,4:0.06838969,5:0.06891123,6:0.06648549);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -459.09 -462.23
2 -459.07 -462.43
--------------------------------------
TOTAL -459.08 -462.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1296/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895426 0.089591 0.366414 1.495390 0.853962 1249.62 1375.31 1.000
r(A<->C){all} 0.194486 0.024437 0.000006 0.507161 0.155575 185.69 189.89 1.002
r(A<->G){all} 0.144894 0.015791 0.000013 0.401036 0.113176 203.22 247.27 1.001
r(A<->T){all} 0.155837 0.018822 0.000044 0.439840 0.116869 252.55 257.27 1.004
r(C<->G){all} 0.170429 0.022262 0.000026 0.485363 0.129907 151.83 247.02 1.004
r(C<->T){all} 0.169443 0.020034 0.000156 0.452559 0.134375 219.83 267.86 1.000
r(G<->T){all} 0.164911 0.020000 0.000038 0.457748 0.132201 235.00 343.22 1.011
pi(A){all} 0.210733 0.000510 0.168053 0.256718 0.210814 1194.46 1329.74 1.000
pi(C){all} 0.243578 0.000545 0.199730 0.290982 0.242850 1313.13 1327.57 1.001
pi(G){all} 0.317479 0.000640 0.270772 0.367700 0.316638 1013.66 1220.45 1.001
pi(T){all} 0.228211 0.000513 0.187026 0.275745 0.227585 1309.31 1347.75 1.000
alpha{1,2} 0.421294 0.227407 0.000261 1.414232 0.250565 1273.84 1333.57 1.000
alpha{3} 0.449548 0.220823 0.000108 1.372784 0.293569 1450.49 1475.75 1.000
pinvar{all} 0.995082 0.000034 0.983973 0.999993 0.996920 1218.43 1230.52 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1296/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 111
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 2 2 2 2 2 2 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 3 3 3 3 3 3 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 0 0 0 0 0 0 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 8 8 8 8 8 8 | GCC 2 2 2 2 2 2 | GAC 4 4 4 4 4 4 | GGC 1 1 1 1 1 1
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 2 2 2 2 2 2 | GCG 3 3 3 3 3 3 | GAG 4 4 4 4 4 4 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908251_1_1364_MLBR_RS06420
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
#2: NC_002677_1_NP_301930_1_802_ML1296
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
#3: NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
#4: NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
#5: NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
#6: NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 18 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 0
CTC 6 | CCC 0 | CAC 12 | CGC 24
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 12
CTG 12 | CCG 12 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 12
ATC 18 | ACC 18 | AAC 12 | AGC 12
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 18 | ACG 18 | AAG 0 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 12 | Gly G GGT 12
GTC 48 | GCC 12 | GAC 24 | GGC 6
GTA 12 | GCA 12 | Glu E GAA 24 | GGA 18
GTG 12 | GCG 18 | GAG 24 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16216 C:0.18919 A:0.23423 G:0.41441
position 2: T:0.33333 C:0.20721 A:0.22523 G:0.23423
position 3: T:0.18919 C:0.33333 A:0.17117 G:0.30631
Average T:0.22823 C:0.24324 A:0.21021 G:0.31832
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -444.514483 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 82.887290
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908251_1_1364_MLBR_RS06420: 0.000004, NC_002677_1_NP_301930_1_802_ML1296: 0.000004, NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910: 0.000004, NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905: 0.000004, NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040: 0.000004, NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 82.88729
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 225.1 107.9 82.8873 0.0000 0.0000 0.0 0.0
7..2 0.000 225.1 107.9 82.8873 0.0000 0.0000 0.0 0.0
7..3 0.000 225.1 107.9 82.8873 0.0000 0.0000 0.0 0.0
7..4 0.000 225.1 107.9 82.8873 0.0000 0.0000 0.0 0.0
7..5 0.000 225.1 107.9 82.8873 0.0000 0.0000 0.0 0.0
7..6 0.000 225.1 107.9 82.8873 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -444.514502 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428903 0.000010 0.649089
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908251_1_1364_MLBR_RS06420: 0.000004, NC_002677_1_NP_301930_1_802_ML1296: 0.000004, NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910: 0.000004, NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905: 0.000004, NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040: 0.000004, NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42890
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.64909 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 225.1 107.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 225.1 107.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 225.1 107.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 225.1 107.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 225.1 107.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 225.1 107.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -444.514485 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428906 0.790326 0.099908 0.000001 96.760196
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908251_1_1364_MLBR_RS06420: 0.000004, NC_002677_1_NP_301930_1_802_ML1296: 0.000004, NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910: 0.000004, NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905: 0.000004, NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040: 0.000004, NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42891
MLEs of dN/dS (w) for site classes (K=3)
p: 0.79033 0.09991 0.10977
w: 0.00000 1.00000 96.76020
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 225.1 107.9 10.7209 0.0000 0.0000 0.0 0.0
7..2 0.000 225.1 107.9 10.7209 0.0000 0.0000 0.0 0.0
7..3 0.000 225.1 107.9 10.7209 0.0000 0.0000 0.0 0.0
7..4 0.000 225.1 107.9 10.7209 0.0000 0.0000 0.0 0.0
7..5 0.000 225.1 107.9 10.7209 0.0000 0.0000 0.0 0.0
7..6 0.000 225.1 107.9 10.7209 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908251_1_1364_MLBR_RS06420)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908251_1_1364_MLBR_RS06420)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -444.514516 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.431997 28.157857 47.126265
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908251_1_1364_MLBR_RS06420: 0.000004, NC_002677_1_NP_301930_1_802_ML1296: 0.000004, NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910: 0.000004, NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905: 0.000004, NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040: 0.000004, NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43200
Parameters in M7 (beta):
p = 28.15786 q = 47.12626
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.28477 0.31637 0.33576 0.35153 0.36589 0.37994 0.39460 0.41107 0.43186 0.46710
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 225.1 107.9 0.3739 0.0000 0.0000 0.0 0.0
7..2 0.000 225.1 107.9 0.3739 0.0000 0.0000 0.0 0.0
7..3 0.000 225.1 107.9 0.3739 0.0000 0.0000 0.0 0.0
7..4 0.000 225.1 107.9 0.3739 0.0000 0.0000 0.0 0.0
7..5 0.000 225.1 107.9 0.3739 0.0000 0.0000 0.0 0.0
7..6 0.000 225.1 107.9 0.3739 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -444.514483 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.431940 0.000010 0.005000 0.005000 82.907327
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908251_1_1364_MLBR_RS06420: 0.000004, NC_002677_1_NP_301930_1_802_ML1296: 0.000004, NZ_LVXE01000068_1_WP_010908251_1_2485_A3216_RS12910: 0.000004, NZ_LYPH01000072_1_WP_010908251_1_2479_A8144_RS11905: 0.000004, NZ_CP029543_1_WP_010908251_1_1385_DIJ64_RS07040: 0.000004, NZ_AP014567_1_WP_010908251_1_1417_JK2ML_RS07200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43194
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.00500
(p1 = 0.99999) w = 82.90733
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 82.90733
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 225.1 107.9 82.9065 0.0000 0.0000 0.0 0.0
7..2 0.000 225.1 107.9 82.9065 0.0000 0.0000 0.0 0.0
7..3 0.000 225.1 107.9 82.9065 0.0000 0.0000 0.0 0.0
7..4 0.000 225.1 107.9 82.9065 0.0000 0.0000 0.0 0.0
7..5 0.000 225.1 107.9 82.9065 0.0000 0.0000 0.0 0.0
7..6 0.000 225.1 107.9 82.9065 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908251_1_1364_MLBR_RS06420)
Pr(w>1) post mean +- SE for w
1 M 1.000** 82.907
2 Y 1.000** 82.907
3 R 1.000** 82.907
4 F 1.000** 82.907
5 G 1.000** 82.907
6 M 1.000** 82.907
7 R 1.000** 82.907
8 Y 1.000** 82.907
9 L 1.000** 82.907
10 D 1.000** 82.907
11 S 1.000** 82.907
12 M 1.000** 82.907
13 T 1.000** 82.907
14 V 1.000** 82.907
15 T 1.000** 82.907
16 V 1.000** 82.907
17 D 1.000** 82.907
18 R 1.000** 82.907
19 H 1.000** 82.907
20 V 1.000** 82.907
21 A 1.000** 82.907
22 G 1.000** 82.907
23 N 1.000** 82.907
24 E 1.000** 82.907
25 F 1.000** 82.907
26 T 1.000** 82.907
27 V 1.000** 82.907
28 E 1.000** 82.907
29 E 1.000** 82.907
30 I 1.000** 82.907
31 S 1.000** 82.907
32 T 1.000** 82.907
33 G 1.000** 82.907
34 I 1.000** 82.907
35 F 1.000** 82.907
36 A 1.000** 82.907
37 S 1.000** 82.907
38 G 1.000** 82.907
39 Y 1.000** 82.907
40 G 1.000** 82.907
41 Q 1.000** 82.907
42 V 1.000** 82.907
43 G 1.000** 82.907
44 D 1.000** 82.907
45 G 1.000** 82.907
46 R 1.000** 82.907
47 S 1.000** 82.907
48 F 1.000** 82.907
49 S 1.000** 82.907
50 F 1.000** 82.907
51 H 1.000** 82.907
52 I 1.000** 82.907
53 E 1.000** 82.907
54 H 1.000** 82.907
55 W 1.000** 82.907
56 S 1.000** 82.907
57 L 1.000** 82.907
58 V 1.000** 82.907
59 V 1.000** 82.907
60 E 1.000** 82.907
61 I 1.000** 82.907
62 Y 1.000** 82.907
63 R 1.000** 82.907
64 T 1.000** 82.907
65 R 1.000** 82.907
66 L 1.000** 82.907
67 A 1.000** 82.907
68 G 1.000** 82.907
69 L 1.000** 82.907
70 V 1.000** 82.907
71 P 1.000** 82.907
72 Q 1.000** 82.907
73 T 1.000** 82.907
74 E 1.000** 82.907
75 E 1.000** 82.907
76 V 1.000** 82.907
77 V 1.000** 82.907
78 P 1.000** 82.907
79 R 1.000** 82.907
80 A 1.000** 82.907
81 I 1.000** 82.907
82 R 1.000** 82.907
83 G 1.000** 82.907
84 L 1.000** 82.907
85 V 1.000** 82.907
86 N 1.000** 82.907
87 I 1.000** 82.907
88 D 1.000** 82.907
89 L 1.000** 82.907
90 T 1.000** 82.907
91 D 1.000** 82.907
92 E 1.000** 82.907
93 R 1.000** 82.907
94 S 1.000** 82.907
95 L 1.000** 82.907
96 A 1.000** 82.907
97 A 1.000** 82.907
98 A 1.000** 82.907
99 V 1.000** 82.907
100 R 1.000** 82.907
101 D 1.000** 82.907
102 L 1.000** 82.907
103 V 1.000** 82.907
104 A 1.000** 82.907
105 R 1.000** 82.907
106 T 1.000** 82.907
107 L 1.000** 82.907
108 T 1.000** 82.907
109 V 1.000** 82.907
110 S 1.000** 82.907
111 G 1.000** 82.907
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908251_1_1364_MLBR_RS06420)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -444.514502 Model 2: PositiveSelection -444.514485 Model 0: one-ratio -444.514483 Model 7: beta -444.514516 Model 8: beta&w>1 -444.514483 Model 0 vs 1 3.800000001774606E-5 Model 2 vs 1 3.400000002784509E-5 Model 8 vs 7 6.60000000607397E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
