--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:44:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplS/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -477.04 -480.91
2 -477.13 -480.98
--------------------------------------
TOTAL -477.09 -480.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871304 0.085820 0.362002 1.454417 0.841820 1407.65 1441.25 1.000
r(A<->C){all} 0.137856 0.017652 0.000065 0.409276 0.093309 205.53 232.48 1.004
r(A<->G){all} 0.164309 0.019097 0.000084 0.448855 0.128100 234.01 281.06 1.004
r(A<->T){all} 0.167065 0.018997 0.000103 0.438343 0.133236 160.32 203.45 1.006
r(C<->G){all} 0.122833 0.014300 0.000037 0.369512 0.086355 167.61 188.67 1.008
r(C<->T){all} 0.230397 0.026036 0.000154 0.537451 0.201197 220.13 229.44 1.002
r(G<->T){all} 0.177540 0.023435 0.000085 0.485744 0.135659 223.76 264.73 1.004
pi(A){all} 0.223115 0.000514 0.179320 0.266484 0.222802 1262.12 1321.49 1.000
pi(C){all} 0.261679 0.000544 0.216506 0.306771 0.260700 1262.04 1312.84 1.000
pi(G){all} 0.318106 0.000588 0.270558 0.365462 0.317565 1044.05 1234.18 1.001
pi(T){all} 0.197100 0.000440 0.158302 0.238644 0.196765 1071.20 1229.66 1.002
alpha{1,2} 0.290074 0.096220 0.000362 0.881767 0.196103 1189.97 1219.67 1.000
alpha{3} 0.391940 0.200927 0.000109 1.310498 0.232198 1209.55 1279.87 1.000
pinvar{all} 0.989214 0.000080 0.971985 0.999591 0.991539 1028.33 1264.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -437.116316
Model 2: PositiveSelection -436.470951
Model 0: one-ratio -436.821441
Model 7: beta -437.116316
Model 8: beta&w>1 -436.470951
Model 0 vs 1 0.5897499999999809
Model 2 vs 1 1.2907299999999395
Model 8 vs 7 1.2907299999999395
>C1
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C2
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C3
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C4
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C5
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C6
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
C1 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C2 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C3 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C4 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C5 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C6 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
**************************************************
C1 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C2 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C3 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C4 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C5 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C6 GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
*********************** **************************
C1 ELRGKKAKIKEKR
C2 ELRGKKAKIKEKR
C3 ELRGKKAKIKEKR
C4 ELRGKKAKIKEKR
C5 ELRGKKAKIKEKR
C6 ELRGKKAKIKEKR
*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3390]--->[3390]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.640 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C2 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C3 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C4 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C5 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C6 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
**************************************************
C1 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C2 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C3 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C4 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C5 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C6 GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
*********************** **************************
C1 ELRGKKAKIKEKR
C2 ELRGKKAKIKEKR
C3 ELRGKKAKIKEKR
C4 ELRGKKAKIKEKR
C5 ELRGKKAKIKEKR
C6 ELRGKKAKIKEKR
*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.12 C1 C6 99.12
TOP 5 0 99.12 C6 C1 99.12
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.12 C2 C6 99.12
TOP 5 1 99.12 C6 C2 99.12
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.12 C3 C6 99.12
TOP 5 2 99.12 C6 C3 99.12
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.12 C4 C6 99.12
TOP 5 3 99.12 C6 C4 99.12
BOT 4 5 99.12 C5 C6 99.12
TOP 5 4 99.12 C6 C5 99.12
AVG 0 C1 * 99.82
AVG 1 C2 * 99.82
AVG 2 C3 * 99.82
AVG 3 C4 * 99.82
AVG 4 C5 * 99.82
AVG 5 C6 * 99.12
TOT TOT * 99.71
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C2 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C3 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C4 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C5 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C6 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
**************************************************
C1 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C2 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C3 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C4 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C5 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C6 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
**************************************************
C1 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C2 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C3 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C4 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C5 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C6 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
**************************************************
C1 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C2 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C3 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C4 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C5 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C6 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
**************************************************
C1 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C2 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C3 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C4 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C5 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C6 TGGCGTCGAACGGACCTTTCTGGTACACTCGCCGAACATCGATCACATCG
******************** *****************************
C1 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C2 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C3 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C4 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C5 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C6 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
**************************************************
C1 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C2 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C3 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C4 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C5 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C6 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
***************************************
>C1
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C2
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C3
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C4
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C5
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C6
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCTGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C1
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C2
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C3
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C4
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C5
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C6
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 339 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790608
Setting output file names to "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1527838211
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0337908893
Seed = 436224347
Swapseed = 1579790608
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -762.101114 -- -24.965149
Chain 2 -- -762.101070 -- -24.965149
Chain 3 -- -762.101070 -- -24.965149
Chain 4 -- -762.100932 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -762.101114 -- -24.965149
Chain 2 -- -762.100932 -- -24.965149
Chain 3 -- -762.101114 -- -24.965149
Chain 4 -- -762.101070 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-762.101] (-762.101) (-762.101) (-762.101) * [-762.101] (-762.101) (-762.101) (-762.101)
500 -- (-486.682) (-485.383) [-483.372] (-484.445) * (-484.761) (-486.078) (-481.214) [-480.550] -- 0:00:00
1000 -- (-489.958) (-482.490) [-480.960] (-486.753) * (-480.301) (-478.659) [-477.471] (-482.469) -- 0:00:00
1500 -- (-478.796) (-483.502) [-484.562] (-483.384) * (-479.888) (-482.051) [-483.482] (-482.732) -- 0:00:00
2000 -- [-482.598] (-485.645) (-481.126) (-479.329) * (-484.717) (-482.707) (-484.848) [-476.669] -- 0:00:00
2500 -- (-484.042) [-480.507] (-491.492) (-491.847) * (-481.313) (-486.347) (-488.786) [-482.459] -- 0:00:00
3000 -- (-489.367) [-480.655] (-490.742) (-485.974) * (-484.492) [-480.674] (-484.271) (-493.527) -- 0:00:00
3500 -- (-489.608) [-489.109] (-484.440) (-480.677) * [-479.449] (-482.609) (-484.771) (-489.071) -- 0:00:00
4000 -- [-477.953] (-481.385) (-482.021) (-490.060) * [-482.915] (-479.469) (-483.207) (-493.580) -- 0:00:00
4500 -- (-483.260) (-481.878) (-479.496) [-486.887] * (-484.194) [-481.723] (-487.044) (-484.210) -- 0:00:00
5000 -- [-480.657] (-482.400) (-485.057) (-481.353) * (-489.916) (-483.698) (-480.124) [-483.110] -- 0:00:00
Average standard deviation of split frequencies: 0.107137
5500 -- [-485.502] (-484.844) (-485.099) (-481.593) * (-490.209) (-483.777) [-477.880] (-485.291) -- 0:00:00
6000 -- [-480.817] (-478.588) (-477.624) (-488.249) * (-487.273) (-482.456) [-484.656] (-485.356) -- 0:00:00
6500 -- (-488.071) (-478.270) [-482.448] (-484.619) * (-482.921) [-480.726] (-489.454) (-481.773) -- 0:00:00
7000 -- (-486.396) (-478.724) (-485.317) [-480.514] * (-479.697) (-486.300) (-484.527) [-483.329] -- 0:00:00
7500 -- (-481.057) (-479.402) [-481.784] (-484.442) * [-478.959] (-482.888) (-481.683) (-479.908) -- 0:00:00
8000 -- (-487.306) (-479.917) (-493.131) [-486.686] * (-481.010) (-487.521) [-484.759] (-486.880) -- 0:00:00
8500 -- (-480.662) [-480.581] (-483.911) (-481.170) * (-480.905) [-485.074] (-487.332) (-487.664) -- 0:00:00
9000 -- [-483.764] (-478.359) (-486.902) (-487.363) * (-481.806) (-481.206) [-479.206] (-484.839) -- 0:00:00
9500 -- [-481.296] (-479.733) (-486.281) (-487.417) * (-481.466) [-480.969] (-481.906) (-479.779) -- 0:00:00
10000 -- (-490.174) (-479.754) [-480.199] (-485.535) * [-487.325] (-485.424) (-490.737) (-487.404) -- 0:01:39
Average standard deviation of split frequencies: 0.062392
10500 -- [-482.885] (-477.617) (-486.115) (-491.298) * [-488.337] (-482.235) (-483.305) (-484.024) -- 0:01:34
11000 -- (-484.687) (-481.679) [-483.455] (-482.368) * (-481.150) (-480.018) [-485.639] (-486.865) -- 0:01:29
11500 -- (-489.690) (-481.029) (-482.813) [-481.945] * [-481.230] (-480.203) (-486.453) (-481.068) -- 0:01:25
12000 -- (-483.698) (-482.174) (-478.252) [-481.732] * [-485.621] (-487.730) (-483.527) (-492.363) -- 0:01:22
12500 -- (-479.504) (-488.769) (-480.643) [-483.798] * [-484.718] (-484.371) (-485.237) (-478.557) -- 0:01:19
13000 -- (-479.579) (-479.767) (-475.694) [-479.377] * (-483.932) [-481.170] (-481.835) (-478.273) -- 0:01:15
13500 -- [-482.365] (-479.592) (-479.260) (-482.146) * (-481.526) (-478.122) (-480.750) [-481.559] -- 0:01:13
14000 -- (-483.972) (-479.082) [-476.801] (-496.475) * [-478.239] (-479.082) (-478.789) (-479.459) -- 0:01:10
14500 -- (-481.825) (-479.167) (-476.699) [-478.957] * (-486.845) (-480.992) [-480.173] (-476.095) -- 0:01:07
15000 -- (-481.901) (-477.609) [-478.882] (-481.248) * (-482.248) (-477.456) [-486.393] (-479.089) -- 0:01:05
Average standard deviation of split frequencies: 0.046299
15500 -- (-488.493) [-476.712] (-478.179) (-480.330) * (-482.822) (-476.582) [-480.253] (-477.926) -- 0:01:03
16000 -- (-491.614) [-478.543] (-475.363) (-478.019) * (-483.245) (-478.087) (-481.687) [-476.040] -- 0:01:01
16500 -- (-481.023) (-481.420) [-478.477] (-480.604) * [-481.711] (-477.361) (-481.763) (-479.249) -- 0:00:59
17000 -- [-486.831] (-479.111) (-478.777) (-479.443) * [-479.723] (-477.295) (-477.705) (-478.097) -- 0:00:57
17500 -- [-479.391] (-476.981) (-481.961) (-484.956) * [-483.528] (-479.373) (-483.886) (-476.552) -- 0:00:56
18000 -- [-482.400] (-476.811) (-483.059) (-477.412) * (-482.615) (-475.333) [-484.246] (-476.761) -- 0:00:54
18500 -- (-484.698) (-477.101) (-483.334) [-480.284] * [-479.268] (-476.788) (-484.747) (-477.668) -- 0:00:53
19000 -- (-488.296) (-479.862) (-479.751) [-478.228] * [-481.063] (-477.910) (-480.877) (-478.783) -- 0:00:51
19500 -- (-481.690) [-476.851] (-480.327) (-481.782) * [-480.233] (-476.281) (-483.543) (-477.388) -- 0:00:50
20000 -- (-483.586) (-479.972) (-480.449) [-478.866] * (-483.836) [-477.035] (-486.380) (-478.102) -- 0:00:49
Average standard deviation of split frequencies: 0.044353
20500 -- [-482.868] (-477.084) (-481.540) (-477.885) * [-483.135] (-476.811) (-480.458) (-480.483) -- 0:00:47
21000 -- [-477.418] (-478.122) (-481.840) (-479.534) * (-482.137) (-479.964) [-477.356] (-480.174) -- 0:00:46
21500 -- [-482.864] (-474.286) (-481.578) (-479.130) * (-477.357) [-476.169] (-481.569) (-481.756) -- 0:00:45
22000 -- (-485.971) [-475.754] (-477.916) (-477.998) * (-484.014) (-478.115) [-485.069] (-477.913) -- 0:00:44
22500 -- (-479.275) [-477.341] (-478.002) (-482.368) * (-477.353) (-475.580) (-487.941) [-479.576] -- 0:00:43
23000 -- (-485.314) [-476.613] (-479.990) (-483.524) * (-481.094) (-477.401) [-488.074] (-479.056) -- 0:00:42
23500 -- (-479.993) [-476.442] (-482.127) (-477.710) * (-490.818) [-480.255] (-484.031) (-476.619) -- 0:00:41
24000 -- (-484.280) (-476.931) [-477.671] (-478.535) * (-486.514) [-481.826] (-482.014) (-479.317) -- 0:00:40
24500 -- (-485.309) (-476.771) (-476.173) [-482.139] * [-484.008] (-477.740) (-481.142) (-482.734) -- 0:00:39
25000 -- [-484.568] (-478.118) (-477.885) (-482.325) * [-482.626] (-476.076) (-480.679) (-479.205) -- 0:00:39
Average standard deviation of split frequencies: 0.028491
25500 -- [-479.730] (-476.897) (-476.680) (-479.981) * (-481.957) (-479.499) [-478.868] (-478.477) -- 0:01:16
26000 -- (-484.337) [-477.565] (-481.028) (-480.653) * (-487.224) [-475.851] (-483.807) (-480.803) -- 0:01:14
26500 -- [-477.131] (-476.062) (-479.584) (-479.695) * (-482.900) (-477.612) (-486.716) [-478.417] -- 0:01:13
27000 -- (-486.836) (-477.087) (-481.013) [-479.533] * [-487.729] (-481.489) (-490.400) (-482.121) -- 0:01:12
27500 -- (-492.007) (-477.586) (-479.219) [-478.114] * [-481.687] (-479.641) (-484.753) (-478.632) -- 0:01:10
28000 -- (-487.567) (-479.713) (-481.106) [-479.807] * [-477.576] (-477.366) (-485.940) (-480.232) -- 0:01:09
28500 -- (-479.303) (-479.081) (-478.814) [-476.343] * (-485.947) (-476.944) [-482.717] (-479.241) -- 0:01:08
29000 -- [-478.561] (-477.831) (-477.029) (-480.272) * [-483.628] (-475.543) (-488.455) (-477.835) -- 0:01:06
29500 -- [-484.966] (-482.181) (-478.125) (-478.038) * [-479.317] (-478.240) (-492.137) (-478.353) -- 0:01:05
30000 -- (-482.216) (-477.630) [-479.220] (-479.274) * (-476.468) (-479.671) (-489.325) [-481.986] -- 0:01:04
Average standard deviation of split frequencies: 0.029207
30500 -- [-483.328] (-476.255) (-479.449) (-480.471) * [-476.975] (-480.385) (-483.922) (-479.744) -- 0:01:03
31000 -- (-487.344) [-479.357] (-478.728) (-478.017) * (-481.255) [-478.502] (-482.837) (-478.817) -- 0:01:02
31500 -- (-483.963) [-476.819] (-478.815) (-479.492) * (-478.121) (-475.449) (-477.787) [-479.465] -- 0:01:01
32000 -- (-495.371) (-478.976) [-478.134] (-479.306) * [-482.621] (-476.104) (-478.821) (-476.777) -- 0:01:00
32500 -- (-480.998) [-476.831] (-478.598) (-479.113) * (-480.267) (-477.834) [-476.553] (-479.094) -- 0:00:59
33000 -- (-476.464) (-482.856) [-477.682] (-480.376) * [-480.578] (-482.510) (-479.861) (-477.301) -- 0:00:58
33500 -- [-486.095] (-479.506) (-477.766) (-480.814) * [-480.967] (-483.314) (-478.345) (-478.390) -- 0:00:57
34000 -- (-479.769) (-482.121) [-477.843] (-477.190) * [-483.225] (-484.587) (-478.089) (-477.719) -- 0:00:56
34500 -- (-479.002) (-478.559) [-476.722] (-477.045) * (-479.483) [-480.193] (-477.613) (-476.693) -- 0:00:55
35000 -- [-482.022] (-479.210) (-477.648) (-475.805) * (-492.615) [-476.106] (-479.930) (-483.742) -- 0:00:55
Average standard deviation of split frequencies: 0.033391
35500 -- [-484.166] (-484.569) (-478.586) (-477.700) * (-476.199) [-478.410] (-483.957) (-477.933) -- 0:00:54
36000 -- [-483.075] (-479.295) (-480.599) (-478.695) * [-479.652] (-476.548) (-478.763) (-475.778) -- 0:00:53
36500 -- (-478.420) (-478.872) (-480.353) [-480.670] * [-483.354] (-477.608) (-479.759) (-476.310) -- 0:00:52
37000 -- (-477.945) [-479.113] (-477.058) (-480.184) * [-481.207] (-478.605) (-478.011) (-479.442) -- 0:00:52
37500 -- (-478.070) [-480.084] (-477.276) (-480.195) * (-484.177) (-476.756) (-479.180) [-479.009] -- 0:00:51
38000 -- (-479.992) (-477.273) [-477.543] (-479.587) * [-483.884] (-482.330) (-478.394) (-479.261) -- 0:00:50
38500 -- (-479.572) (-480.754) (-479.247) [-478.806] * [-480.625] (-478.394) (-479.984) (-480.741) -- 0:00:49
39000 -- (-477.129) (-477.571) (-481.727) [-477.645] * (-487.401) (-483.526) [-478.787] (-478.470) -- 0:00:49
39500 -- (-480.584) (-479.598) [-482.298] (-486.877) * (-480.189) (-476.347) [-482.923] (-479.082) -- 0:00:48
40000 -- [-477.205] (-478.176) (-477.818) (-478.245) * [-476.384] (-477.836) (-485.339) (-479.983) -- 0:00:48
Average standard deviation of split frequencies: 0.032200
40500 -- [-477.874] (-476.643) (-481.803) (-478.482) * (-495.830) [-477.120] (-477.961) (-481.117) -- 0:01:11
41000 -- (-476.330) [-477.396] (-479.692) (-480.306) * [-480.554] (-479.582) (-480.720) (-480.602) -- 0:01:10
41500 -- [-477.353] (-480.867) (-476.705) (-477.111) * (-496.033) (-478.258) [-480.128] (-478.321) -- 0:01:09
42000 -- (-476.322) (-478.178) [-480.097] (-478.740) * (-480.524) (-479.130) (-478.800) [-477.769] -- 0:01:08
42500 -- (-478.220) [-478.983] (-476.021) (-481.714) * (-481.746) [-476.669] (-477.232) (-477.703) -- 0:01:07
43000 -- (-475.750) [-478.002] (-478.624) (-480.215) * (-476.221) (-477.050) (-477.140) [-477.802] -- 0:01:06
43500 -- (-474.920) (-480.879) [-478.337] (-480.223) * (-477.238) (-485.299) (-475.861) [-477.765] -- 0:01:05
44000 -- (-476.796) (-479.283) (-482.220) [-478.824] * (-476.110) [-476.309] (-476.594) (-482.992) -- 0:01:05
44500 -- (-477.259) (-478.105) [-477.660] (-482.827) * (-478.178) (-477.381) [-474.985] (-481.255) -- 0:01:04
45000 -- (-477.091) (-478.212) (-476.195) [-478.249] * [-478.380] (-479.311) (-478.318) (-480.231) -- 0:01:03
Average standard deviation of split frequencies: 0.030744
45500 -- (-480.067) (-478.637) (-483.987) [-476.895] * (-478.907) [-477.103] (-478.111) (-480.616) -- 0:01:02
46000 -- (-476.584) (-478.160) [-477.209] (-479.544) * (-478.090) [-474.327] (-478.757) (-478.210) -- 0:01:02
46500 -- [-476.876] (-480.197) (-478.678) (-481.532) * (-476.186) [-480.509] (-476.220) (-481.368) -- 0:01:01
47000 -- (-476.293) (-478.408) [-476.132] (-479.512) * (-480.261) [-480.076] (-478.360) (-478.982) -- 0:01:00
47500 -- [-476.463] (-476.794) (-476.600) (-479.474) * (-477.546) [-479.836] (-480.403) (-477.954) -- 0:01:00
48000 -- (-475.110) (-476.756) [-477.776] (-479.391) * (-477.965) (-478.350) (-475.812) [-478.338] -- 0:00:59
48500 -- (-475.582) (-477.265) [-476.598] (-480.218) * (-478.035) (-480.081) [-477.955] (-479.060) -- 0:00:58
49000 -- [-478.427] (-476.378) (-477.187) (-477.507) * (-478.197) (-476.622) (-476.777) [-478.811] -- 0:00:58
49500 -- (-475.410) (-476.849) [-477.653] (-478.139) * (-478.593) (-475.561) [-475.591] (-479.947) -- 0:00:57
50000 -- [-476.490] (-476.830) (-477.991) (-477.835) * (-476.979) (-477.479) (-477.236) [-482.342] -- 0:00:57
Average standard deviation of split frequencies: 0.033081
50500 -- (-476.781) [-475.990] (-476.834) (-477.559) * (-477.294) [-479.010] (-479.652) (-478.079) -- 0:00:56
51000 -- (-478.761) [-479.522] (-487.642) (-478.779) * [-476.505] (-477.410) (-477.441) (-480.393) -- 0:00:55
51500 -- [-474.860] (-480.025) (-478.242) (-483.267) * (-477.729) [-477.479] (-479.823) (-478.092) -- 0:00:55
52000 -- (-477.101) (-478.124) [-475.999] (-478.464) * (-481.887) (-478.772) [-479.584] (-478.145) -- 0:00:54
52500 -- (-479.401) (-476.125) (-477.969) [-480.598] * (-476.527) [-478.531] (-478.508) (-477.438) -- 0:00:54
53000 -- (-479.269) [-479.528] (-479.477) (-481.135) * (-478.164) [-476.423] (-480.617) (-477.701) -- 0:00:53
53500 -- (-476.460) (-477.400) (-477.902) [-479.046] * (-478.885) (-478.350) (-480.087) [-477.765] -- 0:00:53
54000 -- [-477.572] (-481.135) (-478.793) (-478.863) * (-478.567) (-479.514) [-477.790] (-475.840) -- 0:00:52
54500 -- [-476.913] (-478.167) (-479.884) (-478.873) * (-476.305) [-479.579] (-477.034) (-481.075) -- 0:00:52
55000 -- [-481.198] (-478.938) (-477.766) (-480.195) * [-477.487] (-475.696) (-479.047) (-476.789) -- 0:01:08
Average standard deviation of split frequencies: 0.034607
55500 -- (-477.981) [-476.503] (-478.634) (-478.804) * (-476.056) [-476.421] (-478.902) (-479.163) -- 0:01:08
56000 -- (-477.058) (-480.998) [-478.557] (-479.019) * (-476.373) (-480.898) (-479.612) [-475.976] -- 0:01:07
56500 -- [-476.410] (-476.632) (-477.117) (-478.430) * [-477.964] (-478.265) (-480.041) (-477.966) -- 0:01:06
57000 -- (-479.533) [-476.566] (-480.659) (-480.786) * [-478.600] (-475.605) (-483.338) (-478.707) -- 0:01:06
57500 -- (-476.793) [-478.374] (-478.478) (-480.393) * (-485.179) (-477.266) [-482.193] (-480.645) -- 0:01:05
58000 -- (-479.127) (-475.757) (-479.538) [-479.246] * (-479.023) [-479.171] (-482.403) (-479.749) -- 0:01:04
58500 -- (-474.840) (-476.826) (-479.966) [-477.132] * [-479.828] (-478.382) (-480.459) (-477.100) -- 0:01:04
59000 -- (-476.932) [-477.751] (-481.827) (-481.121) * (-483.760) (-479.435) [-479.213] (-480.068) -- 0:01:03
59500 -- [-476.046] (-482.286) (-487.251) (-479.755) * (-484.073) (-477.575) (-477.903) [-476.739] -- 0:01:03
60000 -- (-476.154) (-477.428) (-480.198) [-478.946] * (-481.260) (-476.660) [-476.016] (-478.816) -- 0:01:02
Average standard deviation of split frequencies: 0.028923
60500 -- (-477.093) [-478.515] (-478.898) (-485.589) * (-483.609) [-476.909] (-476.338) (-476.073) -- 0:01:02
61000 -- (-475.786) (-479.541) [-479.381] (-482.522) * (-478.005) (-477.720) [-477.463] (-479.915) -- 0:01:01
61500 -- (-477.882) (-478.615) [-478.322] (-480.447) * (-478.133) (-477.281) (-477.656) [-476.796] -- 0:01:01
62000 -- [-480.368] (-476.672) (-478.765) (-481.055) * [-478.241] (-476.649) (-482.592) (-477.406) -- 0:01:00
62500 -- [-475.807] (-476.310) (-479.431) (-481.133) * (-478.490) [-479.423] (-482.993) (-477.424) -- 0:01:00
63000 -- (-479.587) (-476.561) (-478.437) [-480.327] * (-478.714) (-478.688) (-485.269) [-478.243] -- 0:00:59
63500 -- (-477.313) (-479.970) (-478.589) [-481.631] * [-476.166] (-476.450) (-477.269) (-481.093) -- 0:00:58
64000 -- (-476.723) [-478.163] (-479.623) (-479.357) * [-480.401] (-479.469) (-477.600) (-478.185) -- 0:00:58
64500 -- (-477.998) (-477.588) [-479.089] (-480.015) * [-478.665] (-480.536) (-479.011) (-481.540) -- 0:00:58
65000 -- (-478.996) [-477.561] (-479.597) (-478.728) * (-482.205) [-477.817] (-478.238) (-474.893) -- 0:00:57
Average standard deviation of split frequencies: 0.030450
65500 -- [-477.800] (-476.386) (-477.739) (-478.645) * [-478.775] (-477.655) (-482.554) (-475.470) -- 0:00:57
66000 -- (-480.600) [-481.368] (-479.344) (-480.228) * (-478.799) (-478.348) (-481.014) [-476.404] -- 0:00:56
66500 -- (-480.158) (-482.164) (-480.775) [-476.929] * (-480.838) [-478.626] (-480.517) (-478.325) -- 0:00:56
67000 -- (-478.491) (-479.277) [-476.702] (-478.786) * [-476.944] (-480.339) (-485.925) (-478.762) -- 0:00:55
67500 -- [-476.088] (-476.532) (-478.745) (-478.910) * (-480.364) (-481.547) (-477.323) [-476.735] -- 0:00:55
68000 -- [-481.389] (-479.702) (-480.011) (-478.130) * [-478.018] (-480.678) (-476.899) (-478.880) -- 0:00:54
68500 -- (-483.639) [-477.712] (-475.841) (-478.477) * [-479.304] (-478.877) (-478.594) (-480.376) -- 0:00:54
69000 -- (-477.743) [-476.326] (-476.653) (-478.499) * (-477.244) (-478.034) [-476.742] (-480.880) -- 0:00:53
69500 -- (-477.926) (-476.747) (-476.190) [-478.072] * (-478.919) (-481.234) [-477.598] (-477.341) -- 0:00:53
70000 -- (-477.150) (-477.963) (-477.868) [-476.409] * [-478.582] (-479.740) (-477.228) (-479.993) -- 0:00:53
Average standard deviation of split frequencies: 0.032301
70500 -- [-477.367] (-476.762) (-481.902) (-477.283) * [-479.369] (-482.222) (-477.916) (-479.531) -- 0:01:05
71000 -- [-478.712] (-478.051) (-478.010) (-476.905) * [-480.493] (-480.820) (-476.684) (-479.213) -- 0:01:05
71500 -- (-478.456) (-478.484) [-479.196] (-478.464) * [-476.543] (-481.004) (-479.333) (-476.569) -- 0:01:04
72000 -- (-476.159) (-477.777) (-478.574) [-478.759] * (-483.193) (-477.176) [-478.165] (-479.602) -- 0:01:04
72500 -- (-476.198) (-479.445) [-479.420] (-477.613) * (-477.953) (-477.584) (-479.572) [-478.395] -- 0:01:03
73000 -- [-479.722] (-477.139) (-479.487) (-479.644) * (-477.601) [-477.777] (-481.891) (-478.503) -- 0:01:03
73500 -- (-477.766) (-478.240) (-479.409) [-475.464] * [-476.946] (-479.794) (-477.911) (-477.008) -- 0:01:03
74000 -- (-478.434) (-483.769) (-481.369) [-475.818] * (-477.478) (-479.784) (-478.951) [-475.879] -- 0:01:02
74500 -- [-477.507] (-476.956) (-476.676) (-476.647) * (-478.570) (-480.600) (-477.047) [-476.951] -- 0:01:02
75000 -- (-475.427) (-476.080) (-480.453) [-480.237] * (-478.654) (-479.791) [-478.382] (-479.757) -- 0:01:01
Average standard deviation of split frequencies: 0.035045
75500 -- (-477.962) (-482.816) [-477.958] (-478.682) * (-478.795) (-481.963) (-477.683) [-477.748] -- 0:01:01
76000 -- (-475.883) (-479.773) (-478.686) [-482.159] * (-477.343) (-479.844) (-479.600) [-476.851] -- 0:01:00
76500 -- [-476.946] (-475.764) (-477.939) (-484.009) * (-475.827) (-480.122) [-480.724] (-476.414) -- 0:01:00
77000 -- (-478.157) (-476.876) [-476.459] (-480.587) * (-478.578) (-480.510) [-478.550] (-476.470) -- 0:00:59
77500 -- (-478.996) (-478.466) [-476.259] (-481.064) * (-478.191) (-479.104) (-479.318) [-477.344] -- 0:00:59
78000 -- (-477.065) (-481.780) (-479.393) [-478.765] * (-476.968) (-480.796) [-479.566] (-484.155) -- 0:00:59
78500 -- (-480.328) (-481.951) (-479.805) [-476.952] * (-478.156) [-476.461] (-478.971) (-482.081) -- 0:00:58
79000 -- [-478.670] (-477.885) (-479.713) (-477.217) * (-480.865) (-482.628) (-478.654) [-481.576] -- 0:00:58
79500 -- [-478.024] (-478.033) (-476.361) (-476.433) * (-478.148) (-477.040) [-479.082] (-477.820) -- 0:00:57
80000 -- (-477.654) (-476.099) (-477.029) [-478.734] * (-477.064) [-478.497] (-477.112) (-479.187) -- 0:00:57
Average standard deviation of split frequencies: 0.037831
80500 -- (-479.323) [-481.162] (-480.315) (-478.442) * (-478.828) [-476.926] (-476.952) (-475.753) -- 0:00:57
81000 -- (-477.257) (-480.932) [-478.762] (-481.024) * (-480.105) (-478.391) (-478.767) [-477.063] -- 0:00:56
81500 -- [-478.246] (-480.683) (-477.868) (-481.771) * (-485.590) [-476.069] (-480.879) (-483.872) -- 0:00:56
82000 -- [-477.175] (-481.902) (-483.518) (-480.350) * (-481.463) [-477.872] (-477.512) (-483.586) -- 0:00:55
82500 -- (-475.534) (-479.985) (-476.441) [-478.285] * (-483.605) (-476.494) (-481.886) [-478.300] -- 0:00:55
83000 -- (-477.749) [-477.591] (-481.235) (-479.897) * (-478.732) [-477.657] (-479.568) (-478.266) -- 0:00:55
83500 -- (-476.927) (-477.712) [-477.939] (-478.806) * (-479.521) (-477.776) (-479.859) [-478.181] -- 0:00:54
84000 -- [-477.413] (-476.423) (-479.418) (-481.925) * (-481.160) [-477.432] (-482.701) (-476.149) -- 0:00:54
84500 -- [-476.968] (-477.924) (-485.343) (-480.517) * (-480.180) (-479.615) [-479.605] (-476.997) -- 0:00:54
85000 -- (-476.151) [-477.299] (-484.397) (-478.513) * (-483.539) (-479.659) [-485.254] (-477.640) -- 0:00:53
Average standard deviation of split frequencies: 0.033437
85500 -- [-475.050] (-477.154) (-476.985) (-479.653) * (-479.740) (-479.216) [-478.650] (-476.067) -- 0:00:53
86000 -- (-476.136) (-478.207) [-476.801] (-478.417) * [-481.148] (-477.067) (-480.149) (-480.623) -- 0:00:53
86500 -- (-475.944) [-478.221] (-481.961) (-480.591) * (-477.212) [-478.552] (-482.293) (-478.410) -- 0:01:03
87000 -- [-473.670] (-478.183) (-480.966) (-488.005) * (-477.305) (-479.140) (-479.639) [-479.186] -- 0:01:02
87500 -- [-476.985] (-475.934) (-476.303) (-478.852) * (-476.123) (-480.394) (-477.306) [-478.316] -- 0:01:02
88000 -- (-477.227) [-477.609] (-479.519) (-480.781) * [-478.687] (-479.220) (-477.501) (-479.117) -- 0:01:02
88500 -- [-476.762] (-479.635) (-480.627) (-481.581) * (-478.876) (-479.151) [-479.362] (-478.919) -- 0:01:01
89000 -- [-476.461] (-479.948) (-478.101) (-479.158) * (-476.445) [-477.628] (-477.501) (-482.063) -- 0:01:01
89500 -- [-477.235] (-479.117) (-478.090) (-479.348) * (-477.526) (-477.853) [-478.492] (-480.576) -- 0:01:01
90000 -- (-478.022) [-479.416] (-477.759) (-482.367) * (-478.159) [-476.615] (-477.749) (-480.289) -- 0:01:00
Average standard deviation of split frequencies: 0.031196
90500 -- (-480.046) (-477.234) (-476.923) [-484.092] * (-477.154) [-477.297] (-476.830) (-481.674) -- 0:01:00
91000 -- [-478.062] (-478.442) (-479.164) (-483.392) * (-479.837) [-477.988] (-477.795) (-481.775) -- 0:00:59
91500 -- [-478.722] (-476.691) (-481.784) (-478.561) * (-478.982) (-481.065) [-482.088] (-481.180) -- 0:00:59
92000 -- (-476.754) (-480.020) (-479.878) [-478.272] * [-476.335] (-478.388) (-478.321) (-477.552) -- 0:00:59
92500 -- (-477.211) (-486.912) (-477.603) [-479.962] * (-480.712) (-479.445) [-478.731] (-479.622) -- 0:00:58
93000 -- [-476.521] (-488.558) (-480.028) (-479.572) * (-475.388) (-477.920) (-479.008) [-480.894] -- 0:00:58
93500 -- (-476.559) (-480.604) (-478.384) [-478.515] * (-479.112) [-477.001] (-479.298) (-478.394) -- 0:00:58
94000 -- (-475.986) (-479.024) (-479.137) [-478.092] * [-477.035] (-481.989) (-483.679) (-477.863) -- 0:00:57
94500 -- (-475.937) [-476.880] (-479.844) (-478.494) * (-476.146) (-477.976) [-476.150] (-480.012) -- 0:00:57
95000 -- (-476.190) (-478.028) (-480.418) [-477.940] * (-479.544) (-478.128) (-479.201) [-476.683] -- 0:00:57
Average standard deviation of split frequencies: 0.031567
95500 -- [-475.801] (-477.598) (-478.407) (-479.318) * [-476.279] (-478.863) (-478.909) (-477.690) -- 0:00:56
96000 -- (-478.700) (-478.012) [-481.861] (-480.371) * (-478.980) (-479.093) [-476.192] (-478.914) -- 0:00:56
96500 -- (-480.038) (-476.281) [-481.874] (-479.842) * (-477.478) (-478.657) (-478.473) [-478.331] -- 0:00:56
97000 -- (-477.553) [-479.399] (-481.723) (-479.118) * (-477.093) (-478.057) [-478.201] (-476.148) -- 0:00:55
97500 -- (-483.666) (-476.319) (-479.560) [-478.770] * (-476.262) [-479.257] (-488.870) (-477.266) -- 0:00:55
98000 -- (-476.770) [-477.684] (-480.322) (-478.832) * (-480.686) [-475.614] (-484.424) (-480.879) -- 0:00:55
98500 -- (-479.173) [-478.508] (-479.847) (-480.436) * (-480.712) (-477.604) (-481.107) [-481.847] -- 0:00:54
99000 -- [-478.558] (-476.757) (-478.899) (-480.070) * (-478.881) (-475.739) [-479.289] (-476.165) -- 0:00:54
99500 -- (-479.312) (-478.844) [-478.197] (-477.131) * (-478.706) (-485.858) [-477.084] (-480.711) -- 0:00:54
100000 -- (-477.636) (-477.238) (-478.388) [-476.868] * (-478.438) [-482.747] (-477.586) (-479.671) -- 0:00:54
Average standard deviation of split frequencies: 0.028836
100500 -- [-478.183] (-476.135) (-477.721) (-478.463) * (-481.068) [-478.814] (-478.168) (-478.615) -- 0:00:53
101000 -- (-477.689) (-477.597) (-479.817) [-476.953] * [-479.674] (-484.222) (-479.115) (-479.909) -- 0:00:53
101500 -- [-478.146] (-480.706) (-479.773) (-477.976) * (-475.931) (-481.588) (-479.719) [-478.106] -- 0:00:53
102000 -- (-480.989) (-478.005) (-478.390) [-477.427] * (-475.928) (-482.333) [-479.090] (-478.390) -- 0:00:52
102500 -- [-476.552] (-475.478) (-479.040) (-479.161) * (-476.110) (-478.583) (-476.406) [-479.027] -- 0:01:01
103000 -- (-477.003) [-475.544] (-480.710) (-480.611) * (-478.061) (-478.687) [-476.418] (-476.973) -- 0:01:00
103500 -- [-478.216] (-477.020) (-476.755) (-477.294) * (-475.814) (-478.003) (-478.501) [-477.350] -- 0:01:00
104000 -- (-477.682) [-478.238] (-478.796) (-478.343) * (-479.555) (-480.455) [-480.734] (-479.386) -- 0:01:00
104500 -- (-477.239) [-477.356] (-478.721) (-477.557) * (-479.887) [-479.843] (-476.149) (-478.763) -- 0:00:59
105000 -- (-476.629) (-476.556) (-478.781) [-478.945] * (-477.587) (-476.255) [-476.350] (-478.863) -- 0:00:59
Average standard deviation of split frequencies: 0.026895
105500 -- (-478.559) [-477.739] (-479.077) (-478.448) * (-479.581) [-476.308] (-475.746) (-479.799) -- 0:00:59
106000 -- (-479.472) [-477.744] (-477.852) (-478.620) * (-477.305) [-476.003] (-477.464) (-476.805) -- 0:00:59
106500 -- (-476.222) [-475.512] (-479.831) (-476.884) * (-480.047) (-478.994) (-478.180) [-479.261] -- 0:00:58
107000 -- [-476.074] (-478.577) (-477.517) (-477.306) * (-477.026) (-482.044) [-478.510] (-479.711) -- 0:00:58
107500 -- (-484.031) (-477.741) [-479.018] (-476.089) * (-478.033) (-477.275) (-476.717) [-477.946] -- 0:00:58
108000 -- [-479.552] (-476.379) (-477.413) (-479.996) * (-476.802) [-478.984] (-478.482) (-478.510) -- 0:00:57
108500 -- (-481.119) (-476.686) (-483.743) [-477.247] * (-478.501) (-481.501) [-475.095] (-475.762) -- 0:00:57
109000 -- (-478.361) (-475.201) (-477.407) [-476.965] * (-479.596) (-479.167) [-477.034] (-477.215) -- 0:00:57
109500 -- (-481.062) [-478.651] (-481.253) (-476.662) * [-478.795] (-476.540) (-479.453) (-478.017) -- 0:00:56
110000 -- (-483.696) [-476.351] (-482.059) (-479.451) * (-480.137) (-477.918) (-478.192) [-477.754] -- 0:00:56
Average standard deviation of split frequencies: 0.027301
110500 -- [-479.120] (-476.207) (-480.602) (-476.326) * (-479.057) [-478.317] (-475.541) (-478.331) -- 0:00:56
111000 -- (-477.877) [-476.544] (-479.917) (-484.344) * [-477.790] (-479.036) (-483.133) (-477.681) -- 0:00:56
111500 -- [-478.422] (-479.434) (-479.303) (-481.088) * [-480.127] (-477.737) (-481.012) (-478.862) -- 0:00:55
112000 -- (-478.355) (-478.130) [-478.819] (-481.938) * (-477.955) (-478.921) (-481.694) [-476.991] -- 0:00:55
112500 -- (-478.376) (-480.213) [-478.397] (-476.163) * (-478.230) (-480.953) [-479.674] (-480.534) -- 0:00:55
113000 -- (-479.010) [-478.189] (-482.084) (-477.322) * (-479.780) (-479.018) (-476.159) [-476.227] -- 0:00:54
113500 -- (-477.170) (-481.474) [-477.344] (-480.060) * [-477.851] (-480.976) (-475.606) (-477.461) -- 0:00:54
114000 -- (-475.968) [-476.821] (-479.806) (-482.969) * (-479.101) (-480.044) [-475.699] (-480.031) -- 0:00:54
114500 -- (-479.188) [-478.231] (-478.016) (-481.316) * (-481.806) (-478.437) (-478.611) [-479.119] -- 0:00:54
115000 -- [-479.265] (-478.600) (-481.321) (-475.856) * [-478.785] (-478.041) (-479.620) (-477.271) -- 0:00:53
Average standard deviation of split frequencies: 0.026125
115500 -- (-478.980) [-478.817] (-478.976) (-478.538) * (-480.978) [-478.230] (-478.792) (-477.901) -- 0:00:53
116000 -- (-478.535) [-479.771] (-479.346) (-478.743) * (-477.275) (-476.657) [-477.751] (-477.538) -- 0:00:53
116500 -- (-479.290) (-477.780) (-476.342) [-478.662] * [-480.980] (-478.227) (-477.773) (-477.991) -- 0:00:53
117000 -- (-477.973) (-477.957) [-476.086] (-482.382) * [-477.357] (-479.053) (-474.921) (-478.024) -- 0:00:52
117500 -- [-478.639] (-478.860) (-477.231) (-479.893) * (-479.855) (-483.653) [-477.886] (-479.150) -- 0:00:52
118000 -- [-480.571] (-481.333) (-477.932) (-484.108) * (-476.523) [-478.649] (-479.328) (-478.874) -- 0:00:59
118500 -- [-477.330] (-476.741) (-481.131) (-478.079) * (-481.000) [-477.733] (-476.060) (-478.991) -- 0:00:59
119000 -- (-476.933) (-477.787) (-481.129) [-477.995] * (-481.511) (-479.968) [-478.066] (-478.675) -- 0:00:59
119500 -- [-482.040] (-477.334) (-479.966) (-476.424) * [-476.815] (-476.749) (-484.122) (-478.670) -- 0:00:58
120000 -- (-479.623) [-477.781] (-480.931) (-479.689) * [-478.370] (-477.800) (-485.382) (-479.092) -- 0:00:58
Average standard deviation of split frequencies: 0.026761
120500 -- (-477.591) (-477.731) (-482.553) [-477.247] * [-477.133] (-476.446) (-481.996) (-480.438) -- 0:00:58
121000 -- (-482.350) (-478.482) (-477.834) [-479.176] * (-478.374) [-478.091] (-482.374) (-481.378) -- 0:00:58
121500 -- (-479.251) [-476.709] (-479.495) (-477.421) * (-477.422) (-476.732) [-481.969] (-479.297) -- 0:00:57
122000 -- (-481.142) [-481.200] (-479.426) (-478.059) * (-482.833) (-480.119) [-480.325] (-477.325) -- 0:00:57
122500 -- (-478.152) (-478.841) [-477.130] (-484.285) * (-479.856) [-480.431] (-478.681) (-479.009) -- 0:00:57
123000 -- [-475.644] (-479.701) (-476.355) (-482.138) * [-475.656] (-480.024) (-477.411) (-478.338) -- 0:00:57
123500 -- (-478.082) (-479.382) [-476.121] (-483.635) * (-477.628) (-481.126) [-477.699] (-481.860) -- 0:00:56
124000 -- (-477.080) [-481.359] (-475.555) (-482.477) * (-482.467) (-479.287) (-476.289) [-479.717] -- 0:00:56
124500 -- (-479.451) (-481.890) (-479.460) [-477.976] * (-476.793) (-480.849) [-478.458] (-479.247) -- 0:00:56
125000 -- (-481.410) (-480.417) (-478.350) [-478.348] * (-478.928) (-479.160) (-478.206) [-479.067] -- 0:00:56
Average standard deviation of split frequencies: 0.026002
125500 -- (-480.629) [-481.587] (-477.337) (-478.246) * (-478.652) (-482.604) [-479.042] (-477.823) -- 0:00:55
126000 -- (-480.406) (-477.803) [-479.425] (-483.890) * (-479.677) (-483.674) [-478.571] (-477.686) -- 0:00:55
126500 -- [-476.783] (-480.203) (-480.271) (-480.957) * [-480.142] (-478.992) (-476.939) (-483.078) -- 0:00:55
127000 -- [-477.128] (-481.150) (-477.549) (-479.702) * (-480.666) (-478.391) [-477.287] (-479.813) -- 0:00:54
127500 -- (-483.263) (-476.957) (-478.378) [-477.925] * (-479.336) (-482.944) (-476.517) [-480.240] -- 0:00:54
128000 -- (-480.036) [-475.752] (-480.491) (-476.781) * [-477.451] (-478.031) (-481.947) (-478.874) -- 0:00:54
128500 -- (-479.527) (-478.656) [-478.165] (-478.062) * [-476.356] (-478.632) (-476.924) (-478.627) -- 0:00:54
129000 -- (-478.402) [-479.168] (-480.363) (-482.162) * (-476.714) (-478.830) (-482.868) [-478.637] -- 0:00:54
129500 -- [-478.085] (-478.057) (-479.137) (-481.621) * (-477.514) (-479.566) [-479.488] (-480.537) -- 0:00:53
130000 -- (-478.619) [-477.528] (-478.411) (-475.655) * (-477.107) [-476.516] (-476.259) (-481.635) -- 0:00:53
Average standard deviation of split frequencies: 0.023991
130500 -- [-478.551] (-477.491) (-482.384) (-477.149) * (-477.328) (-478.849) [-475.587] (-482.132) -- 0:00:53
131000 -- (-477.300) (-477.098) [-477.607] (-476.439) * (-482.453) (-478.541) [-479.572] (-481.447) -- 0:00:53
131500 -- (-481.502) (-478.828) [-478.502] (-478.286) * (-478.329) [-480.031] (-477.708) (-477.338) -- 0:00:52
132000 -- [-478.906] (-475.939) (-478.155) (-479.413) * (-478.228) (-477.788) [-477.828] (-477.830) -- 0:00:52
132500 -- (-479.100) [-478.112] (-479.829) (-478.902) * (-480.754) (-479.505) [-477.485] (-482.144) -- 0:00:52
133000 -- (-478.682) (-483.056) [-477.372] (-480.932) * [-477.087] (-477.379) (-477.044) (-480.705) -- 0:00:52
133500 -- [-478.474] (-480.334) (-477.337) (-478.270) * (-479.800) (-478.765) (-477.189) [-477.496] -- 0:00:51
134000 -- (-479.363) (-479.289) (-481.005) [-474.905] * [-476.907] (-482.496) (-478.467) (-478.603) -- 0:00:58
134500 -- (-479.430) [-481.269] (-475.896) (-476.991) * [-478.813] (-476.482) (-477.831) (-484.130) -- 0:00:57
135000 -- (-479.982) [-480.553] (-477.987) (-479.297) * (-479.162) [-478.906] (-477.114) (-481.589) -- 0:00:57
Average standard deviation of split frequencies: 0.022530
135500 -- (-477.717) (-477.220) (-476.494) [-479.540] * (-477.616) (-480.280) [-476.242] (-478.163) -- 0:00:57
136000 -- (-477.579) (-477.243) [-479.598] (-478.153) * (-476.611) (-479.307) [-479.020] (-480.548) -- 0:00:57
136500 -- (-482.008) (-479.028) (-477.459) [-477.153] * [-479.447] (-476.649) (-480.338) (-479.864) -- 0:00:56
137000 -- (-479.782) (-478.663) [-476.457] (-479.023) * (-477.034) (-479.930) [-478.376] (-480.423) -- 0:00:56
137500 -- (-477.243) [-481.235] (-479.450) (-479.223) * (-477.453) [-478.678] (-480.236) (-480.714) -- 0:00:56
138000 -- (-481.625) (-477.914) (-478.193) [-479.510] * (-479.358) [-479.765] (-478.616) (-482.880) -- 0:00:56
138500 -- (-477.696) [-478.668] (-479.639) (-478.567) * [-475.492] (-478.088) (-476.903) (-487.294) -- 0:00:55
139000 -- (-479.747) [-478.588] (-480.853) (-477.947) * (-475.816) [-476.555] (-481.037) (-482.649) -- 0:00:55
139500 -- [-476.846] (-477.010) (-479.869) (-480.621) * [-478.953] (-476.967) (-481.102) (-481.225) -- 0:00:55
140000 -- (-480.025) [-480.570] (-477.649) (-483.478) * [-481.058] (-478.411) (-479.374) (-478.877) -- 0:00:55
Average standard deviation of split frequencies: 0.021597
140500 -- [-481.005] (-480.289) (-476.472) (-482.166) * (-478.090) (-478.235) [-477.787] (-482.848) -- 0:00:55
141000 -- (-477.439) [-476.372] (-478.082) (-483.097) * (-480.039) [-478.126] (-481.486) (-483.817) -- 0:00:54
141500 -- (-477.706) (-478.973) (-477.859) [-477.164] * [-480.797] (-478.329) (-480.173) (-483.080) -- 0:00:54
142000 -- (-479.061) (-478.929) [-475.915] (-478.521) * [-477.373] (-479.358) (-478.779) (-479.272) -- 0:00:54
142500 -- [-482.515] (-476.918) (-479.834) (-476.597) * (-478.070) (-479.842) [-474.716] (-478.952) -- 0:00:54
143000 -- (-477.973) (-479.105) [-477.340] (-475.688) * [-476.115] (-479.335) (-477.718) (-480.667) -- 0:00:53
143500 -- [-477.075] (-478.881) (-476.763) (-477.115) * [-479.105] (-479.890) (-482.049) (-479.853) -- 0:00:53
144000 -- (-478.719) [-479.449] (-477.673) (-477.221) * [-481.073] (-478.472) (-475.752) (-478.929) -- 0:00:53
144500 -- (-481.155) (-480.047) [-481.493] (-479.585) * (-477.640) [-477.960] (-478.216) (-478.825) -- 0:00:53
145000 -- (-480.781) (-481.564) [-476.148] (-476.269) * (-477.910) (-481.608) [-477.185] (-482.532) -- 0:00:53
Average standard deviation of split frequencies: 0.020019
145500 -- (-479.167) (-478.764) [-475.647] (-474.820) * (-477.693) [-480.425] (-474.353) (-479.598) -- 0:00:52
146000 -- [-481.883] (-482.553) (-477.860) (-477.220) * (-476.064) [-479.938] (-480.803) (-481.460) -- 0:00:52
146500 -- (-476.214) (-479.527) [-476.926] (-475.674) * (-477.402) (-478.619) [-478.107] (-481.057) -- 0:00:52
147000 -- (-476.754) [-477.216] (-476.804) (-477.326) * (-478.471) [-479.135] (-478.886) (-484.764) -- 0:00:52
147500 -- (-478.066) [-476.246] (-478.461) (-481.159) * (-477.811) (-479.270) [-476.654] (-478.465) -- 0:00:52
148000 -- (-476.932) (-477.662) (-479.765) [-479.752] * (-479.743) (-476.452) [-480.162] (-483.193) -- 0:00:51
148500 -- (-477.055) (-478.343) [-480.056] (-478.364) * [-480.829] (-479.210) (-481.303) (-479.704) -- 0:00:51
149000 -- (-479.939) [-477.309] (-478.612) (-475.756) * (-480.304) [-477.889] (-479.259) (-477.128) -- 0:00:51
149500 -- [-483.200] (-480.769) (-476.874) (-477.469) * (-476.788) (-477.710) [-477.042] (-478.188) -- 0:00:56
150000 -- (-482.863) (-480.455) [-478.616] (-477.828) * [-479.644] (-477.881) (-477.582) (-479.748) -- 0:00:56
Average standard deviation of split frequencies: 0.021078
150500 -- [-475.647] (-482.406) (-476.961) (-477.999) * (-478.643) (-475.763) [-474.872] (-475.825) -- 0:00:56
151000 -- (-478.310) [-477.908] (-477.148) (-476.396) * (-479.927) (-479.074) [-477.390] (-477.764) -- 0:00:56
151500 -- (-476.569) (-480.013) (-479.443) [-479.413] * [-481.091] (-478.820) (-475.702) (-479.949) -- 0:00:56
152000 -- (-478.589) (-478.287) (-476.164) [-478.044] * (-480.295) [-478.443] (-475.904) (-479.138) -- 0:00:55
152500 -- [-479.109] (-475.971) (-477.051) (-479.020) * (-479.846) [-478.439] (-479.271) (-480.315) -- 0:00:55
153000 -- [-477.682] (-478.612) (-479.005) (-480.529) * [-477.437] (-477.100) (-477.989) (-479.808) -- 0:00:55
153500 -- (-477.022) (-478.803) [-477.643] (-477.335) * (-478.261) [-477.003] (-478.379) (-477.895) -- 0:00:55
154000 -- (-474.690) (-478.509) [-476.311] (-480.520) * [-478.583] (-478.015) (-476.592) (-476.870) -- 0:00:54
154500 -- (-475.822) (-479.649) [-478.420] (-478.733) * (-478.048) (-477.334) [-477.339] (-479.068) -- 0:00:54
155000 -- [-478.767] (-479.349) (-476.269) (-475.734) * (-483.122) (-477.819) (-478.641) [-476.902] -- 0:00:54
Average standard deviation of split frequencies: 0.020994
155500 -- [-476.871] (-479.410) (-477.576) (-476.699) * (-479.912) [-476.421] (-476.738) (-479.895) -- 0:00:54
156000 -- [-477.006] (-479.525) (-478.058) (-478.495) * (-482.087) [-478.651] (-476.362) (-480.299) -- 0:00:54
156500 -- (-477.781) [-476.191] (-478.402) (-480.623) * (-480.180) [-475.860] (-476.851) (-478.276) -- 0:00:53
157000 -- (-476.015) (-477.853) [-477.436] (-480.544) * (-478.489) (-480.465) [-474.850] (-478.461) -- 0:00:53
157500 -- [-476.716] (-478.161) (-480.207) (-480.949) * (-480.234) (-475.792) [-478.634] (-480.026) -- 0:00:53
158000 -- (-478.085) [-479.285] (-478.181) (-478.117) * [-478.853] (-477.445) (-477.198) (-479.098) -- 0:00:53
158500 -- (-479.642) (-479.348) (-479.440) [-478.497] * (-479.003) (-479.746) [-477.179] (-481.813) -- 0:00:53
159000 -- (-478.780) (-478.738) [-477.203] (-478.639) * [-481.156] (-476.726) (-481.058) (-479.518) -- 0:00:52
159500 -- [-478.570] (-484.194) (-478.155) (-478.698) * (-478.320) (-477.969) (-484.550) [-475.510] -- 0:00:52
160000 -- (-478.731) (-484.267) [-479.247] (-483.001) * [-478.267] (-476.184) (-481.182) (-483.689) -- 0:00:52
Average standard deviation of split frequencies: 0.021156
160500 -- [-475.862] (-479.988) (-480.664) (-478.024) * (-480.534) [-478.315] (-479.164) (-477.632) -- 0:00:52
161000 -- [-477.275] (-479.499) (-475.401) (-477.403) * (-478.390) [-479.653] (-480.241) (-478.892) -- 0:00:52
161500 -- [-478.829] (-478.628) (-476.974) (-475.668) * (-478.303) [-478.724] (-481.407) (-478.039) -- 0:00:51
162000 -- (-477.952) (-479.864) [-476.626] (-477.902) * (-477.982) (-477.047) (-477.419) [-475.877] -- 0:00:51
162500 -- (-478.081) (-479.525) [-478.258] (-477.023) * (-479.043) [-476.146] (-477.126) (-477.841) -- 0:00:51
163000 -- (-476.310) (-480.584) [-477.525] (-476.974) * (-479.381) [-477.527] (-479.206) (-477.337) -- 0:00:51
163500 -- [-477.280] (-479.163) (-478.752) (-477.952) * (-480.402) (-476.008) (-484.765) [-476.509] -- 0:00:51
164000 -- (-477.304) (-478.663) (-479.789) [-481.782] * (-480.300) (-477.821) (-479.047) [-475.883] -- 0:00:50
164500 -- (-474.249) (-480.336) (-478.863) [-477.054] * (-479.552) (-478.145) (-479.075) [-476.305] -- 0:00:50
165000 -- (-477.135) [-477.202] (-476.342) (-477.087) * (-480.085) (-478.292) (-478.440) [-476.053] -- 0:00:50
Average standard deviation of split frequencies: 0.019595
165500 -- [-475.570] (-480.178) (-475.727) (-478.884) * (-481.010) (-478.408) [-479.703] (-475.036) -- 0:00:55
166000 -- (-476.515) (-479.532) (-476.802) [-477.086] * [-477.357] (-480.257) (-478.569) (-476.441) -- 0:00:55
166500 -- [-479.540] (-480.445) (-479.816) (-477.469) * (-483.472) (-476.614) [-480.286] (-477.452) -- 0:00:55
167000 -- [-478.962] (-476.252) (-478.125) (-476.270) * [-477.556] (-478.362) (-486.074) (-483.387) -- 0:00:54
167500 -- (-475.809) (-477.678) (-478.393) [-477.619] * [-480.219] (-480.131) (-478.650) (-479.394) -- 0:00:54
168000 -- (-480.946) (-476.657) [-475.246] (-478.280) * (-477.685) (-478.548) (-478.231) [-483.143] -- 0:00:54
168500 -- (-478.437) (-475.873) [-478.848] (-475.861) * [-479.442] (-478.342) (-479.054) (-478.341) -- 0:00:54
169000 -- [-475.997] (-477.457) (-478.003) (-477.831) * [-480.555] (-477.744) (-479.005) (-479.319) -- 0:00:54
169500 -- [-477.685] (-478.471) (-480.237) (-476.130) * [-477.800] (-481.972) (-481.420) (-479.383) -- 0:00:53
170000 -- (-478.135) [-478.147] (-476.828) (-477.306) * (-481.194) (-476.329) [-479.051] (-475.242) -- 0:00:53
Average standard deviation of split frequencies: 0.019335
170500 -- (-477.743) (-476.626) [-477.963] (-477.988) * [-479.757] (-478.493) (-478.686) (-480.269) -- 0:00:53
171000 -- (-480.662) [-476.722] (-476.974) (-476.866) * (-480.011) (-477.033) [-477.227] (-479.247) -- 0:00:53
171500 -- (-478.175) (-478.211) [-477.130] (-477.494) * (-484.403) (-477.800) (-479.238) [-478.223] -- 0:00:53
172000 -- (-479.158) (-478.754) [-476.221] (-479.500) * (-480.653) (-478.325) [-478.243] (-477.189) -- 0:00:52
172500 -- [-476.875] (-478.915) (-477.515) (-478.366) * (-480.223) (-478.193) [-475.559] (-476.792) -- 0:00:52
173000 -- (-477.362) (-477.193) [-475.480] (-478.577) * [-476.734] (-477.795) (-475.956) (-477.019) -- 0:00:52
173500 -- (-480.753) (-478.488) (-476.206) [-480.351] * (-477.764) (-477.430) [-475.136] (-478.887) -- 0:00:52
174000 -- (-483.823) [-478.143] (-475.995) (-479.171) * (-478.567) (-478.874) [-478.469] (-480.927) -- 0:00:52
174500 -- (-484.771) [-479.868] (-477.893) (-476.664) * (-481.406) [-477.575] (-475.866) (-486.655) -- 0:00:52
175000 -- (-479.911) (-479.909) [-478.426] (-476.877) * [-478.570] (-474.612) (-476.768) (-483.182) -- 0:00:51
Average standard deviation of split frequencies: 0.021427
175500 -- [-480.575] (-479.562) (-479.695) (-476.790) * (-478.612) [-477.084] (-479.617) (-479.575) -- 0:00:51
176000 -- (-479.743) (-479.342) (-478.100) [-476.469] * (-482.073) (-477.613) [-478.520] (-478.997) -- 0:00:51
176500 -- (-479.526) (-478.993) (-476.093) [-478.639] * (-480.256) (-480.839) [-480.070] (-476.940) -- 0:00:51
177000 -- (-481.271) [-478.940] (-480.132) (-481.209) * (-481.565) (-478.410) (-479.197) [-478.004] -- 0:00:51
177500 -- (-479.612) [-476.877] (-477.223) (-476.174) * (-486.013) [-482.546] (-477.563) (-475.961) -- 0:00:50
178000 -- (-477.899) (-478.313) [-477.926] (-478.027) * [-478.048] (-478.995) (-477.342) (-480.465) -- 0:00:50
178500 -- [-475.527] (-480.284) (-481.754) (-478.538) * (-479.336) (-484.089) [-477.916] (-476.940) -- 0:00:50
179000 -- (-477.096) (-482.305) [-479.955] (-481.689) * (-477.608) (-480.703) [-478.634] (-479.834) -- 0:00:50
179500 -- [-476.440] (-488.544) (-479.052) (-484.049) * (-475.775) [-477.868] (-477.834) (-481.174) -- 0:00:50
180000 -- (-475.508) (-478.988) [-475.673] (-481.877) * (-477.787) (-477.197) [-476.720] (-484.367) -- 0:00:50
Average standard deviation of split frequencies: 0.019638
180500 -- [-478.144] (-481.061) (-479.656) (-480.351) * (-477.708) (-477.997) (-479.082) [-479.236] -- 0:00:54
181000 -- (-478.692) (-480.981) [-477.805] (-479.931) * [-480.939] (-478.788) (-479.004) (-480.697) -- 0:00:54
181500 -- (-479.896) (-480.977) [-476.750] (-476.593) * (-482.171) (-478.466) [-478.817] (-480.526) -- 0:00:54
182000 -- (-481.891) [-484.595] (-478.392) (-477.499) * [-478.104] (-479.695) (-480.521) (-477.792) -- 0:00:53
182500 -- (-480.568) [-481.619] (-479.975) (-478.728) * (-477.915) [-480.327] (-480.809) (-477.506) -- 0:00:53
183000 -- (-480.786) (-479.618) (-477.353) [-477.503] * [-477.704] (-481.137) (-478.004) (-477.754) -- 0:00:53
183500 -- (-478.604) [-480.630] (-478.737) (-477.421) * (-478.523) [-476.680] (-479.944) (-478.407) -- 0:00:53
184000 -- (-478.811) [-479.188] (-478.432) (-477.138) * (-478.315) [-478.399] (-479.507) (-479.196) -- 0:00:53
184500 -- [-478.434] (-477.425) (-481.277) (-477.259) * [-476.615] (-479.376) (-477.333) (-474.862) -- 0:00:53
185000 -- (-479.415) (-478.233) [-479.537] (-479.768) * (-476.305) (-476.844) [-476.917] (-479.053) -- 0:00:52
Average standard deviation of split frequencies: 0.017500
185500 -- (-477.205) (-478.517) (-479.411) [-476.522] * (-477.801) (-479.494) [-477.778] (-475.789) -- 0:00:52
186000 -- (-476.820) (-479.388) [-477.681] (-481.354) * [-476.769] (-479.368) (-476.283) (-476.362) -- 0:00:52
186500 -- [-477.782] (-481.418) (-485.437) (-480.293) * (-475.476) (-479.375) (-477.455) [-476.946] -- 0:00:52
187000 -- (-479.990) (-480.207) [-476.379] (-481.464) * (-478.879) (-478.267) [-478.580] (-476.520) -- 0:00:52
187500 -- (-476.620) (-478.396) (-477.320) [-480.026] * [-477.330] (-478.651) (-478.533) (-477.201) -- 0:00:52
188000 -- (-477.876) (-479.088) [-477.808] (-482.562) * (-475.878) (-480.874) [-477.200] (-477.394) -- 0:00:51
188500 -- (-476.675) (-480.624) (-477.161) [-482.024] * [-474.598] (-483.596) (-476.641) (-476.934) -- 0:00:51
189000 -- (-477.551) [-479.203] (-484.362) (-478.917) * [-474.740] (-478.273) (-480.559) (-477.222) -- 0:00:51
189500 -- (-478.470) (-479.767) [-477.550] (-478.393) * (-476.409) (-485.264) (-475.340) [-479.227] -- 0:00:51
190000 -- (-476.582) [-479.555] (-477.433) (-480.560) * (-477.067) (-480.747) [-478.839] (-478.608) -- 0:00:51
Average standard deviation of split frequencies: 0.017801
190500 -- (-479.225) (-479.546) [-479.958] (-479.443) * (-479.266) (-478.334) (-479.115) [-479.499] -- 0:00:50
191000 -- [-476.136] (-483.246) (-479.800) (-477.514) * (-478.642) [-479.131] (-478.112) (-478.290) -- 0:00:50
191500 -- (-480.072) (-483.724) [-481.268] (-475.228) * (-477.849) (-478.251) (-475.333) [-477.789] -- 0:00:50
192000 -- (-476.200) [-480.534] (-478.005) (-476.562) * (-480.657) [-476.240] (-477.986) (-478.361) -- 0:00:50
192500 -- [-478.186] (-480.494) (-480.269) (-476.154) * (-483.625) (-479.457) (-476.534) [-477.973] -- 0:00:50
193000 -- (-476.227) (-477.620) (-480.607) [-476.726] * (-477.420) (-479.807) [-476.317] (-478.436) -- 0:00:50
193500 -- (-477.794) (-475.772) (-478.481) [-477.546] * [-476.752] (-481.965) (-480.741) (-477.056) -- 0:00:50
194000 -- [-475.873] (-477.314) (-477.372) (-477.424) * (-475.532) [-477.984] (-479.524) (-477.218) -- 0:00:49
194500 -- (-476.474) (-479.054) (-476.750) [-477.228] * (-475.757) (-477.597) (-480.033) [-482.865] -- 0:00:49
195000 -- (-482.311) (-479.850) (-478.826) [-477.987] * (-477.241) (-476.478) (-480.343) [-478.514] -- 0:00:53
Average standard deviation of split frequencies: 0.019494
195500 -- (-478.440) (-476.980) (-477.238) [-479.491] * (-480.238) (-477.665) [-476.030] (-478.015) -- 0:00:53
196000 -- (-478.450) (-478.239) [-476.857] (-473.910) * (-483.810) [-477.423] (-476.360) (-478.194) -- 0:00:53
196500 -- (-478.790) (-477.806) (-479.361) [-478.692] * [-480.294] (-477.856) (-476.317) (-480.623) -- 0:00:53
197000 -- [-476.660] (-476.674) (-480.745) (-478.108) * (-476.363) (-479.066) [-475.986] (-476.417) -- 0:00:52
197500 -- (-478.208) [-477.782] (-478.947) (-480.646) * (-480.429) (-477.808) (-477.394) [-478.620] -- 0:00:52
198000 -- (-481.320) [-476.974] (-479.365) (-482.252) * (-477.465) (-478.967) [-475.118] (-476.931) -- 0:00:52
198500 -- (-482.584) (-480.970) (-479.257) [-479.749] * [-478.559] (-476.401) (-480.299) (-481.633) -- 0:00:52
199000 -- [-479.503] (-477.464) (-479.665) (-476.506) * (-476.308) (-477.470) (-480.538) [-478.440] -- 0:00:52
199500 -- [-476.688] (-479.911) (-480.280) (-479.386) * [-477.874] (-477.978) (-477.287) (-478.542) -- 0:00:52
200000 -- (-479.310) (-476.892) [-478.431] (-483.686) * (-478.355) [-482.748] (-476.725) (-476.426) -- 0:00:51
Average standard deviation of split frequencies: 0.017928
200500 -- [-479.333] (-478.166) (-479.204) (-481.087) * [-479.913] (-477.414) (-476.554) (-477.436) -- 0:00:51
201000 -- (-478.917) (-480.054) (-477.397) [-480.241] * (-478.467) [-477.143] (-476.844) (-480.176) -- 0:00:51
201500 -- [-477.427] (-476.273) (-478.124) (-479.159) * (-479.275) (-477.455) (-479.505) [-478.073] -- 0:00:51
202000 -- (-476.383) [-478.000] (-477.728) (-483.383) * [-475.937] (-486.188) (-481.910) (-478.951) -- 0:00:51
202500 -- (-479.367) [-478.592] (-477.452) (-480.563) * [-476.471] (-479.598) (-481.583) (-478.839) -- 0:00:51
203000 -- (-475.796) [-480.032] (-479.592) (-476.509) * (-477.839) (-482.372) (-480.337) [-477.648] -- 0:00:51
203500 -- [-482.600] (-476.154) (-477.303) (-476.983) * (-477.403) (-477.608) (-481.048) [-478.124] -- 0:00:50
204000 -- (-477.879) [-476.319] (-482.092) (-481.090) * [-483.061] (-479.153) (-478.689) (-479.483) -- 0:00:50
204500 -- (-477.112) (-482.759) (-477.003) [-479.354] * (-481.335) (-479.927) [-476.388] (-477.723) -- 0:00:50
205000 -- (-481.238) (-477.799) (-476.694) [-479.852] * (-478.058) (-480.508) (-477.674) [-476.010] -- 0:00:50
Average standard deviation of split frequencies: 0.017464
205500 -- (-479.254) [-479.475] (-477.311) (-479.144) * (-480.054) (-476.520) [-482.158] (-480.097) -- 0:00:50
206000 -- [-478.548] (-480.003) (-478.273) (-483.373) * [-478.522] (-477.782) (-480.120) (-479.408) -- 0:00:50
206500 -- (-477.080) (-479.130) (-476.604) [-478.563] * (-479.119) (-477.033) (-482.071) [-482.772] -- 0:00:49
207000 -- (-481.131) (-488.872) (-475.270) [-479.325] * (-479.939) [-477.436] (-478.761) (-481.555) -- 0:00:49
207500 -- (-479.160) [-479.488] (-480.086) (-477.679) * (-480.746) [-477.064] (-479.100) (-479.473) -- 0:00:49
208000 -- (-477.030) [-478.020] (-479.026) (-478.895) * (-480.225) (-476.442) [-479.324] (-478.295) -- 0:00:49
208500 -- (-477.636) [-481.199] (-479.794) (-477.731) * [-477.522] (-476.264) (-480.236) (-480.575) -- 0:00:53
209000 -- (-479.623) [-477.687] (-479.805) (-479.043) * [-480.860] (-480.147) (-477.451) (-480.955) -- 0:00:52
209500 -- [-483.775] (-480.392) (-479.749) (-477.252) * [-479.840] (-476.210) (-485.852) (-479.250) -- 0:00:52
210000 -- (-479.136) [-478.112] (-474.999) (-479.543) * [-476.964] (-476.767) (-479.444) (-480.015) -- 0:00:52
Average standard deviation of split frequencies: 0.017901
210500 -- (-475.749) (-477.416) (-475.124) [-476.760] * (-479.629) (-478.801) [-476.561] (-480.901) -- 0:00:52
211000 -- [-476.923] (-476.208) (-475.286) (-479.854) * [-478.351] (-477.040) (-476.133) (-478.285) -- 0:00:52
211500 -- (-477.821) (-477.260) (-483.902) [-480.992] * (-482.960) (-477.167) [-479.226] (-480.548) -- 0:00:52
212000 -- [-476.611] (-480.869) (-484.457) (-479.998) * (-480.629) (-481.069) [-476.988] (-479.443) -- 0:00:52
212500 -- (-479.186) [-476.688] (-480.568) (-480.894) * (-479.689) [-480.178] (-476.514) (-478.396) -- 0:00:51
213000 -- [-476.401] (-477.800) (-479.864) (-478.535) * (-476.489) (-477.687) (-476.284) [-477.017] -- 0:00:51
213500 -- [-477.731] (-478.947) (-478.426) (-478.851) * [-481.437] (-477.448) (-479.433) (-478.017) -- 0:00:51
214000 -- (-477.579) (-476.858) (-477.382) [-478.554] * [-477.442] (-478.035) (-477.393) (-475.907) -- 0:00:51
214500 -- [-477.597] (-479.621) (-479.800) (-478.548) * [-478.867] (-478.024) (-477.256) (-477.549) -- 0:00:51
215000 -- [-480.561] (-479.931) (-480.916) (-479.437) * [-476.789] (-480.350) (-479.658) (-480.975) -- 0:00:51
Average standard deviation of split frequencies: 0.018914
215500 -- (-478.708) (-477.081) [-477.661] (-480.163) * (-479.865) [-477.884] (-480.349) (-480.031) -- 0:00:50
216000 -- (-479.664) (-477.905) [-478.886] (-479.425) * [-480.364] (-481.813) (-477.279) (-478.133) -- 0:00:50
216500 -- (-478.768) (-477.397) [-480.123] (-479.752) * (-477.627) [-476.154] (-478.699) (-478.065) -- 0:00:50
217000 -- (-479.550) (-477.469) [-477.756] (-478.466) * (-479.421) (-478.324) [-477.663] (-478.876) -- 0:00:50
217500 -- (-478.595) [-476.926] (-477.670) (-478.126) * (-479.962) [-477.167] (-480.143) (-477.105) -- 0:00:50
218000 -- (-479.678) [-476.681] (-478.377) (-477.591) * (-480.064) (-477.712) (-477.816) [-478.363] -- 0:00:50
218500 -- (-477.461) [-477.882] (-482.475) (-479.067) * [-481.961] (-478.065) (-480.565) (-476.609) -- 0:00:50
219000 -- (-478.225) [-477.214] (-477.065) (-480.730) * (-483.681) (-475.780) (-478.029) [-479.279] -- 0:00:49
219500 -- (-478.382) [-480.188] (-478.893) (-478.287) * (-480.469) [-483.893] (-475.809) (-479.361) -- 0:00:49
220000 -- (-478.130) [-480.502] (-478.462) (-481.540) * [-478.011] (-478.845) (-479.436) (-483.057) -- 0:00:49
Average standard deviation of split frequencies: 0.017565
220500 -- (-481.390) [-475.543] (-479.368) (-478.157) * [-478.714] (-480.148) (-481.373) (-478.960) -- 0:00:49
221000 -- [-477.483] (-481.352) (-479.226) (-481.721) * (-482.234) [-477.830] (-478.267) (-477.858) -- 0:00:49
221500 -- (-483.435) (-480.908) (-479.169) [-479.313] * (-481.160) [-478.849] (-482.746) (-476.625) -- 0:00:49
222000 -- (-480.768) [-475.924] (-478.965) (-478.996) * (-477.961) (-477.871) [-478.545] (-476.043) -- 0:00:49
222500 -- (-479.034) (-477.442) (-480.327) [-477.981] * (-479.830) (-480.911) (-480.517) [-476.360] -- 0:00:48
223000 -- (-478.740) (-477.737) (-480.611) [-479.547] * (-480.398) [-480.088] (-478.892) (-479.825) -- 0:00:48
223500 -- (-479.997) [-477.810] (-480.396) (-478.895) * (-479.258) [-476.728] (-477.648) (-478.877) -- 0:00:48
224000 -- (-482.402) [-476.106] (-479.613) (-480.370) * (-479.123) [-481.479] (-480.827) (-479.597) -- 0:00:48
224500 -- [-475.327] (-477.017) (-479.275) (-478.111) * (-479.031) (-481.966) [-475.902] (-477.719) -- 0:00:51
225000 -- (-478.033) [-476.050] (-477.750) (-484.028) * (-477.996) (-478.855) (-477.961) [-478.820] -- 0:00:51
Average standard deviation of split frequencies: 0.016791
225500 -- (-476.239) [-482.407] (-478.790) (-481.840) * (-480.060) (-477.586) (-476.585) [-477.896] -- 0:00:51
226000 -- (-480.914) (-479.117) [-479.280] (-479.056) * (-479.901) (-481.253) (-480.010) [-479.068] -- 0:00:51
226500 -- (-480.623) [-476.653] (-479.195) (-480.872) * (-478.491) [-477.874] (-476.824) (-478.053) -- 0:00:51
227000 -- (-481.117) (-477.053) (-481.397) [-478.171] * (-480.825) [-476.931] (-479.830) (-479.995) -- 0:00:51
227500 -- [-476.220] (-479.892) (-479.281) (-479.898) * (-478.799) (-477.170) (-477.531) [-482.451] -- 0:00:50
228000 -- (-480.318) (-476.883) [-478.472] (-480.487) * (-478.805) (-479.441) (-478.092) [-476.444] -- 0:00:50
228500 -- (-478.088) (-477.336) [-479.764] (-480.322) * (-484.602) (-483.224) [-478.107] (-476.289) -- 0:00:50
229000 -- (-480.569) (-475.294) (-480.511) [-478.910] * (-481.021) (-478.642) [-477.282] (-477.554) -- 0:00:50
229500 -- (-486.139) (-479.626) [-480.896] (-478.970) * (-482.451) (-484.145) (-481.502) [-478.923] -- 0:00:50
230000 -- (-484.069) (-479.384) (-485.618) [-483.077] * (-480.411) (-480.223) [-480.131] (-478.327) -- 0:00:50
Average standard deviation of split frequencies: 0.016887
230500 -- (-484.171) (-478.491) (-476.025) [-483.908] * (-479.862) [-478.480] (-476.674) (-478.143) -- 0:00:50
231000 -- [-479.523] (-476.048) (-479.969) (-479.722) * (-480.523) (-477.547) [-477.695] (-477.154) -- 0:00:49
231500 -- (-479.835) [-478.048] (-482.298) (-479.972) * (-483.961) [-480.273] (-475.331) (-478.993) -- 0:00:49
232000 -- (-478.529) (-477.372) [-479.630] (-481.335) * (-478.156) (-479.693) (-476.481) [-478.230] -- 0:00:49
232500 -- (-479.777) (-476.561) (-477.863) [-478.050] * [-481.024] (-478.640) (-479.291) (-479.407) -- 0:00:49
233000 -- (-477.931) (-476.172) [-475.907] (-481.168) * (-479.261) (-479.085) [-481.775] (-476.439) -- 0:00:49
233500 -- [-478.392] (-477.510) (-480.402) (-479.112) * (-477.808) (-479.427) [-479.627] (-480.717) -- 0:00:49
234000 -- (-478.798) (-475.913) (-480.810) [-481.014] * (-481.148) (-477.353) (-481.532) [-478.749] -- 0:00:49
234500 -- (-478.675) [-478.316] (-480.757) (-478.846) * (-480.214) (-477.641) [-477.614] (-481.667) -- 0:00:48
235000 -- (-476.477) [-477.219] (-479.224) (-477.359) * (-479.226) (-481.217) [-477.065] (-481.148) -- 0:00:48
Average standard deviation of split frequencies: 0.015559
235500 -- (-477.303) (-475.982) [-478.918] (-481.755) * (-478.339) [-476.401] (-477.275) (-479.391) -- 0:00:48
236000 -- (-478.881) (-476.278) (-481.069) [-480.511] * (-483.025) [-478.610] (-476.255) (-480.463) -- 0:00:48
236500 -- (-476.984) [-478.056] (-479.585) (-478.921) * (-478.791) [-479.513] (-479.775) (-483.052) -- 0:00:48
237000 -- (-479.410) (-476.264) [-477.845] (-480.103) * (-479.362) [-478.133] (-478.761) (-481.045) -- 0:00:48
237500 -- (-476.972) (-476.714) [-477.124] (-482.169) * (-476.767) (-477.978) [-477.493] (-481.237) -- 0:00:48
238000 -- (-476.750) [-476.423] (-478.810) (-480.541) * (-481.491) (-476.714) [-475.509] (-481.549) -- 0:00:48
238500 -- (-477.248) (-477.333) [-478.875] (-478.903) * (-479.815) [-476.656] (-477.934) (-481.505) -- 0:00:47
239000 -- (-481.572) (-479.359) [-479.928] (-480.613) * (-480.766) [-476.393] (-478.246) (-481.372) -- 0:00:47
239500 -- (-477.115) (-480.518) [-478.481] (-476.755) * (-478.205) [-477.013] (-476.831) (-479.907) -- 0:00:47
240000 -- (-482.305) (-475.822) [-478.147] (-478.494) * (-479.368) (-481.049) [-476.316] (-478.558) -- 0:00:47
Average standard deviation of split frequencies: 0.015154
240500 -- (-481.134) [-475.436] (-479.504) (-479.828) * (-479.456) (-479.698) [-478.028] (-479.776) -- 0:00:50
241000 -- (-477.221) [-480.497] (-476.173) (-479.064) * (-478.034) (-477.112) (-475.758) [-477.777] -- 0:00:50
241500 -- (-478.926) [-478.607] (-477.905) (-483.385) * (-478.921) (-477.785) [-474.422] (-476.505) -- 0:00:50
242000 -- (-476.599) [-476.368] (-479.385) (-479.352) * (-479.758) [-477.653] (-474.989) (-477.923) -- 0:00:50
242500 -- (-482.753) (-478.352) (-477.941) [-479.266] * (-479.255) [-474.804] (-480.367) (-482.901) -- 0:00:49
243000 -- (-476.941) (-478.841) [-476.311] (-479.873) * [-478.940] (-478.029) (-479.195) (-477.677) -- 0:00:49
243500 -- [-477.348] (-478.817) (-476.461) (-480.563) * [-481.613] (-483.596) (-478.250) (-475.321) -- 0:00:49
244000 -- (-477.746) [-478.094] (-478.698) (-481.853) * (-480.831) (-476.762) (-480.353) [-477.590] -- 0:00:49
244500 -- (-482.011) (-478.080) [-477.616] (-480.647) * (-478.136) (-479.609) (-475.989) [-476.163] -- 0:00:49
245000 -- (-477.527) [-475.919] (-479.389) (-479.499) * (-477.678) (-477.830) (-476.588) [-477.505] -- 0:00:49
Average standard deviation of split frequencies: 0.013733
245500 -- (-480.323) [-476.535] (-480.318) (-479.135) * (-479.570) (-477.621) (-476.206) [-477.496] -- 0:00:49
246000 -- [-477.153] (-478.207) (-479.493) (-483.320) * (-480.195) (-478.216) (-476.451) [-478.453] -- 0:00:49
246500 -- (-477.531) (-476.958) [-477.700] (-480.477) * (-481.021) [-477.455] (-478.576) (-477.703) -- 0:00:48
247000 -- (-479.197) (-476.147) (-482.780) [-476.142] * [-478.607] (-479.665) (-478.819) (-477.813) -- 0:00:48
247500 -- (-478.519) (-480.734) [-482.457] (-480.997) * (-478.058) (-479.976) (-481.100) [-476.036] -- 0:00:48
248000 -- [-480.199] (-479.015) (-478.009) (-478.828) * (-476.475) (-479.603) (-480.627) [-476.877] -- 0:00:48
248500 -- [-478.319] (-476.305) (-477.883) (-480.215) * [-479.178] (-479.250) (-481.504) (-481.266) -- 0:00:48
249000 -- (-479.163) [-479.399] (-478.011) (-480.014) * (-478.534) (-479.643) (-481.362) [-476.429] -- 0:00:48
249500 -- (-479.443) [-475.581] (-476.506) (-477.943) * (-483.060) (-478.146) (-479.303) [-476.058] -- 0:00:48
250000 -- (-476.478) (-479.854) (-480.694) [-477.565] * [-479.806] (-480.174) (-476.959) (-477.464) -- 0:00:48
Average standard deviation of split frequencies: 0.015243
250500 -- [-480.237] (-476.434) (-477.934) (-478.849) * (-478.798) [-479.077] (-478.391) (-479.874) -- 0:00:47
251000 -- (-476.653) [-480.470] (-476.664) (-478.898) * (-478.176) [-479.573] (-479.597) (-481.288) -- 0:00:47
251500 -- (-477.318) (-479.219) (-477.977) [-478.761] * (-478.199) (-478.845) (-476.842) [-476.712] -- 0:00:47
252000 -- (-477.036) (-477.237) [-478.924] (-481.127) * [-480.175] (-481.674) (-480.538) (-477.606) -- 0:00:47
252500 -- (-481.384) (-478.109) [-476.314] (-476.882) * (-479.330) [-478.231] (-477.927) (-477.902) -- 0:00:47
253000 -- (-482.985) (-475.862) (-474.605) [-477.064] * (-476.953) (-477.990) [-477.546] (-480.357) -- 0:00:47
253500 -- (-481.096) [-477.607] (-483.319) (-478.482) * (-479.318) (-477.462) (-478.523) [-477.783] -- 0:00:47
254000 -- (-478.537) [-475.607] (-481.548) (-478.353) * [-480.634] (-479.373) (-478.367) (-477.535) -- 0:00:46
254500 -- (-481.475) [-477.284] (-478.680) (-482.318) * (-478.114) [-479.716] (-479.896) (-477.534) -- 0:00:46
255000 -- (-480.492) (-476.468) [-476.489] (-480.033) * [-479.230] (-479.930) (-479.880) (-477.075) -- 0:00:46
Average standard deviation of split frequencies: 0.014936
255500 -- (-478.263) (-476.161) [-478.405] (-478.139) * [-483.681] (-480.494) (-479.286) (-477.713) -- 0:00:46
256000 -- (-477.225) [-476.468] (-477.205) (-477.870) * (-481.066) (-482.317) (-477.164) [-477.190] -- 0:00:46
256500 -- (-476.930) [-475.895] (-478.262) (-478.371) * [-479.439] (-487.652) (-477.644) (-477.575) -- 0:00:49
257000 -- [-477.386] (-476.997) (-478.541) (-476.141) * (-483.630) (-476.756) [-478.424] (-479.822) -- 0:00:49
257500 -- [-476.639] (-476.982) (-480.230) (-475.896) * (-481.239) [-481.464] (-479.074) (-480.193) -- 0:00:49
258000 -- (-478.646) (-475.676) (-482.378) [-478.877] * (-481.839) [-476.942] (-479.905) (-476.776) -- 0:00:48
258500 -- (-477.951) (-475.280) [-480.032] (-481.925) * [-478.664] (-476.160) (-479.757) (-477.555) -- 0:00:48
259000 -- (-480.247) (-478.974) [-480.641] (-479.277) * (-480.176) (-478.954) (-480.953) [-479.007] -- 0:00:48
259500 -- (-482.653) (-478.860) [-478.026] (-479.034) * [-476.313] (-480.579) (-479.134) (-478.577) -- 0:00:48
260000 -- (-480.847) [-475.528] (-477.786) (-482.068) * [-478.896] (-478.676) (-478.867) (-486.144) -- 0:00:48
Average standard deviation of split frequencies: 0.014787
260500 -- (-475.661) [-477.939] (-478.060) (-482.556) * (-477.103) [-478.714] (-477.169) (-480.106) -- 0:00:48
261000 -- [-478.017] (-479.862) (-476.768) (-481.557) * (-477.721) (-479.221) (-476.130) [-479.957] -- 0:00:48
261500 -- (-478.270) (-487.451) [-480.052] (-476.930) * (-479.308) (-475.338) [-475.904] (-480.287) -- 0:00:48
262000 -- (-479.925) (-477.419) (-481.273) [-477.154] * (-479.701) (-476.034) [-479.629] (-478.665) -- 0:00:47
262500 -- (-479.842) [-477.724] (-477.079) (-474.753) * (-477.759) [-476.589] (-478.135) (-482.194) -- 0:00:47
263000 -- (-475.396) (-480.412) [-477.061] (-479.926) * (-480.335) (-478.544) (-482.939) [-476.938] -- 0:00:47
263500 -- (-477.845) [-479.168] (-479.862) (-479.469) * (-479.944) [-478.978] (-479.554) (-477.755) -- 0:00:47
264000 -- [-478.617] (-482.552) (-480.196) (-477.975) * (-478.596) (-477.665) (-478.220) [-478.977] -- 0:00:47
264500 -- (-477.923) (-478.344) (-479.963) [-478.753] * (-476.492) [-479.745] (-477.023) (-479.782) -- 0:00:47
265000 -- (-477.988) [-476.198] (-477.711) (-479.682) * (-479.682) (-478.953) (-477.652) [-477.614] -- 0:00:47
Average standard deviation of split frequencies: 0.013431
265500 -- (-479.283) [-478.349] (-475.283) (-477.847) * (-478.514) [-476.854] (-482.212) (-476.758) -- 0:00:47
266000 -- (-478.182) (-480.196) [-477.620] (-476.884) * [-478.358] (-475.247) (-481.009) (-476.812) -- 0:00:46
266500 -- (-479.185) (-478.732) (-476.394) [-476.212] * [-477.945] (-475.153) (-478.010) (-478.400) -- 0:00:46
267000 -- (-476.368) [-476.601] (-476.648) (-478.008) * (-477.815) [-477.143] (-476.224) (-479.603) -- 0:00:46
267500 -- (-477.622) (-478.452) (-481.506) [-480.418] * (-478.746) [-478.409] (-477.118) (-479.490) -- 0:00:46
268000 -- (-477.572) [-478.113] (-478.681) (-476.454) * (-477.948) [-477.709] (-478.425) (-476.786) -- 0:00:46
268500 -- (-478.364) (-479.077) [-477.581] (-476.935) * [-479.195] (-477.215) (-477.836) (-478.080) -- 0:00:46
269000 -- (-480.736) (-481.102) (-478.342) [-477.582] * (-481.048) [-475.008] (-479.919) (-476.486) -- 0:00:46
269500 -- (-482.228) [-479.434] (-477.576) (-479.360) * [-477.428] (-479.852) (-478.487) (-476.498) -- 0:00:46
270000 -- (-479.976) (-476.388) [-477.457] (-479.879) * [-479.944] (-478.755) (-478.297) (-478.528) -- 0:00:45
Average standard deviation of split frequencies: 0.013523
270500 -- [-481.487] (-477.847) (-477.556) (-482.175) * (-479.290) (-478.720) [-477.474] (-478.068) -- 0:00:48
271000 -- (-479.069) [-479.100] (-481.582) (-483.244) * (-479.996) (-477.248) (-476.407) [-479.322] -- 0:00:48
271500 -- [-476.854] (-478.062) (-481.032) (-480.875) * (-482.454) (-479.110) (-476.358) [-477.191] -- 0:00:48
272000 -- (-478.571) (-483.095) (-483.468) [-480.999] * [-479.704] (-477.237) (-477.439) (-478.252) -- 0:00:48
272500 -- (-477.189) [-477.637] (-479.638) (-480.431) * (-479.015) (-476.231) (-477.286) [-478.741] -- 0:00:48
273000 -- (-479.059) (-479.551) (-479.126) [-478.183] * (-477.641) (-476.546) [-476.885] (-480.144) -- 0:00:47
273500 -- (-480.625) [-479.905] (-479.352) (-477.281) * (-477.634) [-477.819] (-484.496) (-480.058) -- 0:00:47
274000 -- (-479.222) [-478.218] (-479.100) (-478.523) * (-476.354) [-480.036] (-479.488) (-477.269) -- 0:00:47
274500 -- [-479.161] (-478.918) (-480.341) (-479.285) * (-482.590) (-480.540) [-479.276] (-480.438) -- 0:00:47
275000 -- (-481.321) [-479.722] (-479.204) (-479.135) * (-475.561) [-480.584] (-475.329) (-477.937) -- 0:00:47
Average standard deviation of split frequencies: 0.013362
275500 -- (-483.621) (-478.437) (-482.084) [-477.815] * (-479.389) [-475.704] (-477.166) (-481.271) -- 0:00:47
276000 -- (-478.808) (-479.546) (-478.508) [-475.853] * [-479.815] (-480.573) (-478.660) (-483.431) -- 0:00:47
276500 -- (-479.277) (-478.884) (-482.615) [-480.202] * [-475.985] (-476.386) (-477.939) (-479.571) -- 0:00:47
277000 -- (-479.011) (-478.672) (-482.867) [-479.050] * [-476.509] (-478.639) (-483.714) (-478.928) -- 0:00:46
277500 -- (-477.944) [-480.397] (-480.136) (-476.114) * (-475.823) (-480.975) [-480.203] (-482.534) -- 0:00:46
278000 -- (-478.565) (-477.298) (-479.715) [-481.692] * (-477.740) (-479.065) [-480.450] (-481.725) -- 0:00:46
278500 -- (-478.660) (-480.274) (-482.922) [-480.266] * (-477.964) (-479.559) [-479.849] (-487.573) -- 0:00:46
279000 -- [-478.795] (-475.274) (-482.620) (-479.317) * (-476.808) (-478.899) [-478.940] (-478.059) -- 0:00:46
279500 -- (-478.530) [-478.015] (-479.817) (-477.221) * [-477.443] (-479.989) (-480.910) (-478.623) -- 0:00:46
280000 -- (-479.398) [-479.358] (-485.385) (-477.139) * (-478.628) [-476.108] (-476.249) (-478.394) -- 0:00:46
Average standard deviation of split frequencies: 0.012844
280500 -- [-480.091] (-479.440) (-479.766) (-478.880) * (-476.894) (-479.379) (-478.162) [-478.186] -- 0:00:46
281000 -- (-478.176) [-478.039] (-481.504) (-474.503) * (-476.981) (-478.785) [-477.768] (-479.599) -- 0:00:46
281500 -- (-477.397) [-481.651] (-480.335) (-476.506) * [-477.844] (-481.404) (-478.389) (-479.198) -- 0:00:45
282000 -- (-480.360) (-478.051) (-477.069) [-477.153] * [-476.697] (-477.024) (-477.546) (-479.646) -- 0:00:45
282500 -- (-479.212) (-478.180) (-477.231) [-475.278] * (-479.727) [-478.390] (-479.838) (-478.741) -- 0:00:45
283000 -- (-478.901) (-477.119) [-478.404] (-478.279) * (-478.378) (-479.890) (-479.520) [-476.912] -- 0:00:45
283500 -- [-477.950] (-478.350) (-477.106) (-478.862) * (-478.230) (-479.714) (-478.417) [-478.275] -- 0:00:45
284000 -- [-480.198] (-478.215) (-477.298) (-478.520) * (-480.349) (-478.763) [-477.775] (-478.971) -- 0:00:45
284500 -- (-483.640) (-477.237) [-476.945] (-476.002) * [-478.190] (-479.151) (-480.127) (-479.319) -- 0:00:45
285000 -- (-476.607) (-478.810) (-480.159) [-480.253] * (-477.928) (-480.046) (-477.336) [-476.796] -- 0:00:45
Average standard deviation of split frequencies: 0.013644
285500 -- (-478.842) (-475.146) [-477.712] (-480.248) * [-476.043] (-480.707) (-482.853) (-480.534) -- 0:00:45
286000 -- [-478.019] (-477.511) (-477.038) (-484.197) * (-476.761) [-478.328] (-479.744) (-481.363) -- 0:00:44
286500 -- (-477.438) (-478.294) (-478.927) [-479.084] * (-480.114) (-477.699) (-480.473) [-478.063] -- 0:00:47
287000 -- (-475.462) (-476.793) (-482.131) [-481.313] * (-480.044) (-477.814) (-483.874) [-478.960] -- 0:00:47
287500 -- (-479.582) [-478.895] (-478.881) (-479.557) * [-477.380] (-477.674) (-484.505) (-478.377) -- 0:00:47
288000 -- (-478.335) [-477.162] (-480.758) (-478.902) * (-478.413) [-475.282] (-478.887) (-477.577) -- 0:00:46
288500 -- [-479.896] (-478.724) (-477.861) (-476.549) * (-478.218) [-478.387] (-482.188) (-478.624) -- 0:00:46
289000 -- [-478.099] (-478.577) (-477.810) (-477.499) * (-481.481) [-476.573] (-485.382) (-481.009) -- 0:00:46
289500 -- (-478.991) (-478.059) [-478.986] (-479.742) * [-478.328] (-476.256) (-477.918) (-480.253) -- 0:00:46
290000 -- [-477.297] (-480.040) (-478.461) (-479.956) * [-477.598] (-480.854) (-478.322) (-480.210) -- 0:00:46
Average standard deviation of split frequencies: 0.012879
290500 -- (-480.684) (-478.103) [-478.317] (-480.025) * [-479.228] (-477.148) (-486.014) (-481.247) -- 0:00:46
291000 -- (-476.103) (-476.141) (-477.264) [-478.726] * (-483.914) (-481.102) [-477.916] (-476.763) -- 0:00:46
291500 -- (-482.468) (-479.067) [-478.701] (-479.333) * (-480.769) [-477.530] (-478.636) (-477.399) -- 0:00:46
292000 -- (-478.540) [-479.555] (-477.493) (-474.798) * (-477.600) (-480.804) [-476.136] (-480.262) -- 0:00:46
292500 -- (-476.273) (-477.549) (-486.582) [-475.427] * (-477.395) [-475.832] (-477.220) (-477.140) -- 0:00:45
293000 -- [-477.642] (-475.527) (-478.016) (-486.234) * [-477.959] (-480.608) (-476.417) (-480.626) -- 0:00:45
293500 -- (-480.967) (-476.108) (-479.008) [-478.567] * (-479.812) [-476.130] (-478.620) (-479.782) -- 0:00:45
294000 -- (-476.488) [-480.128] (-477.211) (-477.234) * (-479.531) (-478.844) [-478.797] (-481.388) -- 0:00:45
294500 -- (-480.107) (-477.477) (-476.732) [-478.485] * (-478.951) (-476.348) [-478.434] (-481.241) -- 0:00:45
295000 -- (-476.946) [-478.977] (-482.842) (-474.636) * (-479.397) [-477.042] (-479.124) (-477.226) -- 0:00:45
Average standard deviation of split frequencies: 0.012647
295500 -- (-476.394) (-481.281) (-480.583) [-477.633] * (-479.809) (-476.524) (-478.093) [-480.904] -- 0:00:45
296000 -- (-478.395) [-479.353] (-481.907) (-477.533) * [-482.080] (-476.892) (-484.159) (-479.129) -- 0:00:45
296500 -- (-479.422) (-480.793) [-480.561] (-479.730) * (-477.592) (-476.475) (-478.474) [-483.122] -- 0:00:45
297000 -- [-478.169] (-475.094) (-480.149) (-477.682) * (-478.028) (-475.967) [-478.979] (-479.512) -- 0:00:44
297500 -- (-475.878) (-477.793) (-487.964) [-476.393] * (-477.588) (-478.079) [-476.049] (-477.931) -- 0:00:44
298000 -- (-481.496) (-476.577) (-477.259) [-476.064] * (-480.326) (-476.459) [-478.300] (-479.994) -- 0:00:44
298500 -- (-485.441) (-479.068) [-481.364] (-479.076) * (-476.205) (-481.357) (-479.320) [-476.776] -- 0:00:44
299000 -- (-477.569) (-478.526) (-481.493) [-475.462] * (-478.113) [-475.829] (-479.723) (-477.647) -- 0:00:44
299500 -- (-478.908) [-481.306] (-478.771) (-477.187) * (-479.346) (-478.473) [-479.459] (-475.347) -- 0:00:44
300000 -- (-479.966) (-478.159) (-481.069) [-476.872] * [-476.703] (-481.253) (-480.174) (-476.317) -- 0:00:44
Average standard deviation of split frequencies: 0.012266
300500 -- (-478.434) [-477.045] (-478.453) (-476.826) * (-476.944) [-480.568] (-482.781) (-481.703) -- 0:00:46
301000 -- [-478.112] (-477.081) (-478.283) (-480.954) * [-479.080] (-479.908) (-482.009) (-477.478) -- 0:00:46
301500 -- (-477.224) (-478.869) (-478.598) [-477.418] * (-479.338) (-477.367) [-477.631] (-479.125) -- 0:00:46
302000 -- [-477.096] (-476.282) (-478.005) (-479.273) * (-478.488) (-479.657) [-478.816] (-480.796) -- 0:00:46
302500 -- (-478.185) [-479.105] (-479.513) (-479.511) * (-483.783) (-481.480) (-477.348) [-475.341] -- 0:00:46
303000 -- (-476.843) (-477.717) (-479.501) [-476.973] * [-477.846] (-480.673) (-477.492) (-480.901) -- 0:00:46
303500 -- (-479.714) (-478.389) [-477.120] (-477.721) * (-479.529) (-477.516) (-478.430) [-479.249] -- 0:00:45
304000 -- (-476.558) [-478.353] (-475.723) (-478.492) * (-481.231) (-478.676) [-483.088] (-479.184) -- 0:00:45
304500 -- (-475.436) [-478.600] (-477.680) (-483.333) * (-480.127) (-481.242) [-478.712] (-478.241) -- 0:00:45
305000 -- [-478.515] (-480.141) (-475.509) (-482.201) * (-478.617) (-478.580) (-482.133) [-480.950] -- 0:00:45
Average standard deviation of split frequencies: 0.012234
305500 -- (-478.406) [-478.362] (-478.360) (-486.964) * (-480.059) (-477.434) [-478.091] (-479.831) -- 0:00:45
306000 -- (-476.650) [-476.245] (-479.658) (-480.196) * (-475.918) [-479.288] (-477.115) (-477.678) -- 0:00:45
306500 -- (-477.830) [-479.068] (-483.456) (-476.665) * [-477.635] (-475.256) (-477.085) (-478.129) -- 0:00:45
307000 -- [-477.287] (-477.517) (-478.294) (-482.466) * [-483.624] (-475.830) (-482.848) (-478.078) -- 0:00:45
307500 -- (-475.115) (-482.913) [-476.816] (-476.423) * (-480.429) [-476.376] (-479.197) (-483.780) -- 0:00:45
308000 -- (-480.677) (-480.475) [-478.272] (-479.092) * (-480.796) (-479.777) (-478.994) [-477.432] -- 0:00:44
308500 -- [-482.138] (-480.398) (-477.013) (-478.307) * [-476.031] (-479.052) (-478.954) (-480.087) -- 0:00:44
309000 -- (-477.213) (-480.043) [-477.297] (-478.035) * (-477.045) (-477.867) [-476.654] (-480.165) -- 0:00:44
309500 -- [-477.735] (-479.622) (-475.564) (-476.525) * (-478.099) (-477.806) [-477.023] (-478.949) -- 0:00:44
310000 -- (-479.401) [-477.249] (-479.069) (-479.552) * (-476.734) (-476.381) (-476.723) [-479.770] -- 0:00:44
Average standard deviation of split frequencies: 0.013572
310500 -- [-478.944] (-481.002) (-476.473) (-478.241) * (-477.151) (-477.049) [-477.249] (-481.077) -- 0:00:44
311000 -- [-475.607] (-477.992) (-478.370) (-478.087) * (-482.015) (-481.101) [-477.979] (-479.987) -- 0:00:44
311500 -- [-478.255] (-480.268) (-480.271) (-478.517) * [-476.938] (-477.673) (-477.298) (-481.034) -- 0:00:44
312000 -- [-476.172] (-478.127) (-476.463) (-477.016) * (-486.473) (-477.344) [-476.686] (-485.091) -- 0:00:44
312500 -- (-480.904) (-477.252) [-476.059] (-478.378) * (-485.309) (-477.479) (-483.192) [-477.907] -- 0:00:44
313000 -- (-476.888) [-476.997] (-479.200) (-476.658) * (-476.379) [-477.611] (-474.579) (-479.233) -- 0:00:43
313500 -- (-481.800) [-479.290] (-486.730) (-479.463) * (-474.652) (-476.928) [-477.810] (-476.433) -- 0:00:43
314000 -- (-477.794) [-478.396] (-482.825) (-482.189) * (-477.014) [-475.975] (-478.370) (-477.019) -- 0:00:43
314500 -- (-483.060) (-477.571) [-483.707] (-476.798) * (-476.373) (-477.785) [-475.760] (-478.835) -- 0:00:43
315000 -- [-480.094] (-478.113) (-479.012) (-478.669) * [-480.134] (-477.498) (-475.562) (-483.331) -- 0:00:43
Average standard deviation of split frequencies: 0.013075
315500 -- (-478.644) (-480.084) (-478.800) [-475.832] * (-483.848) (-477.118) [-477.984] (-477.995) -- 0:00:43
316000 -- (-482.007) [-478.083] (-475.107) (-480.194) * (-478.059) (-478.652) [-480.505] (-478.214) -- 0:00:45
316500 -- (-479.628) (-478.037) [-474.741] (-480.260) * (-480.341) [-475.880] (-478.587) (-478.101) -- 0:00:45
317000 -- [-477.312] (-476.772) (-476.673) (-478.712) * (-477.081) [-477.540] (-480.058) (-476.833) -- 0:00:45
317500 -- (-475.579) (-476.495) [-478.142] (-477.234) * (-478.370) (-478.347) [-479.185] (-477.756) -- 0:00:45
318000 -- (-478.522) (-476.178) (-477.160) [-479.493] * (-478.259) [-478.689] (-481.481) (-479.844) -- 0:00:45
318500 -- (-482.661) (-476.489) [-479.655] (-485.505) * [-477.558] (-480.077) (-483.179) (-479.320) -- 0:00:44
319000 -- (-481.253) [-475.774] (-481.092) (-479.293) * (-476.952) (-476.756) (-480.032) [-478.760] -- 0:00:44
319500 -- (-482.003) [-475.536] (-477.967) (-476.931) * (-478.220) (-479.809) (-479.977) [-478.261] -- 0:00:44
320000 -- [-476.390] (-478.709) (-476.672) (-482.639) * [-477.834] (-478.148) (-479.641) (-482.240) -- 0:00:44
Average standard deviation of split frequencies: 0.013577
320500 -- (-477.721) [-478.455] (-476.055) (-479.561) * [-476.921] (-482.455) (-476.637) (-483.483) -- 0:00:44
321000 -- (-479.652) [-476.828] (-479.539) (-482.160) * [-478.089] (-484.829) (-476.273) (-480.757) -- 0:00:44
321500 -- (-477.824) [-477.347] (-478.383) (-478.758) * (-479.329) (-479.632) (-476.493) [-479.766] -- 0:00:44
322000 -- [-479.142] (-480.402) (-479.516) (-480.459) * (-480.861) (-479.836) [-475.844] (-480.473) -- 0:00:44
322500 -- (-477.702) (-480.355) [-476.013] (-476.424) * (-480.424) (-479.423) [-477.539] (-480.387) -- 0:00:44
323000 -- (-478.436) [-477.652] (-478.266) (-478.325) * [-479.667] (-480.924) (-480.625) (-479.413) -- 0:00:44
323500 -- [-476.487] (-476.570) (-476.172) (-478.100) * (-478.741) (-480.955) [-477.423] (-479.700) -- 0:00:43
324000 -- (-476.505) (-478.843) (-478.142) [-477.140] * (-476.267) [-478.976] (-476.887) (-477.300) -- 0:00:43
324500 -- (-477.617) (-475.693) (-478.235) [-476.976] * (-481.610) [-479.109] (-477.209) (-478.426) -- 0:00:43
325000 -- (-479.641) [-476.184] (-480.202) (-478.860) * (-477.959) (-479.063) [-479.400] (-478.584) -- 0:00:43
Average standard deviation of split frequencies: 0.013577
325500 -- [-476.837] (-478.301) (-480.915) (-477.664) * [-476.776] (-480.521) (-477.753) (-481.521) -- 0:00:43
326000 -- [-478.002] (-477.985) (-478.211) (-480.249) * (-479.688) (-479.521) [-477.029] (-479.801) -- 0:00:43
326500 -- [-480.755] (-483.755) (-482.552) (-479.442) * (-480.880) (-477.982) [-479.076] (-485.024) -- 0:00:43
327000 -- (-477.781) [-477.440] (-475.958) (-478.340) * (-476.903) [-478.458] (-478.037) (-478.239) -- 0:00:43
327500 -- (-478.544) (-477.104) (-478.954) [-478.520] * (-477.713) (-481.767) (-479.363) [-478.632] -- 0:00:43
328000 -- [-475.970] (-484.015) (-480.966) (-479.536) * (-477.462) (-479.369) (-477.473) [-477.259] -- 0:00:43
328500 -- (-475.574) (-477.778) [-477.158] (-477.315) * (-479.098) [-482.913] (-477.173) (-477.687) -- 0:00:42
329000 -- (-478.571) (-482.396) (-477.713) [-476.829] * (-480.676) (-478.875) [-475.394] (-478.953) -- 0:00:42
329500 -- (-476.764) (-479.344) [-476.670] (-480.573) * (-479.353) (-481.046) [-475.204] (-485.449) -- 0:00:42
330000 -- (-478.398) (-478.696) (-476.386) [-477.462] * [-476.989] (-480.294) (-476.770) (-480.082) -- 0:00:42
Average standard deviation of split frequencies: 0.013939
330500 -- [-477.151] (-480.144) (-480.433) (-476.022) * [-476.887] (-479.302) (-477.692) (-479.189) -- 0:00:42
331000 -- (-478.924) (-479.569) (-478.333) [-479.574] * [-479.455] (-480.261) (-476.069) (-480.720) -- 0:00:42
331500 -- (-478.852) (-477.623) [-482.584] (-478.548) * (-476.672) (-478.520) [-478.794] (-480.205) -- 0:00:42
332000 -- (-481.200) [-479.069] (-478.491) (-481.223) * [-477.274] (-476.053) (-478.980) (-477.177) -- 0:00:44
332500 -- (-477.792) (-477.010) (-480.649) [-478.001] * [-479.126] (-480.515) (-477.224) (-478.954) -- 0:00:44
333000 -- [-476.364] (-476.229) (-478.182) (-477.024) * (-476.042) (-480.753) (-478.075) [-480.000] -- 0:00:44
333500 -- (-475.380) [-477.559] (-478.769) (-476.028) * (-478.579) (-479.082) (-480.119) [-477.712] -- 0:00:43
334000 -- (-480.139) [-478.451] (-477.634) (-477.407) * [-477.802] (-478.691) (-482.073) (-480.486) -- 0:00:43
334500 -- (-476.473) (-479.015) [-478.671] (-478.171) * (-477.889) (-479.522) (-479.623) [-479.311] -- 0:00:43
335000 -- (-476.788) (-476.344) [-478.563] (-477.562) * (-478.425) (-479.995) [-478.255] (-478.736) -- 0:00:43
Average standard deviation of split frequencies: 0.013040
335500 -- (-477.080) [-476.937] (-480.067) (-477.404) * [-477.102] (-478.068) (-480.734) (-478.139) -- 0:00:43
336000 -- (-481.576) (-478.589) (-478.763) [-481.708] * (-476.770) (-479.042) (-476.959) [-479.282] -- 0:00:43
336500 -- [-478.045] (-479.893) (-480.382) (-477.712) * [-476.799] (-478.501) (-477.765) (-477.374) -- 0:00:43
337000 -- (-476.470) [-478.622] (-481.164) (-476.439) * (-480.110) [-478.258] (-478.525) (-478.245) -- 0:00:43
337500 -- (-478.242) (-478.105) [-476.860] (-477.672) * (-475.770) (-479.397) (-478.686) [-478.772] -- 0:00:43
338000 -- [-477.364] (-478.160) (-476.910) (-476.501) * (-476.785) (-478.618) [-478.167] (-480.050) -- 0:00:43
338500 -- (-478.788) (-481.706) (-482.234) [-475.662] * [-479.951] (-477.869) (-480.341) (-481.072) -- 0:00:42
339000 -- (-482.133) [-477.468] (-481.443) (-480.149) * (-477.672) [-479.093] (-478.988) (-477.615) -- 0:00:42
339500 -- (-476.477) [-476.850] (-477.001) (-480.720) * [-477.058] (-478.493) (-484.141) (-477.626) -- 0:00:42
340000 -- (-480.873) (-478.010) [-477.189] (-479.039) * [-476.993] (-479.131) (-480.687) (-475.867) -- 0:00:42
Average standard deviation of split frequencies: 0.012535
340500 -- [-479.117] (-480.164) (-478.346) (-478.067) * [-476.405] (-480.535) (-477.914) (-477.500) -- 0:00:42
341000 -- (-476.605) (-476.986) (-476.766) [-477.159] * (-479.723) (-478.635) [-476.824] (-476.381) -- 0:00:42
341500 -- (-477.280) [-478.026] (-477.976) (-475.128) * (-485.910) [-483.294] (-479.223) (-478.378) -- 0:00:42
342000 -- [-476.764] (-481.951) (-479.710) (-477.877) * (-478.256) (-482.607) (-478.037) [-479.342] -- 0:00:42
342500 -- [-479.039] (-478.310) (-480.282) (-478.839) * (-479.225) (-478.465) [-477.543] (-480.033) -- 0:00:42
343000 -- (-479.222) (-476.927) [-479.160] (-478.440) * (-477.615) [-477.393] (-478.575) (-483.406) -- 0:00:42
343500 -- (-479.896) (-477.230) [-478.618] (-478.359) * (-477.624) (-478.101) (-479.950) [-477.422] -- 0:00:42
344000 -- (-478.348) (-476.043) (-477.894) [-477.620] * (-477.541) (-479.141) (-477.911) [-476.592] -- 0:00:41
344500 -- (-478.923) (-479.276) [-479.590] (-478.664) * (-474.933) (-478.021) [-478.402] (-477.795) -- 0:00:41
345000 -- (-477.356) [-477.851] (-482.071) (-481.910) * (-479.250) (-481.728) (-481.025) [-478.923] -- 0:00:41
Average standard deviation of split frequencies: 0.011941
345500 -- (-481.139) (-477.435) [-475.818] (-479.267) * [-476.566] (-477.772) (-475.727) (-477.626) -- 0:00:41
346000 -- (-478.998) (-480.626) (-477.992) [-476.302] * (-476.630) [-477.596] (-483.201) (-478.650) -- 0:00:41
346500 -- (-477.784) (-479.477) [-478.032] (-481.318) * (-478.025) (-478.008) [-479.594] (-480.452) -- 0:00:41
347000 -- (-479.942) (-480.356) (-478.145) [-478.063] * (-478.367) (-479.279) [-482.675] (-477.220) -- 0:00:41
347500 -- (-479.016) [-479.242] (-478.585) (-478.282) * (-476.220) (-483.023) [-478.563] (-479.712) -- 0:00:41
348000 -- [-479.610] (-479.029) (-479.444) (-476.155) * (-479.592) (-483.853) [-475.464] (-477.243) -- 0:00:43
348500 -- (-478.856) (-480.809) (-478.719) [-479.673] * [-478.215] (-479.688) (-478.564) (-479.974) -- 0:00:42
349000 -- (-479.003) (-481.757) [-476.874] (-479.866) * (-478.190) [-478.521] (-476.485) (-475.012) -- 0:00:42
349500 -- (-477.324) [-475.310] (-478.044) (-482.045) * (-477.814) (-478.799) (-478.574) [-478.575] -- 0:00:42
350000 -- (-478.340) [-477.038] (-477.067) (-479.294) * (-481.065) [-479.597] (-476.724) (-477.518) -- 0:00:42
Average standard deviation of split frequencies: 0.010596
350500 -- (-477.143) (-477.726) (-479.175) [-479.102] * (-478.311) [-479.852] (-477.201) (-478.010) -- 0:00:42
351000 -- [-475.756] (-476.945) (-482.159) (-478.783) * (-476.774) (-484.177) (-480.914) [-480.636] -- 0:00:42
351500 -- [-478.400] (-477.916) (-477.118) (-478.871) * (-479.247) [-477.777] (-477.670) (-478.904) -- 0:00:42
352000 -- [-479.716] (-479.372) (-479.764) (-481.362) * (-477.217) [-477.178] (-477.651) (-477.692) -- 0:00:42
352500 -- (-480.069) [-479.389] (-480.330) (-480.308) * (-479.845) (-478.686) (-476.421) [-476.681] -- 0:00:42
353000 -- [-479.816] (-479.640) (-478.162) (-482.630) * (-479.766) (-477.894) (-478.210) [-476.277] -- 0:00:42
353500 -- (-479.215) (-475.821) (-478.322) [-479.491] * (-478.265) [-480.904] (-475.593) (-478.150) -- 0:00:42
354000 -- (-476.683) (-477.024) [-476.746] (-479.858) * (-476.314) (-477.632) [-478.969] (-480.728) -- 0:00:41
354500 -- (-479.790) (-474.685) [-476.407] (-479.728) * [-480.116] (-482.063) (-478.059) (-477.839) -- 0:00:41
355000 -- (-481.231) (-478.948) [-486.925] (-479.397) * [-479.907] (-479.642) (-475.402) (-479.238) -- 0:00:41
Average standard deviation of split frequencies: 0.011995
355500 -- (-483.213) (-479.036) [-476.199] (-476.574) * (-477.841) (-480.648) [-475.510] (-480.920) -- 0:00:41
356000 -- [-477.747] (-479.916) (-477.876) (-477.566) * (-478.433) (-481.138) (-476.365) [-476.589] -- 0:00:41
356500 -- [-478.610] (-476.227) (-478.850) (-478.933) * (-479.269) (-480.745) [-480.356] (-480.158) -- 0:00:41
357000 -- (-478.852) [-479.039] (-479.454) (-478.276) * (-479.464) (-477.610) [-475.939] (-480.429) -- 0:00:41
357500 -- [-479.491] (-480.104) (-477.691) (-481.251) * (-479.093) [-478.924] (-477.199) (-482.155) -- 0:00:41
358000 -- (-479.097) [-482.609] (-479.131) (-478.177) * (-480.820) [-478.322] (-476.894) (-484.721) -- 0:00:41
358500 -- [-481.281] (-480.393) (-480.419) (-477.241) * [-478.702] (-479.852) (-478.661) (-481.198) -- 0:00:41
359000 -- (-481.082) (-478.900) [-477.705] (-478.673) * [-480.532] (-477.275) (-476.520) (-485.053) -- 0:00:41
359500 -- (-480.025) (-478.666) [-480.505] (-478.927) * (-477.776) [-476.750] (-478.220) (-485.606) -- 0:00:40
360000 -- (-478.686) (-479.012) [-477.579] (-478.580) * (-480.004) (-478.326) [-475.486] (-479.480) -- 0:00:40
Average standard deviation of split frequencies: 0.012071
360500 -- (-486.809) [-476.931] (-477.377) (-478.976) * (-479.360) [-483.598] (-476.579) (-476.935) -- 0:00:40
361000 -- (-481.831) (-483.728) [-482.704] (-480.655) * (-481.211) (-477.971) (-476.069) [-478.232] -- 0:00:40
361500 -- [-476.217] (-480.335) (-480.466) (-481.108) * (-479.341) (-479.757) (-478.796) [-478.370] -- 0:00:40
362000 -- (-477.163) (-480.817) (-478.794) [-478.380] * (-478.137) [-479.492] (-477.007) (-475.670) -- 0:00:40
362500 -- (-478.096) (-484.002) (-477.887) [-479.166] * [-479.981] (-481.172) (-477.027) (-481.908) -- 0:00:40
363000 -- (-479.636) [-476.580] (-481.020) (-482.170) * (-481.744) (-478.654) [-478.976] (-476.665) -- 0:00:40
363500 -- (-478.568) [-477.539] (-477.944) (-481.396) * (-478.933) [-479.385] (-476.295) (-482.981) -- 0:00:40
364000 -- [-478.124] (-478.860) (-479.130) (-478.769) * (-479.430) (-478.645) [-477.218] (-485.728) -- 0:00:41
364500 -- (-476.295) [-476.876] (-481.968) (-478.462) * (-479.986) [-481.120] (-482.328) (-478.200) -- 0:00:41
365000 -- [-479.663] (-478.944) (-478.651) (-481.024) * (-480.689) (-479.760) [-476.513] (-476.981) -- 0:00:41
Average standard deviation of split frequencies: 0.011520
365500 -- (-476.531) (-478.297) (-477.645) [-478.996] * [-479.008] (-476.531) (-478.775) (-477.736) -- 0:00:41
366000 -- (-480.696) (-476.840) [-477.353] (-480.617) * (-476.511) [-476.341] (-478.104) (-477.206) -- 0:00:41
366500 -- (-477.597) (-476.162) [-478.144] (-478.574) * (-478.246) (-479.015) (-476.289) [-476.795] -- 0:00:41
367000 -- (-478.642) (-475.906) (-475.458) [-475.480] * (-481.275) [-480.890] (-479.078) (-475.259) -- 0:00:41
367500 -- (-476.338) (-480.947) (-479.052) [-481.476] * [-480.933] (-485.455) (-478.573) (-477.121) -- 0:00:41
368000 -- [-475.730] (-476.024) (-482.234) (-477.445) * (-480.128) (-480.720) (-478.873) [-478.069] -- 0:00:41
368500 -- (-480.649) (-476.275) (-478.262) [-475.238] * (-481.948) (-483.597) [-478.861] (-477.454) -- 0:00:41
369000 -- (-486.371) (-479.327) (-478.785) [-477.957] * (-476.919) (-478.714) (-477.458) [-478.003] -- 0:00:41
369500 -- (-482.419) (-477.344) (-476.777) [-477.296] * [-478.340] (-480.125) (-481.927) (-481.353) -- 0:00:40
370000 -- (-478.369) (-476.328) (-477.943) [-477.929] * (-479.022) [-478.494] (-479.814) (-475.288) -- 0:00:40
Average standard deviation of split frequencies: 0.011371
370500 -- (-478.697) (-475.484) [-480.074] (-478.556) * [-484.144] (-479.530) (-483.135) (-478.186) -- 0:00:40
371000 -- (-477.993) [-478.029] (-478.479) (-478.213) * (-482.095) (-480.786) (-478.694) [-475.077] -- 0:00:40
371500 -- (-475.645) (-477.295) (-477.657) [-475.976] * [-480.195] (-481.318) (-477.355) (-475.596) -- 0:00:40
372000 -- (-481.944) [-478.216] (-484.290) (-475.529) * (-486.125) (-481.784) (-475.100) [-477.166] -- 0:00:40
372500 -- (-477.034) [-477.174] (-477.353) (-476.149) * [-482.577] (-480.431) (-476.132) (-477.693) -- 0:00:40
373000 -- (-476.145) (-479.531) [-481.194] (-476.405) * (-482.927) (-477.515) [-478.070] (-481.950) -- 0:00:40
373500 -- (-478.442) [-476.891] (-478.476) (-478.316) * (-482.251) (-477.506) (-481.155) [-478.097] -- 0:00:40
374000 -- (-477.355) (-477.823) (-477.327) [-475.993] * (-481.329) (-481.709) [-478.564] (-476.009) -- 0:00:40
374500 -- (-476.179) (-475.840) [-476.713] (-478.516) * (-479.351) [-476.980] (-479.814) (-476.922) -- 0:00:40
375000 -- (-478.367) [-475.878] (-477.879) (-475.672) * (-478.509) (-479.302) [-480.364] (-476.724) -- 0:00:40
Average standard deviation of split frequencies: 0.010472
375500 -- (-478.191) [-475.158] (-479.744) (-480.004) * (-480.394) (-476.016) [-475.503] (-484.302) -- 0:00:39
376000 -- (-477.110) (-477.906) (-482.202) [-476.515] * (-482.461) (-478.188) (-478.854) [-481.034] -- 0:00:39
376500 -- (-478.176) (-480.583) [-477.244] (-477.831) * [-479.383] (-480.865) (-482.203) (-477.884) -- 0:00:39
377000 -- [-477.344] (-476.909) (-477.753) (-479.970) * (-477.977) (-478.809) (-480.441) [-476.362] -- 0:00:39
377500 -- (-477.075) (-476.191) (-475.549) [-477.367] * (-477.667) (-479.643) (-478.510) [-479.410] -- 0:00:39
378000 -- (-480.527) [-476.918] (-478.375) (-476.914) * (-480.017) (-479.938) (-477.400) [-478.182] -- 0:00:39
378500 -- (-477.886) (-476.261) [-481.083] (-476.270) * (-484.873) (-479.955) [-477.189] (-482.960) -- 0:00:39
379000 -- [-479.862] (-477.802) (-478.172) (-477.540) * (-479.628) [-480.929] (-478.509) (-480.705) -- 0:00:39
379500 -- (-479.447) [-476.078] (-475.543) (-478.236) * [-480.890] (-478.984) (-477.978) (-479.784) -- 0:00:39
380000 -- (-480.032) (-477.919) (-477.547) [-479.279] * (-479.047) (-476.502) [-476.468] (-482.266) -- 0:00:40
Average standard deviation of split frequencies: 0.009033
380500 -- [-478.720] (-477.413) (-481.491) (-477.719) * (-479.264) (-477.291) (-477.143) [-478.532] -- 0:00:40
381000 -- [-476.216] (-481.342) (-475.711) (-476.349) * (-477.128) (-477.773) [-477.898] (-478.313) -- 0:00:40
381500 -- (-483.513) (-477.496) [-476.528] (-478.713) * [-480.136] (-483.251) (-478.208) (-479.033) -- 0:00:40
382000 -- (-478.176) [-478.073] (-477.625) (-475.929) * (-478.613) [-479.687] (-485.286) (-477.930) -- 0:00:40
382500 -- (-477.759) [-479.474] (-476.059) (-481.150) * [-478.164] (-480.770) (-478.850) (-478.679) -- 0:00:40
383000 -- [-477.772] (-478.488) (-475.123) (-482.985) * (-479.570) [-477.966] (-480.367) (-483.367) -- 0:00:40
383500 -- (-476.870) (-475.944) (-480.234) [-479.309] * (-480.446) [-477.556] (-478.218) (-480.619) -- 0:00:40
384000 -- (-479.561) [-478.046] (-477.237) (-476.900) * (-482.592) (-478.233) [-478.388] (-478.276) -- 0:00:40
384500 -- [-476.283] (-478.435) (-477.559) (-476.581) * (-480.399) (-479.254) (-477.839) [-479.801] -- 0:00:40
385000 -- (-477.037) (-476.948) (-478.809) [-478.087] * (-478.107) (-479.915) (-477.544) [-476.531] -- 0:00:39
Average standard deviation of split frequencies: 0.008764
385500 -- (-477.522) [-476.991] (-476.554) (-476.137) * (-480.396) (-478.314) [-477.296] (-478.731) -- 0:00:39
386000 -- (-478.476) (-481.351) (-480.062) [-478.738] * (-482.715) (-481.357) [-475.498] (-479.932) -- 0:00:39
386500 -- [-476.685] (-475.600) (-481.311) (-479.458) * (-478.623) [-481.484] (-476.510) (-479.878) -- 0:00:39
387000 -- [-479.143] (-476.727) (-476.063) (-484.047) * (-478.399) (-476.011) [-478.274] (-477.929) -- 0:00:39
387500 -- (-481.397) [-477.565] (-477.462) (-477.603) * [-476.234] (-478.817) (-481.512) (-479.876) -- 0:00:39
388000 -- (-478.330) [-478.860] (-477.101) (-475.743) * [-476.702] (-477.374) (-477.668) (-479.772) -- 0:00:39
388500 -- (-479.138) [-479.890] (-477.805) (-478.935) * (-479.094) (-478.326) (-480.171) [-478.259] -- 0:00:39
389000 -- (-478.044) (-476.992) (-479.192) [-477.622] * (-477.022) (-478.888) (-482.475) [-478.135] -- 0:00:39
389500 -- (-482.234) (-478.509) [-478.809] (-481.775) * [-479.132] (-479.313) (-483.880) (-476.689) -- 0:00:39
390000 -- (-480.376) (-479.037) [-476.401] (-478.620) * (-475.914) [-479.227] (-481.586) (-481.580) -- 0:00:39
Average standard deviation of split frequencies: 0.008660
390500 -- [-476.968] (-477.743) (-480.236) (-478.654) * (-477.592) (-479.357) (-481.940) [-480.349] -- 0:00:39
391000 -- [-475.930] (-475.540) (-476.279) (-479.514) * (-477.996) (-482.104) (-477.795) [-478.373] -- 0:00:38
391500 -- [-475.579] (-478.638) (-475.692) (-478.092) * (-477.890) (-481.567) (-480.765) [-478.718] -- 0:00:38
392000 -- (-476.337) [-479.959] (-480.147) (-476.971) * [-476.855] (-479.461) (-484.134) (-476.163) -- 0:00:38
392500 -- (-475.027) [-476.558] (-477.834) (-479.244) * (-476.625) (-478.123) (-479.375) [-477.972] -- 0:00:38
393000 -- (-477.769) [-476.992] (-478.871) (-479.153) * (-478.851) (-480.560) (-479.286) [-478.164] -- 0:00:38
393500 -- (-477.093) (-480.713) [-475.670] (-479.395) * (-481.427) (-479.993) [-477.578] (-476.826) -- 0:00:38
394000 -- (-479.233) (-479.071) [-476.488] (-477.967) * (-479.941) (-476.968) [-476.383] (-479.962) -- 0:00:38
394500 -- (-479.825) [-476.869] (-482.657) (-478.984) * (-480.677) [-476.153] (-476.873) (-477.186) -- 0:00:38
395000 -- (-479.372) (-480.212) (-479.064) [-476.694] * (-477.359) (-479.469) (-475.439) [-479.892] -- 0:00:38
Average standard deviation of split frequencies: 0.008779
395500 -- (-478.091) (-480.472) (-475.337) [-478.159] * (-477.948) (-483.822) (-476.453) [-477.113] -- 0:00:39
396000 -- (-479.892) (-477.091) (-480.349) [-479.332] * [-476.046] (-487.241) (-479.157) (-477.003) -- 0:00:39
396500 -- (-479.383) (-479.276) (-484.840) [-478.995] * [-476.214] (-479.869) (-480.511) (-476.383) -- 0:00:39
397000 -- [-478.527] (-482.336) (-477.425) (-477.154) * (-480.038) (-477.468) [-477.464] (-480.227) -- 0:00:39
397500 -- (-477.122) (-480.302) [-477.973] (-482.090) * (-478.446) (-478.810) [-477.810] (-479.972) -- 0:00:39
398000 -- (-479.307) (-480.350) (-477.703) [-480.701] * (-478.938) [-479.341] (-477.305) (-477.153) -- 0:00:39
398500 -- (-480.057) (-479.562) (-478.204) [-478.948] * (-477.877) (-479.129) (-476.597) [-478.690] -- 0:00:39
399000 -- (-480.904) (-479.206) [-481.296] (-478.763) * (-476.584) [-480.405] (-478.677) (-484.127) -- 0:00:39
399500 -- [-478.216] (-479.587) (-478.590) (-482.577) * (-476.303) (-479.852) [-478.631] (-480.613) -- 0:00:39
400000 -- [-476.634] (-478.815) (-478.958) (-478.534) * (-476.082) (-478.610) [-479.646] (-480.182) -- 0:00:39
Average standard deviation of split frequencies: 0.007868
400500 -- [-477.779] (-477.454) (-479.872) (-475.887) * (-482.262) [-476.851] (-476.808) (-481.246) -- 0:00:38
401000 -- (-478.773) (-478.420) [-477.590] (-478.539) * (-479.076) [-477.541] (-476.768) (-478.155) -- 0:00:38
401500 -- (-479.340) [-477.090] (-478.645) (-475.241) * [-478.271] (-476.773) (-477.468) (-480.166) -- 0:00:38
402000 -- (-477.173) (-476.435) [-478.266] (-474.673) * (-476.980) [-476.129] (-478.479) (-480.650) -- 0:00:38
402500 -- (-476.624) (-484.194) (-476.905) [-477.117] * (-478.550) (-477.554) [-476.552] (-479.041) -- 0:00:38
403000 -- (-477.599) (-480.041) (-476.394) [-476.557] * [-477.588] (-477.274) (-478.172) (-478.998) -- 0:00:38
403500 -- (-481.354) [-476.787] (-478.086) (-482.745) * (-477.502) (-479.730) [-477.039] (-477.693) -- 0:00:38
404000 -- (-478.688) (-476.388) [-476.140] (-478.328) * (-478.325) [-476.911] (-486.594) (-479.486) -- 0:00:38
404500 -- (-477.329) [-479.739] (-478.011) (-476.414) * (-479.427) (-479.016) (-477.611) [-479.275] -- 0:00:38
405000 -- (-477.661) (-480.252) [-476.013] (-478.094) * [-478.978] (-474.905) (-479.783) (-481.349) -- 0:00:38
Average standard deviation of split frequencies: 0.008563
405500 -- (-477.396) (-481.180) [-478.304] (-477.472) * [-479.709] (-476.162) (-478.551) (-483.850) -- 0:00:38
406000 -- (-478.519) [-476.295] (-478.135) (-478.756) * (-480.575) (-479.227) [-476.673] (-483.095) -- 0:00:38
406500 -- (-481.685) [-478.083] (-480.692) (-479.023) * (-479.949) [-478.627] (-478.810) (-478.548) -- 0:00:37
407000 -- (-480.544) (-476.089) (-479.114) [-477.341] * (-478.921) [-480.202] (-474.726) (-476.685) -- 0:00:37
407500 -- (-480.272) (-478.735) [-479.001] (-478.555) * [-479.609] (-476.704) (-475.596) (-478.706) -- 0:00:37
408000 -- (-479.065) (-479.589) (-480.482) [-478.518] * (-481.402) (-479.116) [-475.854] (-479.807) -- 0:00:37
408500 -- (-478.365) [-478.904] (-479.896) (-477.421) * (-479.301) (-477.626) [-482.028] (-480.041) -- 0:00:37
409000 -- (-476.481) (-478.819) (-475.681) [-480.753] * (-482.365) (-476.021) (-479.870) [-478.277] -- 0:00:37
409500 -- (-475.828) [-479.488] (-477.855) (-478.973) * (-478.691) (-476.775) (-478.856) [-479.245] -- 0:00:37
410000 -- (-479.655) [-477.604] (-478.471) (-475.071) * (-480.372) (-478.394) (-478.339) [-479.056] -- 0:00:37
Average standard deviation of split frequencies: 0.009386
410500 -- (-478.953) (-480.646) [-477.519] (-478.027) * (-477.548) [-479.171] (-480.359) (-478.236) -- 0:00:37
411000 -- (-476.100) (-481.175) [-478.415] (-479.928) * [-480.080] (-479.700) (-477.523) (-477.973) -- 0:00:37
411500 -- (-477.025) [-478.413] (-475.837) (-476.575) * (-482.085) (-479.494) [-476.470] (-475.932) -- 0:00:38
412000 -- (-478.069) (-477.562) [-474.782] (-476.947) * (-478.160) [-478.904] (-478.268) (-477.622) -- 0:00:38
412500 -- (-476.662) (-480.711) [-475.108] (-477.648) * (-479.447) (-482.198) (-481.452) [-479.111] -- 0:00:38
413000 -- (-477.695) (-480.684) (-475.860) [-477.934] * (-476.961) (-477.948) [-477.908] (-479.954) -- 0:00:38
413500 -- (-477.496) (-479.550) (-475.483) [-477.761] * (-476.177) (-480.716) [-478.101] (-483.364) -- 0:00:38
414000 -- (-478.376) (-479.153) (-479.051) [-476.294] * (-478.589) [-478.175] (-477.019) (-480.181) -- 0:00:38
414500 -- (-477.706) (-481.771) (-478.991) [-478.173] * (-478.563) (-481.987) (-474.959) [-476.118] -- 0:00:38
415000 -- (-478.665) [-479.842] (-477.946) (-479.131) * (-481.253) [-481.076] (-478.390) (-477.735) -- 0:00:38
Average standard deviation of split frequencies: 0.009065
415500 -- (-478.099) (-478.252) (-482.072) [-477.930] * [-479.131] (-476.679) (-480.734) (-478.528) -- 0:00:37
416000 -- [-477.850] (-478.566) (-480.502) (-481.457) * (-476.771) [-477.090] (-479.048) (-475.132) -- 0:00:37
416500 -- (-476.435) (-478.597) [-477.210] (-481.874) * (-479.838) (-479.166) [-480.552] (-476.231) -- 0:00:37
417000 -- (-477.059) [-480.767] (-475.325) (-478.502) * (-480.369) (-478.302) [-476.354] (-480.538) -- 0:00:37
417500 -- (-478.095) (-476.805) (-476.377) [-476.318] * (-479.278) [-475.693] (-479.372) (-479.025) -- 0:00:37
418000 -- [-478.978] (-478.210) (-477.006) (-481.408) * (-477.169) (-480.160) (-481.436) [-479.934] -- 0:00:37
418500 -- (-479.613) (-483.399) (-476.752) [-480.956] * (-478.055) [-477.723] (-478.500) (-479.793) -- 0:00:37
419000 -- (-478.276) (-484.119) (-481.262) [-481.227] * [-478.134] (-477.691) (-479.197) (-482.436) -- 0:00:37
419500 -- (-476.079) (-479.057) (-478.602) [-476.157] * (-479.343) [-478.434] (-481.359) (-478.417) -- 0:00:37
420000 -- (-478.399) (-479.990) (-478.177) [-476.320] * (-476.690) (-482.655) (-478.071) [-477.530] -- 0:00:37
Average standard deviation of split frequencies: 0.008475
420500 -- [-477.423] (-479.777) (-476.193) (-478.754) * [-478.082] (-482.970) (-477.423) (-478.657) -- 0:00:37
421000 -- (-478.983) [-478.503] (-479.124) (-478.255) * (-477.364) [-478.536] (-478.233) (-480.504) -- 0:00:37
421500 -- (-477.086) [-478.775] (-479.976) (-478.680) * [-480.934] (-479.503) (-479.722) (-478.681) -- 0:00:37
422000 -- (-476.803) (-479.319) (-481.984) [-478.730] * [-475.926] (-482.894) (-478.971) (-479.246) -- 0:00:36
422500 -- (-480.114) (-477.364) (-482.666) [-482.043] * (-480.795) (-482.455) (-478.249) [-477.299] -- 0:00:36
423000 -- [-478.645] (-479.967) (-477.662) (-477.851) * [-478.530] (-479.359) (-477.909) (-481.754) -- 0:00:36
423500 -- [-477.342] (-480.477) (-478.013) (-480.165) * (-478.341) (-480.236) (-476.389) [-478.169] -- 0:00:36
424000 -- (-476.838) (-480.730) (-482.955) [-478.020] * (-480.781) (-481.076) [-477.390] (-482.218) -- 0:00:36
424500 -- [-477.096] (-478.382) (-480.772) (-479.149) * (-477.884) (-480.312) (-480.632) [-478.510] -- 0:00:36
425000 -- [-478.862] (-481.763) (-479.697) (-478.152) * (-478.734) [-480.179] (-477.427) (-481.189) -- 0:00:36
Average standard deviation of split frequencies: 0.008507
425500 -- (-482.085) (-476.706) (-479.925) [-481.740] * [-479.526] (-483.353) (-478.806) (-477.366) -- 0:00:36
426000 -- (-481.044) (-479.307) [-478.837] (-481.982) * (-476.983) [-481.837] (-477.025) (-478.326) -- 0:00:36
426500 -- (-484.484) [-476.544] (-480.168) (-479.853) * (-478.605) [-481.918] (-478.397) (-478.247) -- 0:00:36
427000 -- (-481.086) (-484.096) (-478.014) [-478.028] * (-477.971) (-479.283) [-476.328] (-478.699) -- 0:00:36
427500 -- (-478.191) [-477.729] (-479.590) (-476.152) * (-477.672) (-478.179) (-479.025) [-478.447] -- 0:00:37
428000 -- (-478.703) (-475.929) (-478.761) [-480.794] * [-478.328] (-478.221) (-476.384) (-478.090) -- 0:00:37
428500 -- [-476.680] (-483.176) (-478.681) (-478.556) * (-478.841) [-477.464] (-479.923) (-478.407) -- 0:00:37
429000 -- [-477.020] (-477.626) (-479.115) (-478.269) * (-479.763) (-480.759) [-477.546] (-476.603) -- 0:00:37
429500 -- (-480.958) (-480.602) [-478.185] (-478.775) * [-482.144] (-479.711) (-477.949) (-478.489) -- 0:00:37
430000 -- (-480.835) (-478.122) (-478.963) [-478.877] * (-482.982) (-477.743) [-476.113] (-480.550) -- 0:00:37
Average standard deviation of split frequencies: 0.009236
430500 -- (-478.407) (-477.717) [-478.803] (-478.703) * (-476.488) [-477.503] (-477.408) (-476.647) -- 0:00:37
431000 -- (-476.201) (-478.770) [-476.117] (-478.431) * [-479.783] (-477.942) (-487.164) (-479.978) -- 0:00:36
431500 -- [-478.875] (-477.813) (-476.973) (-479.280) * (-478.015) [-476.263] (-482.197) (-476.248) -- 0:00:36
432000 -- (-476.603) (-475.435) (-482.054) [-479.474] * (-481.161) (-479.876) [-477.850] (-477.634) -- 0:00:36
432500 -- [-478.193] (-476.980) (-480.596) (-478.836) * (-479.324) (-480.388) (-479.574) [-476.968] -- 0:00:36
433000 -- (-477.825) (-479.803) [-477.650] (-479.026) * (-478.118) (-478.153) [-476.979] (-484.923) -- 0:00:36
433500 -- [-474.922] (-481.187) (-476.918) (-477.999) * [-478.289] (-477.722) (-482.600) (-482.107) -- 0:00:36
434000 -- [-477.658] (-484.882) (-475.663) (-478.107) * (-478.373) (-481.297) (-479.048) [-478.340] -- 0:00:36
434500 -- (-479.044) [-481.093] (-477.615) (-479.233) * (-482.611) (-480.824) [-477.919] (-480.565) -- 0:00:36
435000 -- (-478.715) [-476.728] (-480.077) (-480.517) * (-479.957) (-482.133) (-477.481) [-479.720] -- 0:00:36
Average standard deviation of split frequencies: 0.010069
435500 -- (-478.014) [-477.555] (-476.803) (-482.081) * [-477.514] (-480.857) (-478.432) (-478.429) -- 0:00:36
436000 -- (-478.959) (-478.264) [-477.482] (-479.092) * [-480.315] (-479.756) (-479.416) (-479.853) -- 0:00:36
436500 -- (-476.240) [-477.867] (-477.456) (-479.111) * (-478.037) (-480.564) [-478.409] (-478.014) -- 0:00:36
437000 -- (-481.231) (-475.972) (-477.411) [-478.492] * (-484.845) (-480.466) (-477.608) [-479.031] -- 0:00:36
437500 -- (-481.176) (-477.351) (-477.752) [-479.037] * (-481.966) (-479.367) (-477.743) [-478.974] -- 0:00:36
438000 -- [-479.186] (-477.107) (-477.103) (-481.997) * [-479.671] (-478.471) (-478.529) (-479.172) -- 0:00:35
438500 -- (-477.208) [-477.508] (-476.994) (-480.672) * (-479.517) (-478.408) [-479.045] (-478.738) -- 0:00:35
439000 -- (-478.609) (-475.984) [-478.653] (-479.323) * (-478.326) (-478.170) (-475.757) [-479.730] -- 0:00:35
439500 -- (-479.361) (-475.580) (-478.419) [-477.792] * [-478.466] (-479.572) (-477.985) (-479.968) -- 0:00:35
440000 -- [-476.449] (-479.244) (-477.701) (-477.637) * [-478.958] (-479.844) (-480.096) (-481.830) -- 0:00:35
Average standard deviation of split frequencies: 0.009360
440500 -- (-477.384) (-478.934) [-474.729] (-477.973) * (-479.840) [-477.913] (-476.841) (-483.044) -- 0:00:35
441000 -- (-477.478) (-478.949) (-475.943) [-477.074] * (-477.571) (-483.321) [-475.850] (-481.504) -- 0:00:35
441500 -- [-479.155] (-479.303) (-479.250) (-480.455) * (-482.459) (-479.501) [-477.655] (-480.543) -- 0:00:35
442000 -- (-479.861) (-479.265) (-481.174) [-478.455] * (-481.135) (-478.630) [-477.305] (-479.834) -- 0:00:35
442500 -- (-477.265) (-479.160) [-475.801] (-480.399) * (-478.550) (-479.700) (-479.335) [-476.926] -- 0:00:35
443000 -- (-477.693) [-475.244] (-476.651) (-478.539) * [-478.290] (-480.866) (-478.117) (-480.523) -- 0:00:36
443500 -- (-477.404) (-478.526) [-484.868] (-480.039) * [-479.161] (-479.498) (-476.502) (-477.612) -- 0:00:36
444000 -- (-478.368) [-477.313] (-487.147) (-479.083) * (-482.067) [-480.395] (-477.798) (-478.568) -- 0:00:36
444500 -- (-477.889) [-477.007] (-478.630) (-479.483) * (-478.855) [-480.397] (-479.531) (-478.432) -- 0:00:36
445000 -- (-479.704) (-478.994) [-479.714] (-483.175) * [-478.067] (-480.066) (-478.362) (-476.840) -- 0:00:36
Average standard deviation of split frequencies: 0.009182
445500 -- (-481.570) [-476.414] (-479.262) (-480.791) * (-477.583) (-480.645) (-478.894) [-476.778] -- 0:00:36
446000 -- [-475.992] (-478.176) (-478.299) (-477.734) * (-479.376) (-478.008) (-479.116) [-480.450] -- 0:00:36
446500 -- (-477.507) (-477.430) [-479.536] (-477.441) * (-480.319) [-478.174] (-478.818) (-478.038) -- 0:00:35
447000 -- (-476.503) (-477.289) [-479.281] (-479.993) * [-477.646] (-482.946) (-479.687) (-478.472) -- 0:00:35
447500 -- [-479.055] (-480.508) (-478.545) (-477.508) * [-477.108] (-482.235) (-483.901) (-481.357) -- 0:00:35
448000 -- (-478.615) [-477.073] (-482.587) (-474.952) * (-477.857) [-479.164] (-479.285) (-478.706) -- 0:00:35
448500 -- (-476.647) (-477.058) (-479.118) [-477.490] * (-481.231) (-479.097) [-480.186] (-480.099) -- 0:00:35
449000 -- (-479.783) (-478.646) [-475.877] (-477.416) * (-476.171) [-479.576] (-480.361) (-483.520) -- 0:00:35
449500 -- [-478.229] (-476.647) (-475.313) (-479.379) * (-475.073) (-487.915) [-481.551] (-480.354) -- 0:00:35
450000 -- [-479.142] (-476.255) (-476.049) (-477.764) * (-476.362) [-477.651] (-481.224) (-479.275) -- 0:00:35
Average standard deviation of split frequencies: 0.009205
450500 -- (-477.705) [-475.679] (-476.306) (-475.720) * [-476.450] (-477.279) (-479.162) (-479.941) -- 0:00:35
451000 -- (-480.060) (-480.693) [-478.206] (-479.260) * [-477.770] (-476.797) (-476.541) (-481.117) -- 0:00:35
451500 -- (-478.594) (-480.046) (-477.701) [-477.549] * (-475.732) (-477.559) [-477.425] (-476.664) -- 0:00:35
452000 -- [-475.848] (-479.718) (-480.412) (-475.441) * [-477.565] (-478.167) (-478.136) (-480.616) -- 0:00:35
452500 -- (-479.892) (-479.350) (-481.022) [-477.190] * [-476.864] (-479.068) (-478.173) (-478.018) -- 0:00:35
453000 -- [-476.936] (-479.391) (-477.719) (-477.863) * (-478.343) (-476.620) (-481.929) [-479.049] -- 0:00:35
453500 -- [-476.216] (-476.465) (-479.690) (-476.742) * (-477.055) (-476.703) [-480.628] (-480.809) -- 0:00:34
454000 -- (-478.322) [-477.391] (-479.273) (-479.021) * (-475.880) (-478.016) [-477.668] (-477.005) -- 0:00:34
454500 -- (-479.001) (-479.087) (-481.300) [-478.838] * (-478.479) (-477.896) [-478.636] (-479.027) -- 0:00:34
455000 -- [-476.570] (-476.823) (-479.514) (-479.959) * (-477.924) (-478.809) [-475.398] (-476.546) -- 0:00:34
Average standard deviation of split frequencies: 0.008822
455500 -- [-479.999] (-476.560) (-478.990) (-480.039) * (-478.594) [-479.205] (-478.965) (-476.340) -- 0:00:34
456000 -- (-482.865) (-480.336) (-477.458) [-479.945] * (-477.533) (-478.205) (-477.313) [-474.751] -- 0:00:34
456500 -- (-475.750) (-477.531) [-480.611] (-478.519) * (-475.198) (-483.034) (-477.372) [-474.659] -- 0:00:34
457000 -- (-477.440) [-479.745] (-480.373) (-477.481) * (-473.899) (-477.768) (-477.499) [-476.301] -- 0:00:34
457500 -- (-481.225) (-478.946) [-479.913] (-477.679) * [-477.367] (-478.461) (-480.479) (-479.132) -- 0:00:34
458000 -- (-478.671) (-478.974) (-477.343) [-477.160] * (-480.985) (-480.572) (-478.841) [-477.108] -- 0:00:34
458500 -- (-477.189) (-478.984) [-480.412] (-479.794) * (-478.214) [-480.073] (-481.467) (-477.332) -- 0:00:34
459000 -- (-482.508) [-480.230] (-483.166) (-475.672) * (-480.427) (-479.361) [-475.941] (-476.350) -- 0:00:35
459500 -- (-481.401) (-480.138) [-480.820] (-477.468) * (-480.598) (-482.373) [-475.334] (-476.528) -- 0:00:35
460000 -- [-478.466] (-480.046) (-480.922) (-476.571) * (-482.677) (-479.735) (-477.289) [-478.229] -- 0:00:35
Average standard deviation of split frequencies: 0.009346
460500 -- (-479.495) [-476.172] (-480.546) (-478.446) * [-477.276] (-479.051) (-480.169) (-478.085) -- 0:00:35
461000 -- [-476.615] (-478.522) (-478.522) (-479.194) * (-481.406) (-480.079) (-481.753) [-476.422] -- 0:00:35
461500 -- (-480.724) (-478.368) (-476.789) [-476.797] * (-485.297) (-480.675) (-478.876) [-479.433] -- 0:00:35
462000 -- (-480.355) (-477.413) (-477.082) [-477.115] * (-481.496) (-478.675) [-476.144] (-477.069) -- 0:00:34
462500 -- (-480.186) (-479.343) (-486.333) [-477.543] * [-475.229] (-479.664) (-476.085) (-480.033) -- 0:00:34
463000 -- [-477.652] (-479.985) (-480.359) (-476.899) * [-477.662] (-479.675) (-477.010) (-479.654) -- 0:00:34
463500 -- (-477.983) (-478.295) (-484.021) [-477.755] * (-477.014) [-477.712] (-477.313) (-480.815) -- 0:00:34
464000 -- (-480.415) (-478.296) [-474.529] (-477.238) * [-478.989] (-481.721) (-480.338) (-481.608) -- 0:00:34
464500 -- (-479.470) (-476.135) (-479.832) [-481.290] * (-475.811) (-483.698) [-482.262] (-481.118) -- 0:00:34
465000 -- (-478.166) [-477.904] (-483.355) (-476.472) * (-475.917) [-478.375] (-482.706) (-478.567) -- 0:00:34
Average standard deviation of split frequencies: 0.009878
465500 -- (-478.512) (-477.571) [-479.532] (-477.190) * [-478.007] (-478.696) (-479.131) (-475.421) -- 0:00:34
466000 -- (-476.555) (-479.598) (-479.775) [-478.151] * (-479.297) [-480.857] (-474.908) (-476.618) -- 0:00:34
466500 -- (-478.246) [-476.947] (-479.732) (-477.395) * (-476.454) (-479.084) [-476.220] (-475.135) -- 0:00:34
467000 -- (-477.070) (-476.657) (-482.546) [-475.752] * (-478.561) (-480.044) (-485.059) [-476.898] -- 0:00:34
467500 -- (-476.339) [-476.398] (-478.586) (-478.635) * (-478.971) [-478.347] (-477.539) (-474.894) -- 0:00:34
468000 -- (-476.966) (-478.263) [-481.205] (-477.261) * (-480.044) (-478.829) (-480.005) [-478.533] -- 0:00:34
468500 -- (-476.561) (-477.447) [-479.866] (-477.989) * [-478.237] (-478.431) (-478.516) (-479.977) -- 0:00:34
469000 -- [-476.306] (-477.630) (-478.832) (-477.793) * (-477.329) (-475.623) [-476.526] (-480.846) -- 0:00:33
469500 -- [-479.744] (-478.124) (-477.273) (-480.467) * (-477.364) (-478.457) [-476.670] (-482.552) -- 0:00:33
470000 -- [-477.353] (-478.461) (-478.239) (-475.897) * (-478.938) [-476.255] (-478.794) (-479.951) -- 0:00:33
Average standard deviation of split frequencies: 0.009682
470500 -- [-474.959] (-483.591) (-479.732) (-479.520) * (-477.387) [-477.947] (-480.399) (-478.043) -- 0:00:33
471000 -- (-480.011) (-481.488) [-480.752] (-478.567) * [-478.174] (-477.416) (-479.334) (-480.962) -- 0:00:33
471500 -- (-475.764) (-483.008) [-479.288] (-483.565) * (-479.187) (-476.620) (-479.416) [-477.228] -- 0:00:33
472000 -- (-477.395) (-478.342) (-476.051) [-484.248] * (-481.638) (-475.755) [-479.269] (-478.763) -- 0:00:33
472500 -- (-479.415) (-479.018) (-477.971) [-480.428] * (-480.816) [-476.005] (-477.803) (-476.607) -- 0:00:33
473000 -- (-478.081) [-479.602] (-478.402) (-477.528) * [-479.190] (-479.782) (-479.781) (-478.177) -- 0:00:33
473500 -- (-478.827) (-476.042) [-478.857] (-476.966) * (-476.973) (-479.392) (-477.325) [-477.789] -- 0:00:33
474000 -- (-476.975) (-477.616) (-480.165) [-481.111] * (-478.162) [-479.605] (-483.170) (-479.382) -- 0:00:33
474500 -- (-476.387) [-480.466] (-478.454) (-477.089) * (-478.497) (-476.785) (-483.281) [-476.291] -- 0:00:33
475000 -- [-476.483] (-476.316) (-477.183) (-480.681) * (-478.331) (-484.973) (-482.970) [-477.974] -- 0:00:34
Average standard deviation of split frequencies: 0.009507
475500 -- (-476.299) [-476.027] (-476.825) (-483.232) * (-477.966) (-483.328) [-477.650] (-479.886) -- 0:00:34
476000 -- (-476.840) (-477.618) [-477.136] (-479.450) * (-479.809) (-482.862) (-478.239) [-478.217] -- 0:00:34
476500 -- [-480.485] (-477.016) (-485.771) (-480.866) * (-480.391) [-477.114] (-481.342) (-478.928) -- 0:00:34
477000 -- [-480.249] (-477.212) (-476.902) (-480.989) * [-477.405] (-475.982) (-479.761) (-476.458) -- 0:00:33
477500 -- (-479.013) [-483.686] (-476.063) (-483.419) * (-480.105) [-476.440] (-476.485) (-477.576) -- 0:00:33
478000 -- (-479.438) [-478.794] (-481.555) (-480.013) * (-482.240) (-474.694) (-479.190) [-475.548] -- 0:00:33
478500 -- (-475.771) [-475.934] (-481.458) (-478.091) * (-478.526) (-477.150) [-478.470] (-480.323) -- 0:00:33
479000 -- (-478.857) (-476.761) (-475.693) [-479.232] * (-480.322) (-475.123) [-476.771] (-479.209) -- 0:00:33
479500 -- (-479.498) (-477.937) [-476.546] (-477.624) * [-478.484] (-477.244) (-480.219) (-481.806) -- 0:00:33
480000 -- (-476.122) [-477.727] (-478.621) (-476.474) * (-482.077) (-478.345) (-482.830) [-477.902] -- 0:00:33
Average standard deviation of split frequencies: 0.009611
480500 -- (-477.399) [-479.670] (-479.730) (-477.246) * (-480.195) [-478.381] (-477.921) (-480.186) -- 0:00:33
481000 -- (-478.136) [-481.606] (-479.911) (-481.359) * (-478.120) (-477.707) (-478.358) [-476.785] -- 0:00:33
481500 -- (-480.692) [-476.332] (-481.290) (-479.010) * (-478.102) (-478.556) [-476.048] (-479.415) -- 0:00:33
482000 -- (-475.842) (-478.346) [-479.486] (-480.712) * [-476.192] (-477.847) (-478.446) (-478.698) -- 0:00:33
482500 -- (-475.502) (-477.841) [-476.836] (-478.811) * (-479.966) (-478.560) (-478.424) [-480.211] -- 0:00:33
483000 -- (-475.937) [-477.756] (-480.840) (-481.570) * (-479.899) (-478.066) (-481.104) [-477.920] -- 0:00:33
483500 -- (-476.036) (-480.698) (-480.043) [-481.343] * [-478.815] (-478.165) (-477.639) (-477.110) -- 0:00:33
484000 -- (-474.997) [-475.906] (-477.923) (-480.137) * (-479.014) (-478.394) [-477.845] (-479.646) -- 0:00:33
484500 -- (-475.729) (-479.008) [-477.223] (-485.985) * (-477.865) [-478.621] (-481.825) (-478.522) -- 0:00:32
485000 -- (-476.175) (-483.719) (-477.758) [-479.972] * (-475.243) (-478.951) (-477.587) [-477.676] -- 0:00:32
Average standard deviation of split frequencies: 0.009376
485500 -- (-481.228) [-477.663] (-477.215) (-477.875) * (-478.977) (-475.823) [-477.149] (-479.407) -- 0:00:32
486000 -- [-479.265] (-479.401) (-482.744) (-478.263) * (-476.379) [-477.742] (-477.900) (-478.781) -- 0:00:32
486500 -- (-480.185) (-477.498) [-478.714] (-477.937) * [-480.186] (-476.285) (-475.888) (-478.011) -- 0:00:32
487000 -- (-477.765) [-478.118] (-479.248) (-480.246) * (-478.828) (-478.669) (-475.874) [-477.421] -- 0:00:32
487500 -- (-478.139) [-478.557] (-479.258) (-479.980) * [-479.470] (-476.108) (-478.474) (-478.549) -- 0:00:32
488000 -- (-479.671) (-479.561) (-479.051) [-476.742] * (-480.646) [-476.432] (-476.718) (-480.853) -- 0:00:32
488500 -- (-478.082) (-480.728) [-475.627] (-481.243) * (-476.757) [-478.647] (-476.910) (-480.690) -- 0:00:32
489000 -- (-477.870) (-480.141) (-478.611) [-481.318] * (-477.971) (-475.934) [-475.810] (-477.551) -- 0:00:32
489500 -- [-478.874] (-480.248) (-478.855) (-478.744) * (-479.062) (-481.650) [-477.191] (-478.576) -- 0:00:32
490000 -- (-476.745) (-476.425) [-476.898] (-481.070) * (-481.107) [-475.392] (-478.326) (-479.030) -- 0:00:32
Average standard deviation of split frequencies: 0.010229
490500 -- (-479.673) [-477.020] (-477.860) (-479.968) * (-478.113) [-476.405] (-479.198) (-478.484) -- 0:00:33
491000 -- (-478.714) (-477.926) (-479.771) [-477.151] * (-480.033) (-480.956) [-478.268] (-477.961) -- 0:00:33
491500 -- (-478.416) (-480.677) [-477.182] (-480.049) * (-478.151) (-478.202) (-478.865) [-480.118] -- 0:00:33
492000 -- (-481.005) (-480.549) (-477.306) [-475.752] * (-476.263) (-479.249) (-479.586) [-478.038] -- 0:00:33
492500 -- (-476.996) (-477.729) [-477.003] (-480.294) * (-477.083) [-482.601] (-478.064) (-480.478) -- 0:00:32
493000 -- (-476.644) (-477.765) [-480.813] (-476.736) * [-476.118] (-482.785) (-482.643) (-479.640) -- 0:00:32
493500 -- (-477.267) [-477.756] (-476.708) (-476.266) * (-478.530) [-478.881] (-478.123) (-478.893) -- 0:00:32
494000 -- (-478.910) (-478.755) [-479.380] (-475.144) * (-480.530) [-476.100] (-478.146) (-476.430) -- 0:00:32
494500 -- (-478.197) [-479.537] (-479.868) (-475.780) * (-479.898) (-480.449) (-477.958) [-477.476] -- 0:00:32
495000 -- [-480.985] (-477.015) (-479.171) (-477.100) * (-478.869) [-477.289] (-476.820) (-478.756) -- 0:00:32
Average standard deviation of split frequencies: 0.009694
495500 -- (-477.127) [-482.839] (-479.729) (-478.113) * [-477.829] (-477.442) (-478.847) (-483.016) -- 0:00:32
496000 -- (-478.008) (-477.586) [-479.691] (-479.094) * (-475.767) [-486.264] (-476.545) (-476.469) -- 0:00:32
496500 -- (-477.498) [-476.787] (-478.163) (-481.225) * (-477.496) (-478.826) [-480.170] (-480.596) -- 0:00:32
497000 -- [-477.535] (-480.891) (-477.019) (-477.278) * (-477.397) [-479.788] (-479.434) (-479.023) -- 0:00:32
497500 -- (-476.711) (-480.192) (-479.919) [-479.993] * (-478.846) (-478.389) [-481.921] (-478.618) -- 0:00:32
498000 -- [-477.079] (-480.285) (-479.230) (-478.600) * [-477.425] (-481.052) (-482.633) (-478.140) -- 0:00:32
498500 -- (-477.476) (-480.187) (-476.410) [-479.717] * [-480.085] (-478.610) (-482.166) (-480.129) -- 0:00:32
499000 -- (-478.173) (-478.808) (-478.120) [-478.930] * [-475.503] (-481.842) (-477.489) (-478.509) -- 0:00:32
499500 -- (-480.615) (-478.302) (-478.148) [-480.022] * (-476.868) (-478.037) (-478.901) [-478.563] -- 0:00:32
500000 -- (-478.008) (-479.041) [-478.649] (-481.510) * (-482.319) [-477.090] (-482.557) (-479.997) -- 0:00:32
Average standard deviation of split frequencies: 0.010063
500500 -- (-479.880) (-480.678) [-477.300] (-481.021) * (-477.043) (-480.882) (-477.237) [-481.834] -- 0:00:31
501000 -- (-479.965) (-491.512) [-479.481] (-475.737) * [-476.741] (-480.213) (-478.856) (-481.094) -- 0:00:31
501500 -- (-478.802) (-480.797) (-480.443) [-478.520] * (-477.577) (-480.967) [-478.836] (-479.504) -- 0:00:31
502000 -- (-477.816) (-477.456) (-476.184) [-478.450] * (-476.975) (-477.582) [-478.008] (-478.052) -- 0:00:31
502500 -- [-478.250] (-480.848) (-479.337) (-480.115) * (-476.991) (-478.299) [-476.261] (-479.792) -- 0:00:31
503000 -- (-478.246) [-477.320] (-478.370) (-483.263) * [-476.854] (-477.975) (-478.287) (-479.321) -- 0:00:31
503500 -- [-475.075] (-481.366) (-479.220) (-480.254) * [-475.464] (-475.271) (-480.893) (-482.930) -- 0:00:31
504000 -- [-476.148] (-478.607) (-478.556) (-478.449) * (-475.362) (-479.587) [-479.351] (-484.759) -- 0:00:31
504500 -- [-477.898] (-480.095) (-479.932) (-480.253) * [-475.405] (-478.524) (-481.633) (-480.736) -- 0:00:31
505000 -- (-476.392) (-484.916) (-477.257) [-475.274] * [-476.205] (-478.374) (-476.883) (-489.815) -- 0:00:31
Average standard deviation of split frequencies: 0.010364
505500 -- (-475.406) (-480.153) (-477.510) [-477.426] * [-475.954] (-480.003) (-476.111) (-479.128) -- 0:00:31
506000 -- (-475.051) (-479.370) [-475.776] (-478.894) * (-480.689) (-478.041) (-477.408) [-477.184] -- 0:00:32
506500 -- (-478.828) [-478.828] (-478.909) (-480.028) * (-476.387) (-477.584) [-476.162] (-475.196) -- 0:00:32
507000 -- [-477.879] (-476.830) (-480.000) (-479.449) * (-484.684) [-477.889] (-478.165) (-478.156) -- 0:00:32
507500 -- (-479.012) [-476.899] (-482.158) (-477.112) * (-480.789) (-477.159) (-476.554) [-478.683] -- 0:00:32
508000 -- (-482.002) (-479.326) (-478.865) [-478.737] * (-480.249) (-479.938) [-476.182] (-477.921) -- 0:00:31
508500 -- (-477.534) (-478.304) (-482.027) [-480.929] * (-478.603) (-481.356) [-477.377] (-479.556) -- 0:00:31
509000 -- (-476.031) [-479.495] (-485.442) (-478.880) * (-479.001) (-481.200) (-478.514) [-478.646] -- 0:00:31
509500 -- [-479.859] (-477.723) (-484.045) (-477.453) * (-479.755) [-479.681] (-476.521) (-476.358) -- 0:00:31
510000 -- [-479.384] (-476.565) (-479.626) (-478.577) * (-475.974) (-477.734) [-476.181] (-478.622) -- 0:00:31
Average standard deviation of split frequencies: 0.010893
510500 -- [-478.520] (-479.438) (-476.619) (-483.802) * (-478.601) [-476.224] (-477.952) (-479.685) -- 0:00:31
511000 -- (-479.703) (-475.759) (-477.478) [-481.556] * (-480.211) (-479.028) [-479.055] (-479.397) -- 0:00:31
511500 -- (-480.288) (-478.752) [-480.384] (-479.358) * [-478.656] (-476.740) (-482.011) (-477.649) -- 0:00:31
512000 -- (-479.182) (-478.510) [-479.400] (-475.701) * [-476.758] (-476.171) (-483.073) (-477.499) -- 0:00:31
512500 -- (-477.223) (-478.246) [-480.565] (-477.886) * (-476.710) (-479.411) (-479.443) [-476.724] -- 0:00:31
513000 -- (-475.744) (-478.483) [-479.136] (-478.072) * [-479.290] (-476.208) (-479.848) (-479.035) -- 0:00:31
513500 -- (-476.854) (-477.571) [-482.254] (-479.346) * (-476.325) [-475.971] (-476.853) (-478.221) -- 0:00:31
514000 -- (-478.942) (-478.140) (-480.370) [-475.443] * (-478.594) [-475.385] (-479.032) (-480.172) -- 0:00:31
514500 -- [-478.837] (-481.648) (-479.325) (-483.598) * (-479.773) (-477.342) [-475.811] (-475.366) -- 0:00:31
515000 -- [-476.834] (-478.949) (-479.533) (-482.943) * (-477.685) [-478.228] (-478.421) (-480.616) -- 0:00:31
Average standard deviation of split frequencies: 0.011267
515500 -- (-477.498) (-481.936) [-478.458] (-480.991) * (-483.393) (-480.209) (-479.905) [-479.715] -- 0:00:31
516000 -- (-477.320) (-481.403) [-484.261] (-479.063) * [-477.532] (-478.984) (-478.043) (-475.301) -- 0:00:30
516500 -- (-476.569) [-478.729] (-479.398) (-482.234) * (-475.855) (-478.563) [-478.007] (-477.075) -- 0:00:30
517000 -- (-478.475) (-480.482) [-478.495] (-477.917) * (-476.573) (-478.828) (-476.358) [-479.438] -- 0:00:30
517500 -- (-477.804) [-480.908] (-483.181) (-476.382) * (-479.548) (-478.706) [-475.661] (-477.476) -- 0:00:30
518000 -- (-476.482) [-476.874] (-480.580) (-482.476) * (-478.032) (-477.126) [-480.660] (-479.263) -- 0:00:30
518500 -- (-476.599) (-479.543) (-479.953) [-476.419] * (-478.070) [-477.908] (-478.468) (-480.828) -- 0:00:30
519000 -- (-482.000) [-477.515] (-476.615) (-479.006) * (-480.427) (-479.144) (-480.052) [-475.504] -- 0:00:30
519500 -- (-479.735) (-479.119) [-476.237] (-480.593) * (-480.870) [-476.690] (-478.521) (-476.579) -- 0:00:30
520000 -- (-475.234) [-482.243] (-478.837) (-477.748) * (-477.307) [-478.295] (-477.117) (-476.269) -- 0:00:30
Average standard deviation of split frequencies: 0.010623
520500 -- (-479.177) (-482.557) (-477.039) [-476.492] * (-479.294) [-480.255] (-480.113) (-478.961) -- 0:00:30
521000 -- [-478.931] (-477.526) (-476.501) (-475.817) * [-478.097] (-480.444) (-478.055) (-475.875) -- 0:00:30
521500 -- (-480.799) [-476.937] (-483.020) (-481.283) * [-479.440] (-482.658) (-480.355) (-478.025) -- 0:00:30
522000 -- (-476.892) [-482.897] (-480.891) (-478.023) * (-476.762) [-476.944] (-482.310) (-478.779) -- 0:00:31
522500 -- (-478.758) (-479.543) [-480.878] (-478.791) * (-476.822) [-480.571] (-478.904) (-477.941) -- 0:00:31
523000 -- (-476.216) [-475.208] (-478.722) (-477.254) * [-477.148] (-481.604) (-478.774) (-478.352) -- 0:00:31
523500 -- (-480.045) (-478.793) [-477.392] (-475.893) * (-482.238) (-478.680) [-481.025] (-482.881) -- 0:00:30
524000 -- (-483.511) (-482.222) [-477.620] (-484.037) * (-481.661) [-478.984] (-477.598) (-480.395) -- 0:00:30
524500 -- (-478.074) (-477.807) [-481.236] (-480.478) * (-479.770) [-478.375] (-479.863) (-479.182) -- 0:00:30
525000 -- (-480.685) [-476.473] (-479.268) (-478.982) * [-477.119] (-478.137) (-481.253) (-479.856) -- 0:00:30
Average standard deviation of split frequencies: 0.010586
525500 -- [-482.049] (-476.936) (-483.159) (-477.559) * (-481.202) (-480.415) (-480.227) [-477.758] -- 0:00:30
526000 -- [-479.914] (-475.192) (-485.245) (-477.320) * (-476.944) (-481.869) (-475.756) [-477.945] -- 0:00:30
526500 -- (-479.006) (-478.454) [-480.207] (-479.791) * (-476.086) (-478.108) [-476.865] (-480.506) -- 0:00:30
527000 -- (-480.005) (-478.293) (-477.641) [-479.305] * [-477.571] (-478.227) (-477.790) (-478.949) -- 0:00:30
527500 -- (-481.023) (-476.568) [-479.283] (-480.044) * (-479.557) (-477.321) [-477.140] (-480.453) -- 0:00:30
528000 -- (-480.098) (-477.401) (-477.745) [-475.587] * [-479.278] (-479.578) (-476.716) (-480.922) -- 0:00:30
528500 -- (-481.625) (-479.906) [-478.984] (-475.725) * [-478.904] (-478.926) (-478.666) (-476.892) -- 0:00:30
529000 -- (-477.855) [-480.674] (-480.293) (-476.354) * [-477.862] (-479.348) (-476.891) (-479.687) -- 0:00:30
529500 -- (-483.018) (-480.222) (-482.726) [-474.826] * (-477.612) (-480.058) [-477.610] (-480.238) -- 0:00:30
530000 -- (-478.313) (-477.887) [-479.833] (-477.689) * (-476.763) (-478.211) [-477.301] (-479.856) -- 0:00:30
Average standard deviation of split frequencies: 0.010660
530500 -- [-479.301] (-487.959) (-480.824) (-479.854) * (-477.421) (-482.162) (-478.748) [-478.461] -- 0:00:30
531000 -- (-481.158) (-485.082) (-480.268) [-476.141] * [-479.320] (-480.220) (-479.341) (-481.170) -- 0:00:30
531500 -- [-479.648] (-479.001) (-478.992) (-477.791) * [-478.555] (-479.118) (-477.811) (-479.123) -- 0:00:29
532000 -- (-477.760) (-478.618) [-478.835] (-479.989) * (-478.540) [-477.106] (-477.407) (-478.652) -- 0:00:29
532500 -- (-479.750) [-476.830] (-475.910) (-475.495) * (-479.274) [-478.694] (-481.429) (-480.130) -- 0:00:29
533000 -- [-481.365] (-478.841) (-476.411) (-476.145) * [-478.384] (-480.417) (-478.184) (-479.339) -- 0:00:29
533500 -- (-476.892) (-480.542) (-476.089) [-478.192] * [-478.075] (-479.492) (-482.088) (-480.464) -- 0:00:29
534000 -- (-479.808) (-479.365) [-477.187] (-481.588) * (-479.272) (-479.461) [-477.218] (-480.199) -- 0:00:29
534500 -- (-480.096) [-479.795] (-479.800) (-478.067) * (-479.414) (-478.293) (-483.692) [-477.485] -- 0:00:29
535000 -- (-480.152) [-476.920] (-479.542) (-479.921) * (-476.737) (-477.048) (-481.573) [-476.822] -- 0:00:29
Average standard deviation of split frequencies: 0.010939
535500 -- (-484.295) (-475.347) (-480.994) [-475.710] * (-478.167) (-482.546) (-478.905) [-479.604] -- 0:00:29
536000 -- (-479.302) [-476.087] (-481.428) (-480.301) * [-477.595] (-476.091) (-485.526) (-479.392) -- 0:00:29
536500 -- (-481.110) [-476.184] (-479.676) (-476.978) * [-483.217] (-477.948) (-482.302) (-479.136) -- 0:00:29
537000 -- (-480.511) (-477.028) (-479.186) [-485.509] * [-483.257] (-486.303) (-479.771) (-482.055) -- 0:00:29
537500 -- [-479.419] (-481.932) (-478.105) (-479.915) * (-478.482) (-475.282) (-479.521) [-477.029] -- 0:00:29
538000 -- (-481.390) [-477.195] (-479.847) (-478.025) * (-478.266) [-477.142] (-479.839) (-478.458) -- 0:00:30
538500 -- (-484.346) [-477.110] (-477.295) (-476.290) * [-477.267] (-478.382) (-481.297) (-479.411) -- 0:00:29
539000 -- (-477.174) (-475.432) [-477.839] (-481.321) * (-479.030) [-478.527] (-480.454) (-481.419) -- 0:00:29
539500 -- (-479.243) [-476.211] (-476.268) (-483.923) * [-477.733] (-479.887) (-477.561) (-479.075) -- 0:00:29
540000 -- (-479.179) (-479.316) [-480.018] (-477.107) * (-480.271) (-479.251) (-478.550) [-479.852] -- 0:00:29
Average standard deviation of split frequencies: 0.010299
540500 -- (-480.752) (-478.671) (-478.920) [-477.700] * (-476.622) (-477.786) (-478.775) [-479.925] -- 0:00:29
541000 -- [-477.931] (-478.382) (-479.836) (-480.497) * [-478.302] (-478.260) (-479.663) (-478.439) -- 0:00:29
541500 -- (-478.204) (-476.786) (-480.012) [-476.817] * [-477.134] (-477.523) (-479.490) (-480.743) -- 0:00:29
542000 -- [-477.281] (-477.129) (-480.149) (-482.647) * [-476.781] (-479.332) (-478.191) (-480.009) -- 0:00:29
542500 -- (-478.380) (-477.363) [-478.638] (-479.507) * (-480.555) (-477.871) (-477.898) [-479.969] -- 0:00:29
543000 -- (-478.729) [-478.650] (-477.787) (-482.210) * (-479.831) (-477.392) (-475.764) [-478.710] -- 0:00:29
543500 -- (-478.171) [-476.621] (-480.333) (-477.590) * (-480.102) (-476.397) [-477.051] (-479.233) -- 0:00:29
544000 -- (-477.158) (-476.737) [-479.348] (-478.755) * (-478.480) [-477.901] (-477.082) (-477.491) -- 0:00:29
544500 -- (-479.457) (-477.607) (-480.652) [-478.763] * (-478.064) [-475.694] (-482.387) (-481.831) -- 0:00:29
545000 -- (-479.437) (-478.809) (-478.530) [-477.968] * (-478.515) (-475.955) [-478.638] (-478.873) -- 0:00:29
Average standard deviation of split frequencies: 0.010868
545500 -- (-477.182) (-481.753) (-478.723) [-479.679] * (-476.137) [-478.307] (-479.475) (-478.917) -- 0:00:29
546000 -- (-477.461) (-480.147) (-479.682) [-477.455] * (-479.757) (-479.440) (-478.136) [-478.780] -- 0:00:29
546500 -- (-482.640) [-478.784] (-480.348) (-477.308) * (-476.698) (-477.290) (-479.468) [-479.147] -- 0:00:29
547000 -- (-480.725) (-477.319) [-477.413] (-478.797) * [-477.412] (-478.051) (-481.415) (-478.145) -- 0:00:28
547500 -- [-476.783] (-482.478) (-478.662) (-481.122) * (-477.964) [-479.630] (-480.431) (-474.750) -- 0:00:28
548000 -- [-479.294] (-478.534) (-482.665) (-481.648) * (-481.891) (-479.362) (-479.687) [-476.646] -- 0:00:28
548500 -- (-479.062) (-480.291) (-480.959) [-479.036] * (-482.244) [-478.897] (-477.379) (-478.191) -- 0:00:28
549000 -- (-478.661) (-479.674) (-480.299) [-480.681] * [-480.979] (-479.261) (-478.912) (-478.439) -- 0:00:28
549500 -- (-484.121) [-475.489] (-478.818) (-480.658) * (-480.472) (-478.339) (-478.028) [-478.843] -- 0:00:28
550000 -- (-479.626) (-482.192) (-479.367) [-478.282] * (-476.614) (-479.321) [-478.838] (-477.042) -- 0:00:28
Average standard deviation of split frequencies: 0.011243
550500 -- (-478.331) [-477.817] (-478.148) (-479.393) * (-477.182) [-481.905] (-482.389) (-477.509) -- 0:00:28
551000 -- (-479.590) (-478.143) (-476.990) [-481.582] * (-478.436) [-475.999] (-479.615) (-478.325) -- 0:00:28
551500 -- (-477.504) (-478.257) (-477.661) [-479.576] * (-478.942) (-476.779) (-479.770) [-477.377] -- 0:00:28
552000 -- (-478.151) [-476.586] (-479.937) (-480.365) * (-479.120) [-478.919] (-478.988) (-478.660) -- 0:00:28
552500 -- [-479.267] (-477.225) (-479.646) (-479.074) * [-477.746] (-478.298) (-480.788) (-479.033) -- 0:00:28
553000 -- [-477.700] (-477.168) (-482.071) (-480.200) * (-479.269) (-478.099) (-477.837) [-479.387] -- 0:00:28
553500 -- [-478.619] (-478.318) (-478.053) (-475.405) * (-476.090) [-480.314] (-478.252) (-479.259) -- 0:00:28
554000 -- (-476.956) (-480.877) (-477.744) [-477.710] * [-476.919] (-478.601) (-479.141) (-479.859) -- 0:00:28
554500 -- (-477.662) [-479.251] (-479.598) (-478.350) * (-478.447) [-478.788] (-481.439) (-481.701) -- 0:00:28
555000 -- (-477.554) (-477.584) [-476.425] (-478.865) * (-481.498) (-481.507) (-480.929) [-478.093] -- 0:00:28
Average standard deviation of split frequencies: 0.010909
555500 -- [-477.536] (-477.960) (-476.856) (-478.449) * [-481.427] (-478.783) (-478.379) (-479.930) -- 0:00:28
556000 -- (-479.572) (-478.587) [-477.512] (-482.076) * [-479.740] (-480.148) (-477.941) (-482.538) -- 0:00:28
556500 -- (-478.423) (-481.338) [-479.540] (-479.499) * (-477.771) (-479.781) (-477.233) [-476.182] -- 0:00:28
557000 -- (-482.054) (-475.586) (-481.765) [-479.485] * [-475.318] (-479.595) (-478.759) (-477.813) -- 0:00:28
557500 -- (-480.891) [-477.998] (-480.647) (-477.418) * (-481.276) (-479.228) [-478.611] (-481.581) -- 0:00:28
558000 -- (-479.092) (-478.071) (-480.093) [-478.592] * [-477.468] (-479.192) (-479.150) (-480.278) -- 0:00:28
558500 -- (-484.933) (-476.935) (-478.970) [-477.571] * (-480.819) (-477.729) [-479.056] (-479.147) -- 0:00:28
559000 -- (-478.645) (-477.459) [-477.134] (-480.875) * (-481.668) (-481.483) (-480.478) [-476.361] -- 0:00:28
559500 -- (-477.923) [-477.898] (-478.511) (-479.938) * (-480.282) (-478.524) [-479.357] (-477.396) -- 0:00:28
560000 -- (-477.806) [-477.953] (-475.787) (-480.001) * (-482.092) [-476.946] (-478.141) (-480.704) -- 0:00:28
Average standard deviation of split frequencies: 0.011211
560500 -- (-479.738) [-477.928] (-477.288) (-476.125) * (-479.124) [-480.055] (-478.347) (-477.864) -- 0:00:28
561000 -- (-479.085) (-476.123) [-480.485] (-480.764) * (-478.759) (-481.639) [-479.038] (-476.992) -- 0:00:28
561500 -- (-478.616) [-477.919] (-480.610) (-478.726) * [-476.436] (-479.298) (-480.571) (-480.342) -- 0:00:28
562000 -- [-481.477] (-478.425) (-480.362) (-481.019) * (-479.001) [-478.458] (-477.565) (-477.864) -- 0:00:28
562500 -- (-481.134) [-479.618] (-480.214) (-477.481) * (-477.581) (-477.864) (-481.127) [-478.394] -- 0:00:28
563000 -- (-479.587) [-479.316] (-478.435) (-477.181) * [-476.920] (-480.548) (-482.302) (-480.018) -- 0:00:27
563500 -- [-479.347] (-478.860) (-476.427) (-482.170) * (-478.694) (-478.077) (-479.517) [-480.936] -- 0:00:27
564000 -- [-476.932] (-478.136) (-478.584) (-479.031) * (-480.597) [-485.456] (-480.250) (-479.744) -- 0:00:27
564500 -- (-477.987) (-482.083) [-478.389] (-479.434) * (-475.670) (-481.685) (-481.455) [-479.446] -- 0:00:27
565000 -- [-476.495] (-476.492) (-475.720) (-476.672) * (-478.976) [-478.179] (-484.622) (-478.343) -- 0:00:27
Average standard deviation of split frequencies: 0.011272
565500 -- (-479.654) [-479.453] (-476.970) (-478.850) * (-477.085) (-478.396) (-481.537) [-476.782] -- 0:00:27
566000 -- (-477.705) (-479.909) [-477.169] (-479.939) * (-477.112) (-477.948) [-478.876] (-479.777) -- 0:00:27
566500 -- [-478.550] (-477.545) (-478.290) (-480.285) * (-480.580) (-484.157) [-476.167] (-479.548) -- 0:00:27
567000 -- (-477.591) (-478.208) [-480.578] (-478.843) * (-478.087) (-478.645) [-481.590] (-478.242) -- 0:00:27
567500 -- (-479.161) [-475.329] (-478.444) (-476.426) * (-477.294) (-478.383) (-479.211) [-479.131] -- 0:00:27
568000 -- [-477.215] (-476.148) (-477.732) (-478.643) * [-475.851] (-480.736) (-482.213) (-475.955) -- 0:00:27
568500 -- (-479.895) (-476.801) [-476.170] (-477.077) * (-477.175) (-481.188) [-478.647] (-478.171) -- 0:00:27
569000 -- [-477.384] (-477.883) (-478.034) (-477.931) * (-482.539) (-479.572) (-477.315) [-479.824] -- 0:00:27
569500 -- (-480.284) (-479.865) [-478.116] (-479.058) * (-482.912) [-479.234] (-480.899) (-480.434) -- 0:00:27
570000 -- (-483.383) (-481.905) (-477.015) [-475.589] * (-479.270) [-478.847] (-484.168) (-478.004) -- 0:00:27
Average standard deviation of split frequencies: 0.010849
570500 -- (-480.497) [-476.227] (-477.982) (-476.352) * (-477.559) [-480.594] (-479.326) (-479.392) -- 0:00:27
571000 -- (-480.592) (-475.524) (-478.336) [-476.469] * [-479.198] (-479.301) (-478.883) (-479.576) -- 0:00:27
571500 -- (-476.494) [-476.923] (-480.428) (-478.367) * (-481.019) (-478.239) (-478.625) [-477.956] -- 0:00:27
572000 -- (-476.940) [-476.291] (-476.330) (-475.370) * [-477.664] (-480.972) (-481.504) (-478.169) -- 0:00:27
572500 -- (-477.868) (-479.779) (-481.602) [-478.704] * (-476.438) [-480.722] (-480.655) (-478.770) -- 0:00:27
573000 -- (-478.893) (-478.011) [-481.978] (-477.687) * (-477.493) (-478.795) [-478.694] (-481.442) -- 0:00:27
573500 -- [-479.923] (-479.275) (-480.730) (-477.662) * (-478.073) (-477.648) [-479.840] (-480.816) -- 0:00:27
574000 -- (-480.246) [-478.816] (-476.565) (-476.534) * (-478.025) (-477.644) [-480.762] (-478.182) -- 0:00:27
574500 -- (-475.920) [-478.244] (-478.097) (-478.157) * [-476.461] (-476.680) (-480.355) (-477.084) -- 0:00:27
575000 -- (-476.249) [-475.906] (-477.161) (-476.533) * (-477.630) (-480.852) [-481.115] (-480.931) -- 0:00:27
Average standard deviation of split frequencies: 0.010203
575500 -- [-479.959] (-483.581) (-480.433) (-477.895) * (-476.177) (-480.177) [-481.572] (-478.868) -- 0:00:27
576000 -- (-477.602) (-478.197) [-477.108] (-477.674) * (-478.293) [-479.289] (-479.474) (-482.658) -- 0:00:27
576500 -- (-480.076) (-480.490) (-476.647) [-476.594] * (-477.307) (-477.022) (-481.152) [-477.948] -- 0:00:27
577000 -- (-476.409) (-480.094) (-479.508) [-477.212] * [-476.994] (-479.852) (-484.319) (-478.287) -- 0:00:27
577500 -- (-482.860) (-481.944) [-477.277] (-476.595) * (-481.617) (-479.981) (-481.269) [-478.960] -- 0:00:27
578000 -- (-477.648) (-477.554) [-481.578] (-477.884) * [-479.436] (-482.381) (-479.825) (-479.153) -- 0:00:27
578500 -- (-481.428) [-477.574] (-478.790) (-476.839) * (-478.919) (-478.268) [-478.575] (-478.071) -- 0:00:26
579000 -- (-478.620) (-478.387) [-478.035] (-477.470) * (-483.031) [-478.614] (-482.297) (-479.371) -- 0:00:26
579500 -- (-478.906) (-479.430) (-478.429) [-475.175] * (-478.421) [-477.678] (-481.041) (-479.600) -- 0:00:26
580000 -- [-479.586] (-482.631) (-476.344) (-478.650) * (-478.403) (-482.883) (-483.603) [-478.244] -- 0:00:26
Average standard deviation of split frequencies: 0.009796
580500 -- (-476.883) (-479.680) (-478.516) [-475.426] * [-476.940] (-476.887) (-480.047) (-477.684) -- 0:00:26
581000 -- (-478.715) [-478.055] (-478.219) (-477.350) * (-478.565) (-477.376) [-479.525] (-480.650) -- 0:00:26
581500 -- (-477.176) (-481.906) (-477.513) [-477.932] * [-475.605] (-478.776) (-478.340) (-477.685) -- 0:00:26
582000 -- [-479.536] (-476.483) (-479.753) (-477.242) * (-475.592) (-478.382) (-479.910) [-477.374] -- 0:00:26
582500 -- [-475.012] (-477.629) (-480.269) (-481.164) * (-476.978) (-478.722) (-478.954) [-477.064] -- 0:00:26
583000 -- (-478.596) [-477.480] (-479.385) (-476.509) * (-481.587) [-478.441] (-480.276) (-478.802) -- 0:00:26
583500 -- [-478.563] (-478.886) (-477.579) (-477.240) * (-477.161) [-476.240] (-479.582) (-479.349) -- 0:00:26
584000 -- [-476.842] (-480.786) (-478.947) (-477.640) * (-477.330) [-476.036] (-477.576) (-475.394) -- 0:00:26
584500 -- (-478.927) (-476.815) (-479.386) [-477.152] * (-476.353) (-480.453) [-479.592] (-482.004) -- 0:00:26
585000 -- [-477.665] (-479.931) (-481.667) (-478.756) * (-477.784) (-478.396) [-477.695] (-479.396) -- 0:00:26
Average standard deviation of split frequencies: 0.009546
585500 -- [-475.873] (-476.590) (-480.059) (-479.369) * (-479.531) (-480.384) (-479.560) [-479.691] -- 0:00:26
586000 -- [-476.904] (-477.525) (-479.214) (-476.623) * [-476.068] (-484.141) (-478.773) (-479.316) -- 0:00:26
586500 -- [-477.711] (-477.119) (-482.201) (-476.423) * (-476.610) [-482.796] (-477.081) (-475.942) -- 0:00:26
587000 -- (-476.575) [-479.963] (-481.722) (-478.817) * (-482.024) (-482.999) [-477.937] (-480.632) -- 0:00:26
587500 -- (-477.199) [-480.872] (-479.519) (-477.950) * [-476.320] (-480.575) (-480.562) (-475.957) -- 0:00:26
588000 -- (-478.233) (-481.447) (-480.716) [-475.956] * [-474.594] (-481.167) (-478.820) (-477.684) -- 0:00:26
588500 -- [-477.824] (-479.640) (-483.306) (-479.398) * [-476.525] (-481.345) (-479.170) (-477.169) -- 0:00:26
589000 -- (-477.262) (-478.829) (-480.308) [-478.541] * (-478.450) (-478.653) (-480.644) [-476.430] -- 0:00:26
589500 -- [-476.254] (-477.996) (-481.444) (-477.071) * (-482.365) [-479.238] (-480.201) (-477.926) -- 0:00:26
590000 -- [-479.453] (-481.135) (-481.176) (-480.337) * (-476.893) (-480.786) (-479.198) [-476.040] -- 0:00:26
Average standard deviation of split frequencies: 0.009258
590500 -- (-482.491) (-479.874) [-478.050] (-480.741) * [-476.891] (-482.115) (-477.019) (-483.120) -- 0:00:26
591000 -- (-479.763) (-479.265) [-477.298] (-479.170) * (-487.265) (-479.852) [-475.147] (-478.600) -- 0:00:26
591500 -- (-478.752) (-481.350) [-475.327] (-476.406) * (-478.737) (-483.031) [-478.936] (-478.219) -- 0:00:26
592000 -- (-481.029) (-476.973) (-479.704) [-478.720] * (-479.045) [-479.051] (-484.026) (-477.604) -- 0:00:26
592500 -- (-478.618) (-476.255) [-477.437] (-482.516) * (-479.381) (-476.371) (-478.048) [-478.385] -- 0:00:26
593000 -- (-478.257) (-483.131) (-478.648) [-476.672] * (-477.004) (-480.018) [-477.256] (-479.531) -- 0:00:26
593500 -- (-476.723) (-480.638) [-477.958] (-478.853) * (-482.648) (-481.414) [-477.666] (-477.376) -- 0:00:26
594000 -- [-480.183] (-479.684) (-480.729) (-478.979) * (-478.217) (-476.121) [-479.679] (-479.628) -- 0:00:25
594500 -- (-479.379) (-478.161) [-480.789] (-477.204) * [-476.160] (-477.496) (-479.484) (-477.931) -- 0:00:25
595000 -- (-477.328) (-479.137) (-478.845) [-479.827] * (-476.222) (-476.812) (-478.257) [-476.974] -- 0:00:25
Average standard deviation of split frequencies: 0.009491
595500 -- (-476.169) (-476.315) (-479.539) [-476.359] * [-478.176] (-477.179) (-479.180) (-478.157) -- 0:00:25
596000 -- (-474.931) (-476.404) [-477.769] (-475.577) * [-476.810] (-477.127) (-477.396) (-478.518) -- 0:00:25
596500 -- [-476.644] (-480.020) (-479.020) (-476.574) * [-476.285] (-477.435) (-476.633) (-476.867) -- 0:00:25
597000 -- (-478.894) (-477.637) (-478.703) [-477.301] * (-478.088) (-478.934) (-477.378) [-477.398] -- 0:00:25
597500 -- (-480.829) [-479.683] (-479.835) (-480.350) * (-478.305) (-478.791) [-478.794] (-484.092) -- 0:00:25
598000 -- [-478.791] (-477.113) (-482.011) (-478.550) * (-484.510) [-478.575] (-478.072) (-479.868) -- 0:00:25
598500 -- (-476.106) (-479.722) [-478.933] (-477.652) * (-477.834) (-476.523) [-476.588] (-479.635) -- 0:00:25
599000 -- [-476.962] (-482.496) (-479.195) (-478.625) * (-477.789) (-478.673) [-479.550] (-477.683) -- 0:00:25
599500 -- (-478.788) (-475.522) [-478.366] (-477.989) * (-481.633) (-479.708) (-481.160) [-479.246] -- 0:00:25
600000 -- [-478.877] (-475.516) (-478.674) (-484.383) * (-480.002) (-475.450) (-478.961) [-475.659] -- 0:00:25
Average standard deviation of split frequencies: 0.009261
600500 -- (-478.282) (-477.776) [-477.851] (-480.009) * (-480.061) (-475.869) (-477.452) [-480.605] -- 0:00:25
601000 -- (-479.418) [-476.301] (-478.653) (-479.315) * (-479.430) (-478.355) (-479.160) [-477.056] -- 0:00:25
601500 -- (-477.161) [-475.915] (-479.807) (-476.427) * (-481.857) (-476.372) (-479.189) [-476.985] -- 0:00:25
602000 -- (-479.784) (-476.247) (-478.694) [-477.065] * (-479.536) (-477.577) [-478.071] (-479.720) -- 0:00:25
602500 -- (-482.274) (-477.156) (-477.756) [-477.590] * (-480.777) [-475.618] (-480.056) (-477.028) -- 0:00:25
603000 -- (-476.931) (-476.644) (-480.404) [-477.971] * (-480.932) [-475.335] (-479.246) (-478.447) -- 0:00:25
603500 -- (-477.803) (-477.300) (-480.071) [-479.846] * (-479.052) (-477.398) (-478.108) [-478.216] -- 0:00:25
604000 -- (-477.032) [-477.569] (-476.685) (-478.031) * [-478.105] (-480.573) (-480.664) (-479.313) -- 0:00:25
604500 -- (-479.251) (-479.683) [-477.906] (-477.348) * [-477.969] (-478.579) (-479.309) (-481.057) -- 0:00:25
605000 -- (-476.055) [-478.704] (-477.657) (-480.811) * (-477.912) [-476.350] (-480.653) (-479.089) -- 0:00:25
Average standard deviation of split frequencies: 0.009387
605500 -- (-478.120) (-478.276) [-484.486] (-478.670) * (-478.903) [-476.683] (-482.161) (-477.245) -- 0:00:25
606000 -- [-478.815] (-488.909) (-479.698) (-478.334) * (-477.870) [-476.616] (-478.240) (-478.961) -- 0:00:25
606500 -- (-475.975) (-480.046) (-476.955) [-478.616] * [-476.352] (-478.775) (-480.127) (-479.111) -- 0:00:25
607000 -- [-478.288] (-477.894) (-478.328) (-478.871) * (-477.526) (-477.847) (-479.694) [-480.068] -- 0:00:25
607500 -- (-478.810) (-480.495) [-476.987] (-477.128) * (-476.227) [-476.759] (-480.313) (-479.334) -- 0:00:25
608000 -- (-477.838) (-477.495) (-478.474) [-479.434] * (-476.613) (-476.435) (-478.669) [-477.507] -- 0:00:25
608500 -- (-478.192) (-478.572) [-479.291] (-478.665) * [-481.141] (-477.875) (-478.761) (-476.314) -- 0:00:25
609000 -- (-480.723) (-477.440) (-479.520) [-477.560] * (-479.757) [-476.104] (-479.244) (-477.168) -- 0:00:25
609500 -- (-479.742) (-476.743) [-481.785] (-476.481) * (-486.887) (-477.207) [-477.502] (-477.836) -- 0:00:24
610000 -- (-477.789) (-477.483) (-482.411) [-478.218] * (-479.806) [-477.198] (-484.715) (-477.953) -- 0:00:24
Average standard deviation of split frequencies: 0.009727
610500 -- [-476.688] (-478.595) (-478.509) (-479.772) * (-475.901) (-478.891) (-477.592) [-478.218] -- 0:00:24
611000 -- (-478.213) [-478.840] (-478.342) (-475.965) * (-482.364) (-477.777) (-478.933) [-478.543] -- 0:00:24
611500 -- (-476.587) (-479.160) [-477.912] (-480.978) * (-479.646) (-475.770) [-479.422] (-478.745) -- 0:00:24
612000 -- (-479.053) (-481.624) (-477.314) [-478.572] * [-477.674] (-476.082) (-477.515) (-481.048) -- 0:00:24
612500 -- (-477.136) [-478.919] (-479.240) (-481.844) * (-476.920) [-475.467] (-477.287) (-479.352) -- 0:00:24
613000 -- (-476.254) (-478.213) [-480.163] (-480.578) * (-477.626) (-480.251) (-477.570) [-477.911] -- 0:00:24
613500 -- (-478.279) [-478.353] (-479.183) (-480.346) * (-479.766) (-478.885) (-478.993) [-479.387] -- 0:00:24
614000 -- (-476.113) [-476.611] (-479.866) (-481.997) * (-478.966) (-474.979) [-478.383] (-475.370) -- 0:00:24
614500 -- (-477.571) [-477.645] (-480.905) (-480.444) * (-477.509) (-477.940) (-479.840) [-476.995] -- 0:00:24
615000 -- (-485.397) (-480.554) (-478.115) [-479.069] * [-478.776] (-481.797) (-479.321) (-479.515) -- 0:00:24
Average standard deviation of split frequencies: 0.009795
615500 -- [-478.696] (-478.005) (-482.671) (-481.585) * (-480.059) (-482.747) [-479.253] (-478.573) -- 0:00:24
616000 -- (-481.293) [-475.804] (-484.642) (-479.520) * (-478.445) (-480.890) (-477.313) [-480.141] -- 0:00:24
616500 -- (-478.491) [-478.049] (-480.191) (-477.012) * (-479.624) (-481.332) [-476.810] (-478.321) -- 0:00:24
617000 -- (-480.446) (-476.808) (-479.594) [-477.050] * [-479.034] (-478.338) (-478.243) (-476.632) -- 0:00:24
617500 -- (-480.246) [-476.444] (-477.496) (-476.809) * (-480.349) (-477.331) (-479.323) [-477.376] -- 0:00:24
618000 -- (-478.058) [-482.480] (-477.718) (-480.720) * (-477.500) (-478.396) [-476.850] (-480.447) -- 0:00:24
618500 -- [-476.585] (-479.798) (-477.637) (-478.302) * (-480.398) (-478.614) (-478.855) [-480.265] -- 0:00:24
619000 -- [-480.721] (-476.503) (-477.612) (-478.142) * (-479.294) (-481.086) [-476.374] (-486.856) -- 0:00:24
619500 -- (-480.421) (-479.212) [-479.273] (-479.251) * (-476.920) (-478.866) (-477.251) [-480.502] -- 0:00:24
620000 -- (-477.546) (-478.345) [-476.293] (-476.020) * (-479.277) (-479.547) [-478.028] (-479.961) -- 0:00:24
Average standard deviation of split frequencies: 0.010228
620500 -- (-476.310) (-478.519) [-478.092] (-476.754) * [-479.902] (-483.404) (-475.835) (-477.899) -- 0:00:24
621000 -- (-479.111) [-479.567] (-477.088) (-475.935) * (-482.047) (-483.111) (-476.802) [-480.018] -- 0:00:24
621500 -- (-476.560) (-477.462) (-479.040) [-478.795] * [-477.774] (-479.485) (-476.446) (-478.576) -- 0:00:24
622000 -- (-476.601) (-476.525) [-477.214] (-477.731) * (-480.370) (-480.204) (-475.896) [-477.808] -- 0:00:24
622500 -- (-478.809) [-482.851] (-477.584) (-480.467) * (-476.490) (-479.160) [-476.666] (-476.890) -- 0:00:24
623000 -- (-479.560) (-477.709) (-477.720) [-477.908] * (-476.613) (-478.272) [-477.700] (-479.397) -- 0:00:24
623500 -- [-480.892] (-477.853) (-480.392) (-478.759) * (-478.064) (-478.007) (-475.883) [-482.695] -- 0:00:24
624000 -- (-482.828) (-476.109) [-477.071] (-477.372) * [-480.458] (-480.631) (-475.727) (-479.821) -- 0:00:24
624500 -- (-477.933) (-479.461) [-475.247] (-478.381) * (-482.201) (-476.712) [-476.210] (-479.658) -- 0:00:24
625000 -- (-476.713) [-478.948] (-477.702) (-477.847) * (-478.737) (-478.403) [-477.805] (-478.449) -- 0:00:24
Average standard deviation of split frequencies: 0.009890
625500 -- (-481.643) (-478.541) (-476.692) [-476.924] * [-477.750] (-478.584) (-474.825) (-480.853) -- 0:00:23
626000 -- (-477.623) [-475.235] (-481.147) (-477.284) * [-478.320] (-479.189) (-480.889) (-481.557) -- 0:00:23
626500 -- (-480.864) (-477.221) [-479.725] (-477.667) * (-479.289) [-477.955] (-475.838) (-481.068) -- 0:00:23
627000 -- [-476.367] (-481.066) (-478.702) (-478.759) * (-479.135) [-476.163] (-476.622) (-480.886) -- 0:00:23
627500 -- [-476.920] (-478.236) (-478.708) (-476.687) * (-478.268) (-478.948) [-475.345] (-477.976) -- 0:00:23
628000 -- (-476.930) (-476.680) (-478.300) [-478.405] * [-477.080] (-478.678) (-478.598) (-477.510) -- 0:00:23
628500 -- (-476.455) [-477.712] (-475.259) (-481.929) * (-480.286) (-478.051) (-480.212) [-479.831] -- 0:00:23
629000 -- (-477.087) (-477.556) [-478.019] (-481.005) * (-476.116) (-480.091) (-481.242) [-475.742] -- 0:00:23
629500 -- (-481.491) (-477.819) [-480.485] (-477.229) * (-480.421) (-478.414) (-476.815) [-478.852] -- 0:00:23
630000 -- (-484.095) (-477.126) (-477.760) [-477.431] * (-480.138) (-478.545) [-475.280] (-479.848) -- 0:00:23
Average standard deviation of split frequencies: 0.010315
630500 -- (-476.341) [-477.877] (-476.661) (-486.489) * (-478.784) (-480.282) [-478.745] (-479.248) -- 0:00:23
631000 -- (-478.539) (-478.271) (-479.898) [-478.713] * [-478.689] (-482.698) (-478.475) (-478.285) -- 0:00:23
631500 -- (-478.887) [-476.902] (-482.733) (-476.786) * (-480.632) [-476.480] (-478.637) (-477.932) -- 0:00:23
632000 -- (-479.213) [-478.692] (-477.081) (-476.830) * (-481.180) (-476.517) (-479.480) [-478.169] -- 0:00:23
632500 -- (-479.293) (-478.393) [-477.541] (-479.165) * (-478.219) [-477.207] (-477.879) (-479.063) -- 0:00:23
633000 -- (-478.362) (-479.444) [-477.828] (-480.851) * (-477.401) [-478.064] (-476.532) (-479.128) -- 0:00:23
633500 -- (-477.583) [-477.960] (-478.808) (-478.211) * (-476.913) (-481.114) (-478.653) [-479.824] -- 0:00:23
634000 -- (-477.504) (-478.372) [-478.002] (-479.190) * [-480.673] (-478.219) (-481.856) (-480.143) -- 0:00:23
634500 -- (-479.908) (-478.255) [-476.175] (-477.512) * [-485.945] (-478.550) (-486.461) (-475.856) -- 0:00:23
635000 -- (-478.863) [-479.208] (-479.789) (-479.218) * (-480.010) [-478.332] (-478.287) (-477.768) -- 0:00:23
Average standard deviation of split frequencies: 0.010031
635500 -- (-480.431) (-482.267) (-481.286) [-479.449] * (-478.031) (-477.909) [-479.871] (-477.977) -- 0:00:23
636000 -- (-478.402) (-478.687) (-479.244) [-477.693] * (-477.481) [-478.559] (-482.576) (-475.088) -- 0:00:23
636500 -- (-477.810) (-476.279) [-479.498] (-477.331) * (-480.468) (-478.433) (-478.610) [-477.442] -- 0:00:23
637000 -- (-478.449) (-475.767) (-478.932) [-477.100] * (-479.501) (-479.312) (-479.569) [-478.145] -- 0:00:23
637500 -- (-476.263) (-476.217) (-477.793) [-476.875] * [-479.059] (-483.120) (-480.647) (-478.674) -- 0:00:23
638000 -- [-479.106] (-477.645) (-480.220) (-480.222) * (-477.081) (-482.124) (-480.828) [-478.282] -- 0:00:23
638500 -- (-478.011) (-479.150) [-477.702] (-479.965) * (-480.384) (-475.608) [-478.779] (-482.165) -- 0:00:23
639000 -- (-477.952) (-480.168) [-479.034] (-483.428) * [-478.276] (-479.517) (-478.511) (-479.819) -- 0:00:23
639500 -- (-478.331) (-477.668) [-474.698] (-479.801) * (-477.644) (-480.707) (-479.264) [-477.069] -- 0:00:23
640000 -- [-476.229] (-477.154) (-485.140) (-483.605) * (-483.042) [-477.770] (-481.244) (-476.244) -- 0:00:23
Average standard deviation of split frequencies: 0.009369
640500 -- (-477.860) (-478.033) [-477.449] (-477.363) * (-484.577) [-476.418] (-478.842) (-477.935) -- 0:00:23
641000 -- (-477.194) (-479.152) [-477.551] (-478.153) * (-482.729) [-477.598] (-480.011) (-477.216) -- 0:00:22
641500 -- (-479.584) (-477.576) [-479.760] (-479.984) * [-480.857] (-482.818) (-480.788) (-478.084) -- 0:00:22
642000 -- [-478.452] (-480.684) (-480.558) (-478.541) * [-481.613] (-480.639) (-480.190) (-479.118) -- 0:00:22
642500 -- (-477.679) (-479.699) (-480.756) [-478.024] * (-480.279) (-478.177) (-479.228) [-478.073] -- 0:00:22
643000 -- (-479.145) (-480.655) (-478.929) [-477.298] * (-480.384) [-476.051] (-478.057) (-480.051) -- 0:00:22
643500 -- (-478.027) (-477.550) [-477.916] (-477.150) * (-480.580) [-477.295] (-478.395) (-480.964) -- 0:00:22
644000 -- [-481.536] (-479.356) (-481.675) (-478.415) * (-481.883) (-475.541) (-476.158) [-479.463] -- 0:00:22
644500 -- (-477.951) [-477.532] (-476.946) (-478.412) * (-478.635) (-484.297) [-477.048] (-480.937) -- 0:00:22
645000 -- (-480.183) (-482.363) (-475.221) [-480.010] * (-476.522) (-485.345) (-482.657) [-481.119] -- 0:00:22
Average standard deviation of split frequencies: 0.009389
645500 -- [-478.761] (-481.297) (-479.655) (-479.500) * (-477.802) (-482.337) (-481.795) [-477.347] -- 0:00:22
646000 -- (-477.179) (-476.784) (-479.628) [-476.481] * (-478.615) [-479.237] (-481.648) (-478.041) -- 0:00:22
646500 -- (-474.334) [-479.513] (-478.125) (-481.703) * [-478.373] (-482.891) (-479.333) (-478.834) -- 0:00:22
647000 -- (-476.599) [-476.020] (-482.683) (-478.967) * (-476.524) [-477.292] (-480.820) (-480.555) -- 0:00:22
647500 -- [-478.520] (-477.460) (-482.012) (-477.872) * (-477.140) (-477.887) (-479.870) [-477.644] -- 0:00:22
648000 -- (-476.946) [-477.054] (-477.113) (-479.495) * (-481.112) (-479.908) [-479.229] (-481.200) -- 0:00:22
648500 -- [-476.547] (-476.647) (-479.348) (-479.829) * (-480.342) (-478.515) [-478.719] (-480.211) -- 0:00:22
649000 -- (-477.118) (-476.535) [-479.839] (-482.065) * (-479.247) (-478.513) [-480.177] (-477.644) -- 0:00:22
649500 -- (-481.719) [-477.259] (-478.879) (-479.153) * (-477.146) [-476.209] (-479.962) (-478.266) -- 0:00:22
650000 -- (-481.792) [-476.576] (-477.937) (-481.212) * (-478.874) (-477.298) (-478.324) [-481.006] -- 0:00:22
Average standard deviation of split frequencies: 0.008163
650500 -- (-477.803) (-479.179) [-478.454] (-482.562) * (-480.064) (-479.642) [-478.432] (-476.712) -- 0:00:22
651000 -- [-475.446] (-476.216) (-479.268) (-480.049) * (-480.162) (-479.139) (-479.249) [-478.470] -- 0:00:22
651500 -- (-476.626) (-478.321) [-480.061] (-476.492) * (-478.372) (-477.915) (-477.033) [-479.923] -- 0:00:22
652000 -- (-479.027) (-477.970) [-478.988] (-478.608) * (-481.641) (-484.376) (-476.230) [-477.044] -- 0:00:22
652500 -- (-478.929) (-485.142) [-481.693] (-477.196) * (-481.844) (-480.445) (-479.648) [-479.073] -- 0:00:22
653000 -- (-480.384) (-477.076) (-477.925) [-476.898] * (-476.326) (-479.957) [-479.768] (-476.100) -- 0:00:22
653500 -- (-477.358) (-477.887) [-481.260] (-478.912) * (-478.841) [-477.819] (-478.391) (-475.709) -- 0:00:22
654000 -- [-477.899] (-477.027) (-478.086) (-479.407) * (-477.861) [-476.370] (-477.320) (-479.576) -- 0:00:22
654500 -- (-476.097) (-478.550) (-477.795) [-479.398] * [-475.969] (-478.789) (-477.780) (-478.675) -- 0:00:22
655000 -- (-477.757) (-478.181) (-478.827) [-476.472] * (-479.403) [-476.296] (-482.825) (-479.045) -- 0:00:22
Average standard deviation of split frequencies: 0.008432
655500 -- (-483.594) [-474.727] (-480.716) (-477.223) * (-478.275) [-476.088] (-479.577) (-478.951) -- 0:00:22
656000 -- (-480.699) [-476.239] (-478.006) (-476.493) * [-478.375] (-477.920) (-480.530) (-475.928) -- 0:00:22
656500 -- (-479.441) (-478.225) [-480.103] (-477.354) * (-479.817) (-480.592) [-478.022] (-478.118) -- 0:00:21
657000 -- [-478.868] (-479.909) (-479.915) (-476.154) * (-480.947) (-479.472) [-477.514] (-483.196) -- 0:00:21
657500 -- (-482.613) [-476.944] (-479.133) (-476.219) * (-479.982) (-477.140) (-481.186) [-476.767] -- 0:00:21
658000 -- (-480.139) (-479.270) (-477.408) [-476.659] * (-477.215) [-477.763] (-481.930) (-478.476) -- 0:00:21
658500 -- (-479.200) (-485.685) (-480.778) [-476.161] * (-484.385) (-477.202) (-476.486) [-477.732] -- 0:00:21
659000 -- [-476.839] (-480.976) (-478.209) (-476.818) * (-482.780) (-480.439) (-481.942) [-478.482] -- 0:00:21
659500 -- (-476.825) [-479.799] (-475.801) (-478.121) * [-479.456] (-479.323) (-480.960) (-481.764) -- 0:00:21
660000 -- (-481.777) (-475.617) [-476.917] (-478.624) * (-481.462) [-481.947] (-478.237) (-483.966) -- 0:00:21
Average standard deviation of split frequencies: 0.008562
660500 -- (-484.383) [-475.891] (-478.440) (-477.066) * (-481.041) (-477.999) (-477.569) [-479.167] -- 0:00:21
661000 -- (-485.396) [-477.972] (-480.607) (-475.819) * (-477.108) [-477.038] (-480.598) (-478.320) -- 0:00:21
661500 -- (-478.043) [-478.634] (-479.021) (-479.367) * (-479.143) [-478.236] (-482.183) (-482.803) -- 0:00:21
662000 -- (-478.369) (-476.072) [-478.936] (-477.803) * (-476.580) (-479.732) [-478.006] (-482.624) -- 0:00:21
662500 -- (-481.488) [-478.519] (-477.477) (-478.895) * [-479.202] (-486.304) (-480.164) (-477.322) -- 0:00:21
663000 -- (-477.809) [-481.041] (-478.098) (-475.757) * [-478.958] (-478.133) (-479.466) (-482.236) -- 0:00:21
663500 -- [-477.556] (-478.090) (-483.170) (-476.959) * (-478.318) (-480.207) [-480.042] (-478.463) -- 0:00:21
664000 -- (-477.138) (-477.951) [-484.706] (-478.408) * (-478.428) (-478.770) [-478.572] (-476.242) -- 0:00:21
664500 -- (-479.401) (-476.015) [-481.919] (-478.717) * [-477.406] (-484.292) (-476.282) (-478.704) -- 0:00:21
665000 -- (-479.067) (-482.269) [-477.652] (-477.823) * (-476.693) (-476.236) [-477.994] (-480.059) -- 0:00:21
Average standard deviation of split frequencies: 0.008635
665500 -- (-479.643) [-478.643] (-477.747) (-489.098) * (-478.012) [-479.459] (-478.649) (-480.378) -- 0:00:21
666000 -- (-478.818) (-479.757) [-479.071] (-477.224) * [-478.166] (-478.706) (-478.531) (-480.134) -- 0:00:21
666500 -- (-483.992) [-476.745] (-478.885) (-478.268) * (-476.100) [-479.510] (-479.557) (-478.246) -- 0:00:21
667000 -- (-476.346) (-477.970) [-480.173] (-476.154) * (-479.483) [-477.942] (-478.845) (-478.795) -- 0:00:21
667500 -- (-478.528) (-474.649) [-475.240] (-479.738) * (-477.990) [-476.365] (-479.442) (-482.643) -- 0:00:21
668000 -- (-475.912) (-478.661) [-481.716] (-483.107) * [-478.710] (-480.016) (-480.826) (-477.638) -- 0:00:21
668500 -- (-478.848) (-476.718) (-480.091) [-478.910] * (-480.322) (-478.395) (-476.330) [-477.233] -- 0:00:21
669000 -- (-477.100) (-477.188) [-479.242] (-476.874) * (-478.406) [-477.028] (-479.435) (-476.341) -- 0:00:21
669500 -- [-475.821] (-478.772) (-481.651) (-483.118) * (-477.776) (-479.324) (-481.220) [-476.478] -- 0:00:21
670000 -- (-478.002) (-477.060) [-477.758] (-480.797) * [-478.874] (-477.829) (-477.159) (-481.923) -- 0:00:21
Average standard deviation of split frequencies: 0.008482
670500 -- (-476.743) (-482.572) [-477.677] (-480.246) * (-479.994) [-478.124] (-478.140) (-479.901) -- 0:00:21
671000 -- [-477.638] (-476.073) (-478.376) (-475.640) * (-476.028) [-478.641] (-477.237) (-477.388) -- 0:00:21
671500 -- (-476.774) [-480.492] (-476.191) (-478.807) * (-478.319) (-480.396) [-479.138] (-478.208) -- 0:00:21
672000 -- [-477.066] (-481.961) (-478.190) (-483.531) * [-480.359] (-484.688) (-481.075) (-478.521) -- 0:00:20
672500 -- [-480.438] (-477.135) (-479.349) (-480.909) * (-479.186) (-479.192) [-480.039] (-479.069) -- 0:00:20
673000 -- (-478.871) [-477.665] (-479.952) (-480.931) * (-478.732) (-479.994) [-477.921] (-479.776) -- 0:00:20
673500 -- [-479.639] (-478.219) (-479.120) (-478.923) * [-479.405] (-481.725) (-478.906) (-477.746) -- 0:00:20
674000 -- [-477.349] (-477.699) (-478.317) (-480.108) * (-480.327) [-479.338] (-479.178) (-477.576) -- 0:00:20
674500 -- [-476.692] (-476.691) (-479.309) (-480.599) * (-477.666) (-479.224) [-478.823] (-477.508) -- 0:00:20
675000 -- [-478.891] (-478.673) (-478.059) (-482.131) * (-477.730) [-476.815] (-478.663) (-476.527) -- 0:00:20
Average standard deviation of split frequencies: 0.009019
675500 -- (-477.075) (-476.068) [-477.348] (-485.328) * (-479.982) [-478.597] (-477.074) (-476.588) -- 0:00:20
676000 -- [-477.663] (-479.246) (-480.178) (-477.747) * (-483.747) (-480.366) [-476.698] (-478.124) -- 0:00:20
676500 -- (-477.359) (-478.320) (-481.503) [-481.174] * (-482.187) (-478.410) [-481.488] (-477.206) -- 0:00:20
677000 -- (-480.432) (-482.281) (-476.725) [-478.500] * [-477.521] (-480.778) (-480.219) (-476.124) -- 0:00:20
677500 -- (-476.499) [-477.554] (-479.052) (-479.441) * (-476.980) (-479.993) [-478.398] (-478.656) -- 0:00:20
678000 -- (-478.721) [-476.103] (-481.214) (-479.761) * (-478.716) (-482.502) [-476.998] (-477.176) -- 0:00:20
678500 -- (-477.971) (-484.410) [-476.626] (-483.557) * (-477.026) (-477.128) [-476.035] (-479.122) -- 0:00:20
679000 -- [-478.480] (-480.162) (-477.048) (-479.544) * [-475.760] (-475.693) (-479.436) (-478.074) -- 0:00:20
679500 -- (-479.053) (-480.257) (-477.068) [-481.526] * [-476.837] (-478.531) (-483.367) (-476.888) -- 0:00:20
680000 -- (-483.945) (-478.126) [-476.790] (-482.240) * (-478.056) (-477.711) [-476.682] (-475.173) -- 0:00:20
Average standard deviation of split frequencies: 0.008634
680500 -- (-478.263) (-480.415) [-479.425] (-479.482) * [-481.566] (-477.540) (-478.312) (-478.972) -- 0:00:20
681000 -- (-479.636) (-478.533) [-478.258] (-478.493) * (-483.117) (-482.449) (-478.482) [-476.832] -- 0:00:20
681500 -- (-478.901) (-476.518) (-478.765) [-481.231] * (-479.189) (-478.214) (-477.283) [-476.950] -- 0:00:20
682000 -- [-481.353] (-477.028) (-476.444) (-476.665) * [-481.595] (-477.092) (-477.628) (-483.486) -- 0:00:20
682500 -- (-477.358) (-477.845) [-475.593] (-486.773) * (-480.020) (-481.146) [-476.652] (-475.211) -- 0:00:20
683000 -- [-480.636] (-478.577) (-478.832) (-478.085) * [-479.477] (-477.227) (-478.201) (-478.368) -- 0:00:20
683500 -- [-479.838] (-482.022) (-476.593) (-476.053) * (-481.034) [-475.965] (-480.543) (-475.635) -- 0:00:20
684000 -- (-479.601) (-482.123) [-476.952] (-478.340) * (-481.826) (-478.144) [-479.158] (-476.734) -- 0:00:20
684500 -- (-480.744) [-480.165] (-479.109) (-479.725) * (-476.139) [-477.875] (-479.481) (-478.667) -- 0:00:20
685000 -- (-480.457) [-477.704] (-477.304) (-480.751) * [-480.652] (-476.776) (-477.812) (-479.741) -- 0:00:20
Average standard deviation of split frequencies: 0.008155
685500 -- (-478.709) (-477.965) [-478.358] (-483.182) * (-476.020) (-478.514) [-476.069] (-478.736) -- 0:00:20
686000 -- (-479.048) (-475.950) [-479.508] (-480.063) * (-477.595) (-480.197) [-475.921] (-479.583) -- 0:00:20
686500 -- (-477.355) (-477.224) [-478.066] (-479.845) * [-476.626] (-478.550) (-477.656) (-479.909) -- 0:00:20
687000 -- (-477.949) (-478.124) (-478.417) [-478.378] * (-477.542) [-479.477] (-477.414) (-479.931) -- 0:00:20
687500 -- (-478.336) [-476.148] (-480.168) (-480.514) * (-477.945) (-477.620) [-478.010] (-477.768) -- 0:00:20
688000 -- (-478.922) [-479.724] (-475.285) (-476.965) * [-477.548] (-480.194) (-478.504) (-479.264) -- 0:00:19
688500 -- (-479.050) [-478.901] (-478.243) (-478.928) * (-476.812) (-481.473) (-477.830) [-478.415] -- 0:00:19
689000 -- (-478.938) (-482.780) (-478.945) [-476.949] * [-478.099] (-480.300) (-480.035) (-479.528) -- 0:00:19
689500 -- (-478.904) (-479.917) (-478.647) [-477.550] * (-476.395) (-484.557) [-480.197] (-483.180) -- 0:00:19
690000 -- (-479.297) [-479.041] (-479.637) (-481.065) * [-476.431] (-482.666) (-480.900) (-481.114) -- 0:00:19
Average standard deviation of split frequencies: 0.008418
690500 -- [-477.810] (-479.504) (-479.250) (-479.340) * [-478.099] (-479.484) (-479.944) (-477.908) -- 0:00:19
691000 -- (-483.730) [-476.909] (-476.532) (-479.263) * (-479.180) [-481.610] (-478.436) (-479.757) -- 0:00:19
691500 -- (-479.150) (-476.669) (-478.990) [-480.533] * [-477.449] (-483.632) (-482.620) (-479.616) -- 0:00:19
692000 -- (-478.410) [-476.896] (-479.521) (-480.538) * (-477.943) (-480.354) (-479.075) [-476.336] -- 0:00:19
692500 -- (-482.102) (-478.460) (-479.022) [-478.926] * (-479.251) [-478.556] (-476.843) (-479.366) -- 0:00:19
693000 -- (-481.845) [-476.757] (-479.066) (-478.819) * (-478.946) (-478.234) [-478.176] (-479.715) -- 0:00:19
693500 -- [-480.048] (-476.712) (-479.816) (-478.035) * [-478.623] (-479.741) (-479.455) (-477.289) -- 0:00:19
694000 -- (-480.693) (-478.863) (-479.849) [-476.796] * (-479.287) (-479.665) (-478.906) [-476.313] -- 0:00:19
694500 -- (-480.451) (-480.028) [-478.054] (-477.433) * (-478.869) (-479.517) [-477.089] (-477.528) -- 0:00:19
695000 -- (-481.889) [-477.503] (-475.713) (-478.651) * (-481.017) (-479.094) (-478.023) [-478.661] -- 0:00:19
Average standard deviation of split frequencies: 0.008760
695500 -- (-479.036) (-477.506) [-478.423] (-478.872) * [-477.663] (-480.259) (-475.537) (-480.038) -- 0:00:19
696000 -- (-479.789) (-478.582) (-479.318) [-477.691] * (-479.739) (-478.027) [-478.905] (-480.083) -- 0:00:19
696500 -- (-479.611) (-478.637) (-478.494) [-476.570] * (-478.341) [-477.854] (-479.599) (-476.858) -- 0:00:19
697000 -- (-480.930) [-477.988] (-480.978) (-476.536) * [-475.374] (-478.303) (-479.440) (-479.096) -- 0:00:19
697500 -- (-482.080) [-479.387] (-479.373) (-479.422) * (-476.403) [-481.144] (-476.566) (-477.457) -- 0:00:19
698000 -- (-483.714) (-479.341) [-477.553] (-482.846) * [-476.187] (-475.756) (-479.841) (-482.507) -- 0:00:19
698500 -- (-477.543) (-479.302) (-477.615) [-476.752] * [-476.165] (-477.390) (-478.553) (-479.351) -- 0:00:19
699000 -- [-477.117] (-480.564) (-479.692) (-478.398) * (-476.560) [-476.990] (-479.430) (-485.052) -- 0:00:19
699500 -- (-477.087) (-480.716) [-480.009] (-479.153) * (-479.966) (-476.010) (-479.753) [-480.461] -- 0:00:19
700000 -- (-476.442) [-479.418] (-480.004) (-481.971) * (-476.436) (-480.100) [-478.365] (-476.839) -- 0:00:19
Average standard deviation of split frequencies: 0.008298
700500 -- (-478.140) (-480.093) [-480.188] (-483.400) * (-476.102) (-478.733) [-477.284] (-477.919) -- 0:00:19
701000 -- [-475.262] (-479.585) (-478.193) (-481.246) * [-478.217] (-484.037) (-482.601) (-478.907) -- 0:00:19
701500 -- [-476.464] (-481.418) (-478.635) (-480.526) * (-477.844) (-478.105) (-481.723) [-479.259] -- 0:00:19
702000 -- (-480.137) (-481.040) (-480.779) [-479.378] * (-481.438) (-477.894) (-478.781) [-479.084] -- 0:00:19
702500 -- [-477.553] (-478.910) (-481.010) (-481.615) * (-480.622) [-478.714] (-479.181) (-480.617) -- 0:00:19
703000 -- [-478.563] (-478.806) (-479.897) (-476.968) * (-479.956) (-478.083) (-481.521) [-478.289] -- 0:00:19
703500 -- (-480.921) [-479.587] (-478.809) (-477.999) * [-481.902] (-483.730) (-476.410) (-477.695) -- 0:00:18
704000 -- (-477.781) [-479.617] (-479.794) (-481.656) * (-479.532) (-476.570) [-477.616] (-478.319) -- 0:00:18
704500 -- (-478.824) (-480.417) (-479.568) [-478.296] * (-480.853) (-476.547) [-476.362] (-481.050) -- 0:00:18
705000 -- [-479.183] (-477.058) (-478.282) (-479.212) * (-478.992) (-475.997) (-479.406) [-481.612] -- 0:00:18
Average standard deviation of split frequencies: 0.008235
705500 -- [-479.569] (-479.639) (-478.902) (-476.997) * (-478.096) [-475.946] (-477.169) (-480.720) -- 0:00:18
706000 -- (-479.307) (-476.880) [-477.023] (-482.631) * (-477.709) [-478.690] (-478.925) (-478.585) -- 0:00:18
706500 -- (-481.153) [-476.251] (-476.407) (-479.811) * (-476.460) (-476.624) (-479.780) [-478.423] -- 0:00:18
707000 -- (-480.361) (-479.137) [-477.283] (-481.808) * [-478.904] (-479.485) (-478.407) (-478.152) -- 0:00:18
707500 -- (-478.474) (-478.643) [-477.277] (-479.265) * (-478.748) (-477.946) [-476.108] (-477.742) -- 0:00:18
708000 -- [-479.854] (-479.911) (-482.055) (-478.173) * (-478.364) [-477.211] (-476.263) (-476.428) -- 0:00:18
708500 -- (-478.034) (-478.538) (-479.589) [-476.037] * (-477.349) (-483.650) (-477.250) [-476.570] -- 0:00:18
709000 -- (-479.200) (-478.450) (-478.181) [-478.145] * (-478.716) (-486.120) [-475.846] (-476.200) -- 0:00:18
709500 -- (-478.921) (-478.972) (-476.920) [-477.575] * [-478.230] (-484.113) (-479.620) (-476.927) -- 0:00:18
710000 -- (-476.673) (-478.846) (-479.480) [-476.670] * (-478.622) (-481.362) (-479.476) [-477.379] -- 0:00:18
Average standard deviation of split frequencies: 0.007960
710500 -- [-476.128] (-481.223) (-477.500) (-476.319) * (-480.800) [-479.105] (-477.177) (-479.046) -- 0:00:18
711000 -- [-475.839] (-479.635) (-481.769) (-475.786) * (-480.655) (-478.887) (-477.469) [-478.479] -- 0:00:18
711500 -- [-475.074] (-479.472) (-483.738) (-476.386) * (-481.522) (-477.813) (-479.664) [-474.245] -- 0:00:18
712000 -- (-476.749) [-478.225] (-482.597) (-477.309) * (-477.163) (-476.727) (-475.922) [-477.711] -- 0:00:18
712500 -- (-479.405) (-479.868) (-479.846) [-478.496] * [-477.742] (-478.437) (-478.375) (-478.046) -- 0:00:18
713000 -- [-478.166] (-476.777) (-479.995) (-479.803) * (-479.112) (-479.113) (-476.849) [-476.637] -- 0:00:18
713500 -- (-479.859) (-481.876) [-480.149] (-479.813) * (-478.744) (-479.572) [-477.614] (-476.614) -- 0:00:18
714000 -- (-479.190) [-478.574] (-481.561) (-477.694) * (-483.888) (-476.355) [-477.605] (-475.670) -- 0:00:18
714500 -- (-477.399) [-481.040] (-479.092) (-476.127) * [-477.866] (-475.805) (-482.778) (-478.783) -- 0:00:18
715000 -- [-478.326] (-480.253) (-479.757) (-480.160) * (-479.924) (-476.230) [-475.173] (-481.701) -- 0:00:18
Average standard deviation of split frequencies: 0.007857
715500 -- (-478.948) (-479.097) (-478.194) [-479.006] * (-477.749) (-477.795) [-478.170] (-480.025) -- 0:00:18
716000 -- (-478.611) [-476.807] (-480.622) (-480.242) * (-478.397) [-478.395] (-480.654) (-477.061) -- 0:00:18
716500 -- (-480.316) [-476.387] (-479.484) (-476.500) * (-478.285) [-477.061] (-478.261) (-478.222) -- 0:00:18
717000 -- (-479.650) [-477.939] (-476.834) (-479.881) * (-478.676) (-478.723) [-479.339] (-477.423) -- 0:00:18
717500 -- (-477.775) (-476.385) [-477.452] (-479.643) * (-478.753) [-479.092] (-477.604) (-478.602) -- 0:00:18
718000 -- [-477.957] (-478.381) (-477.222) (-481.790) * (-477.313) [-478.413] (-477.987) (-478.995) -- 0:00:18
718500 -- (-481.910) [-478.548] (-478.840) (-478.799) * (-479.802) [-479.587] (-476.635) (-480.252) -- 0:00:18
719000 -- (-478.468) [-478.052] (-478.665) (-478.873) * (-481.072) (-481.570) [-474.887] (-481.204) -- 0:00:17
719500 -- [-478.382] (-478.736) (-479.754) (-481.364) * (-483.705) [-477.350] (-476.875) (-476.849) -- 0:00:17
720000 -- (-479.668) (-476.912) (-479.607) [-481.890] * (-480.524) (-477.095) (-476.542) [-478.372] -- 0:00:18
Average standard deviation of split frequencies: 0.007631
720500 -- (-478.676) (-477.978) [-477.778] (-482.136) * (-476.408) (-475.422) (-477.669) [-478.607] -- 0:00:18
721000 -- (-484.461) [-478.721] (-480.763) (-477.627) * [-478.198] (-478.794) (-479.047) (-475.079) -- 0:00:18
721500 -- (-478.277) (-479.024) [-480.792] (-477.007) * (-479.904) (-478.516) (-479.971) [-479.823] -- 0:00:18
722000 -- [-480.221] (-476.780) (-477.528) (-478.786) * (-480.562) (-478.225) (-477.429) [-477.210] -- 0:00:18
722500 -- (-479.554) [-476.341] (-475.684) (-479.113) * [-478.801] (-477.250) (-482.756) (-476.364) -- 0:00:18
723000 -- [-478.709] (-478.437) (-477.999) (-483.394) * [-481.838] (-481.495) (-480.441) (-478.408) -- 0:00:18
723500 -- (-478.034) (-477.881) (-476.633) [-476.225] * (-480.639) (-477.891) [-481.024] (-480.518) -- 0:00:17
724000 -- (-478.108) (-475.816) [-478.354] (-476.509) * (-478.497) [-477.963] (-481.850) (-477.774) -- 0:00:17
724500 -- [-478.626] (-481.286) (-477.495) (-483.566) * (-478.280) (-482.256) (-478.253) [-481.471] -- 0:00:17
725000 -- (-478.834) (-476.256) (-478.255) [-477.100] * [-484.943] (-478.704) (-478.637) (-477.197) -- 0:00:17
Average standard deviation of split frequencies: 0.007532
725500 -- (-477.128) (-478.172) (-483.830) [-476.552] * (-478.352) (-479.492) (-478.989) [-478.284] -- 0:00:17
726000 -- (-481.076) (-480.363) (-476.833) [-477.805] * (-478.717) [-476.264] (-477.494) (-477.239) -- 0:00:17
726500 -- (-481.033) (-484.004) (-477.970) [-477.689] * [-477.626] (-476.756) (-477.594) (-478.995) -- 0:00:17
727000 -- (-480.382) [-478.427] (-477.972) (-478.761) * [-481.456] (-477.346) (-480.420) (-475.930) -- 0:00:17
727500 -- [-477.813] (-479.986) (-479.457) (-480.821) * (-489.027) (-477.612) (-481.663) [-475.803] -- 0:00:17
728000 -- (-478.394) [-477.111] (-476.913) (-475.770) * (-479.341) [-477.676] (-479.452) (-479.044) -- 0:00:17
728500 -- (-479.374) (-479.489) [-477.896] (-477.515) * (-484.102) (-480.345) (-476.439) [-477.782] -- 0:00:17
729000 -- (-478.795) (-476.899) (-476.918) [-477.950] * (-481.421) (-478.281) (-477.621) [-479.792] -- 0:00:17
729500 -- (-478.021) (-480.394) (-478.772) [-475.217] * (-480.274) (-477.193) [-477.282] (-480.641) -- 0:00:17
730000 -- [-478.707] (-484.890) (-480.314) (-477.046) * [-480.370] (-478.737) (-478.083) (-479.455) -- 0:00:17
Average standard deviation of split frequencies: 0.006581
730500 -- (-478.815) (-479.579) [-477.845] (-478.125) * (-478.873) [-480.033] (-479.045) (-481.277) -- 0:00:17
731000 -- [-477.358] (-480.238) (-477.625) (-477.045) * (-476.346) (-475.981) [-477.927] (-481.089) -- 0:00:17
731500 -- (-476.257) [-480.074] (-478.510) (-478.311) * (-476.602) (-478.311) (-479.359) [-481.773] -- 0:00:17
732000 -- [-483.372] (-478.667) (-477.235) (-477.011) * (-479.186) (-478.412) [-478.315] (-476.489) -- 0:00:17
732500 -- (-477.339) (-476.806) [-477.234] (-478.713) * (-478.420) (-477.187) [-476.727] (-478.017) -- 0:00:17
733000 -- (-476.399) (-478.124) [-479.022] (-479.400) * [-477.679] (-478.672) (-478.799) (-476.733) -- 0:00:17
733500 -- [-479.621] (-479.556) (-478.568) (-477.729) * (-476.968) [-478.611] (-479.133) (-480.085) -- 0:00:17
734000 -- [-478.418] (-477.267) (-476.682) (-481.242) * (-479.219) (-479.007) [-477.350] (-477.303) -- 0:00:17
734500 -- [-478.158] (-476.321) (-477.725) (-479.388) * (-479.195) [-476.896] (-476.837) (-476.658) -- 0:00:16
735000 -- (-477.037) [-479.983] (-477.238) (-481.127) * (-478.002) (-480.358) [-476.506] (-480.418) -- 0:00:17
Average standard deviation of split frequencies: 0.006917
735500 -- (-475.836) (-479.610) (-474.949) [-476.574] * (-478.184) (-479.165) [-478.655] (-477.123) -- 0:00:17
736000 -- (-478.191) [-476.474] (-481.645) (-480.202) * (-481.495) (-478.846) (-480.907) [-477.624] -- 0:00:17
736500 -- (-476.268) [-477.271] (-477.551) (-478.465) * [-475.016] (-481.009) (-478.052) (-475.636) -- 0:00:17
737000 -- (-477.325) (-476.981) [-477.297] (-477.722) * [-481.139] (-479.342) (-479.160) (-476.663) -- 0:00:17
737500 -- (-478.060) (-475.535) (-477.007) [-478.125] * (-479.581) (-478.042) (-476.054) [-475.344] -- 0:00:17
738000 -- (-477.588) [-481.034] (-478.566) (-478.960) * (-482.244) (-480.992) [-478.359] (-476.577) -- 0:00:17
738500 -- (-477.666) [-479.047] (-478.295) (-477.099) * [-478.224] (-479.624) (-477.568) (-476.154) -- 0:00:16
739000 -- (-482.656) [-474.476] (-482.365) (-475.374) * (-481.596) (-477.304) (-476.815) [-477.335] -- 0:00:16
739500 -- (-476.331) (-479.815) (-478.319) [-480.146] * (-477.227) (-479.137) (-477.002) [-480.644] -- 0:00:16
740000 -- (-479.054) (-476.419) [-475.899] (-476.572) * (-478.505) (-479.240) [-477.466] (-475.972) -- 0:00:16
Average standard deviation of split frequencies: 0.006407
740500 -- (-476.786) (-478.028) (-478.633) [-480.070] * (-476.976) (-477.319) [-476.588] (-480.241) -- 0:00:16
741000 -- [-477.504] (-479.766) (-479.226) (-477.355) * [-478.980] (-476.550) (-474.317) (-480.506) -- 0:00:16
741500 -- (-478.913) [-477.557] (-481.290) (-475.307) * (-479.839) [-476.526] (-475.986) (-478.188) -- 0:00:16
742000 -- (-482.273) [-477.570] (-475.452) (-478.435) * (-479.722) [-478.266] (-476.247) (-479.579) -- 0:00:16
742500 -- (-477.024) (-483.373) [-478.568] (-480.008) * (-478.979) (-478.939) [-478.028] (-482.307) -- 0:00:16
743000 -- (-476.912) (-479.616) [-476.941] (-477.348) * [-474.907] (-480.641) (-475.849) (-478.552) -- 0:00:16
743500 -- (-479.226) (-486.277) [-477.212] (-478.164) * (-478.535) (-479.181) [-478.014] (-479.194) -- 0:00:16
744000 -- [-476.741] (-479.361) (-478.135) (-482.100) * [-478.389] (-478.335) (-479.597) (-477.272) -- 0:00:16
744500 -- (-479.531) (-479.650) (-477.632) [-479.836] * (-475.635) (-481.946) (-480.060) [-476.239] -- 0:00:16
745000 -- (-477.908) (-477.354) [-478.584] (-478.772) * (-478.121) (-480.319) [-478.466] (-480.495) -- 0:00:16
Average standard deviation of split frequencies: 0.006066
745500 -- (-477.860) (-479.230) [-479.962] (-482.007) * (-476.040) (-477.746) (-479.865) [-475.199] -- 0:00:16
746000 -- (-478.615) (-480.013) (-477.452) [-481.587] * (-477.126) (-476.577) (-476.513) [-477.148] -- 0:00:16
746500 -- [-476.836] (-477.258) (-478.770) (-478.323) * (-480.034) (-477.972) (-475.885) [-480.395] -- 0:00:16
747000 -- (-477.789) [-477.688] (-478.769) (-477.882) * (-479.387) (-478.956) [-476.595] (-476.636) -- 0:00:16
747500 -- (-477.348) (-482.602) (-479.932) [-476.954] * (-477.105) [-478.095] (-478.484) (-477.660) -- 0:00:16
748000 -- [-481.190] (-482.490) (-478.652) (-477.598) * (-480.679) [-478.584] (-481.235) (-479.502) -- 0:00:16
748500 -- (-477.794) [-480.330] (-476.794) (-478.723) * (-479.370) (-477.866) [-479.143] (-481.110) -- 0:00:16
749000 -- (-479.686) (-479.628) [-477.195] (-477.073) * (-479.958) (-480.120) [-480.187] (-480.034) -- 0:00:16
749500 -- (-483.176) (-477.471) [-478.723] (-477.754) * (-479.475) [-479.762] (-477.872) (-486.390) -- 0:00:16
750000 -- (-476.614) [-478.997] (-477.497) (-483.117) * (-481.446) (-478.521) (-478.217) [-483.276] -- 0:00:16
Average standard deviation of split frequencies: 0.005526
750500 -- [-477.176] (-479.937) (-479.379) (-480.492) * (-480.645) (-478.139) [-480.845] (-478.726) -- 0:00:16
751000 -- (-475.496) (-480.004) (-477.712) [-475.747] * [-481.902] (-477.457) (-478.687) (-478.268) -- 0:00:16
751500 -- [-476.197] (-481.597) (-478.654) (-477.989) * (-477.498) (-478.626) [-477.877] (-480.467) -- 0:00:16
752000 -- (-480.472) (-478.266) [-478.482] (-480.156) * [-477.903] (-479.129) (-479.165) (-480.076) -- 0:00:16
752500 -- (-479.463) (-478.509) [-478.248] (-477.089) * [-478.118] (-477.880) (-476.651) (-480.969) -- 0:00:16
753000 -- (-478.645) (-479.759) [-477.419] (-484.671) * (-479.270) (-479.233) [-476.496] (-480.223) -- 0:00:16
753500 -- (-479.328) (-476.815) (-480.048) [-475.936] * (-478.378) (-476.690) (-480.701) [-477.669] -- 0:00:16
754000 -- [-475.719] (-476.377) (-479.149) (-478.242) * [-479.138] (-478.522) (-478.084) (-477.403) -- 0:00:15
754500 -- (-479.845) (-477.296) (-478.899) [-480.483] * [-478.321] (-477.230) (-476.144) (-477.941) -- 0:00:15
755000 -- [-476.282] (-482.364) (-482.250) (-478.213) * (-478.307) (-480.384) [-476.785] (-477.373) -- 0:00:15
Average standard deviation of split frequencies: 0.005861
755500 -- (-478.204) (-479.727) (-477.562) [-479.296] * (-483.097) [-480.001] (-478.580) (-478.778) -- 0:00:15
756000 -- (-477.773) (-480.489) [-479.357] (-480.049) * (-478.365) (-479.253) (-477.489) [-475.902] -- 0:00:15
756500 -- (-479.288) (-477.954) [-475.852] (-477.652) * (-478.401) (-481.276) (-478.491) [-478.133] -- 0:00:15
757000 -- [-476.475] (-479.482) (-477.968) (-483.182) * (-480.698) [-477.858] (-479.244) (-480.054) -- 0:00:15
757500 -- (-476.763) [-476.909] (-480.965) (-480.371) * (-478.217) (-477.405) [-484.329] (-476.889) -- 0:00:15
758000 -- (-476.874) [-476.122] (-478.983) (-481.869) * (-478.196) (-477.858) (-477.164) [-475.015] -- 0:00:15
758500 -- (-478.232) (-478.017) [-476.620] (-478.972) * (-476.564) (-479.739) [-478.738] (-477.205) -- 0:00:15
759000 -- (-477.249) [-475.979] (-484.112) (-478.558) * (-478.474) [-479.307] (-477.222) (-478.794) -- 0:00:15
759500 -- (-478.143) (-479.355) (-480.142) [-477.848] * (-478.737) [-477.781] (-481.293) (-478.997) -- 0:00:15
760000 -- (-478.550) (-477.378) [-477.870] (-479.064) * (-477.068) (-475.407) [-477.605] (-474.951) -- 0:00:15
Average standard deviation of split frequencies: 0.006156
760500 -- [-479.413] (-475.991) (-478.249) (-476.551) * (-480.085) (-484.427) [-477.239] (-476.741) -- 0:00:15
761000 -- (-484.335) (-477.527) [-476.467] (-476.992) * (-480.226) (-482.402) (-478.208) [-479.177] -- 0:00:15
761500 -- (-480.465) (-480.344) (-482.422) [-475.208] * (-477.005) (-480.299) [-474.815] (-477.982) -- 0:00:15
762000 -- (-478.769) (-477.983) [-478.478] (-478.914) * (-477.981) (-478.264) (-478.608) [-477.888] -- 0:00:15
762500 -- (-477.539) [-478.906] (-476.547) (-476.463) * (-479.111) (-476.245) [-478.196] (-480.074) -- 0:00:15
763000 -- (-477.766) [-477.637] (-477.654) (-478.358) * (-478.603) (-476.163) (-479.947) [-477.364] -- 0:00:15
763500 -- [-481.968] (-479.954) (-477.091) (-476.462) * (-478.344) (-478.219) (-479.088) [-476.964] -- 0:00:15
764000 -- (-478.056) (-478.272) [-482.658] (-477.098) * (-477.957) [-476.336] (-476.793) (-478.439) -- 0:00:15
764500 -- (-484.598) (-476.316) [-477.169] (-479.175) * (-479.306) (-476.440) [-481.884] (-478.420) -- 0:00:15
765000 -- [-479.274] (-480.035) (-478.800) (-482.740) * (-480.153) (-477.938) [-475.876] (-478.908) -- 0:00:15
Average standard deviation of split frequencies: 0.005990
765500 -- (-474.539) (-474.909) (-479.226) [-478.716] * (-482.194) [-477.508] (-475.624) (-478.606) -- 0:00:15
766000 -- (-476.326) (-478.645) [-479.157] (-479.359) * (-478.849) (-478.070) [-477.602] (-478.284) -- 0:00:15
766500 -- (-478.027) (-476.089) [-478.025] (-479.208) * (-479.854) (-474.403) [-479.417] (-476.513) -- 0:00:15
767000 -- [-478.221] (-476.159) (-478.659) (-480.342) * (-482.523) [-477.315] (-478.901) (-477.628) -- 0:00:15
767500 -- (-477.616) (-476.594) (-478.360) [-478.069] * (-477.524) (-478.342) (-479.127) [-478.390] -- 0:00:15
768000 -- (-481.638) [-476.281] (-476.616) (-475.463) * [-478.362] (-476.167) (-478.691) (-480.158) -- 0:00:15
768500 -- (-479.132) (-475.642) [-477.848] (-474.475) * (-478.799) [-477.955] (-479.263) (-478.232) -- 0:00:15
769000 -- (-476.975) (-477.516) (-475.863) [-476.018] * (-480.181) (-477.181) (-476.624) [-478.488] -- 0:00:15
769500 -- (-479.922) [-474.885] (-483.125) (-477.833) * (-481.473) (-479.154) (-478.112) [-475.381] -- 0:00:14
770000 -- (-479.928) (-476.122) [-478.243] (-476.975) * (-480.617) (-478.408) (-478.726) [-480.850] -- 0:00:14
Average standard deviation of split frequencies: 0.005872
770500 -- (-477.627) [-475.464] (-476.060) (-477.192) * (-478.397) (-478.618) [-476.635] (-478.917) -- 0:00:14
771000 -- (-479.450) (-477.186) [-477.311] (-475.195) * (-477.638) [-477.927] (-476.353) (-477.301) -- 0:00:14
771500 -- [-478.205] (-479.490) (-479.135) (-478.426) * (-482.027) (-478.440) [-479.350] (-483.763) -- 0:00:14
772000 -- (-476.902) [-478.092] (-478.755) (-476.954) * (-484.792) (-481.208) [-479.306] (-482.434) -- 0:00:14
772500 -- (-477.072) (-476.520) (-480.366) [-478.461] * (-479.240) (-477.112) [-477.078] (-481.757) -- 0:00:14
773000 -- (-483.694) (-476.401) (-480.366) [-477.695] * [-478.358] (-478.914) (-478.251) (-483.440) -- 0:00:14
773500 -- [-476.242] (-480.457) (-476.577) (-479.627) * (-478.197) (-479.494) [-476.558] (-476.596) -- 0:00:14
774000 -- (-477.442) (-477.092) [-477.684] (-476.573) * (-476.908) [-476.449] (-477.764) (-480.975) -- 0:00:14
774500 -- [-475.119] (-477.378) (-479.140) (-478.279) * [-475.570] (-480.653) (-477.239) (-481.081) -- 0:00:14
775000 -- [-477.270] (-476.512) (-478.086) (-478.431) * (-480.531) [-478.061] (-477.691) (-477.655) -- 0:00:14
Average standard deviation of split frequencies: 0.005386
775500 -- (-475.943) [-476.602] (-477.242) (-477.419) * [-479.484] (-477.662) (-481.769) (-480.702) -- 0:00:14
776000 -- (-485.746) [-476.494] (-480.575) (-479.467) * (-476.347) (-482.237) (-479.035) [-478.197] -- 0:00:14
776500 -- (-477.895) (-476.226) [-476.320] (-476.678) * (-483.334) [-479.450] (-479.887) (-480.205) -- 0:00:14
777000 -- (-477.265) [-478.560] (-479.328) (-476.897) * (-479.668) (-477.988) [-478.414] (-482.128) -- 0:00:14
777500 -- (-477.276) [-476.476] (-480.991) (-480.160) * [-479.965] (-476.432) (-477.910) (-482.119) -- 0:00:14
778000 -- [-476.244] (-481.202) (-477.757) (-480.356) * (-477.706) [-478.643] (-481.639) (-482.753) -- 0:00:14
778500 -- [-479.614] (-479.537) (-477.480) (-486.263) * (-476.255) (-478.461) [-479.060] (-480.525) -- 0:00:14
779000 -- [-478.115] (-479.016) (-475.855) (-475.739) * (-479.506) (-476.161) (-477.915) [-477.092] -- 0:00:14
779500 -- (-479.865) [-480.675] (-477.791) (-477.520) * [-479.420] (-479.396) (-476.464) (-481.026) -- 0:00:14
780000 -- (-479.074) [-480.821] (-479.366) (-476.763) * (-477.888) [-480.475] (-475.041) (-480.837) -- 0:00:14
Average standard deviation of split frequencies: 0.005394
780500 -- (-477.666) (-485.491) [-477.503] (-479.359) * [-479.789] (-480.377) (-478.597) (-475.944) -- 0:00:14
781000 -- [-477.403] (-480.134) (-475.804) (-477.490) * (-479.415) (-479.740) (-480.024) [-476.741] -- 0:00:14
781500 -- (-477.302) (-475.998) (-476.548) [-484.467] * (-478.454) (-478.897) (-478.187) [-477.860] -- 0:00:14
782000 -- (-476.894) [-478.602] (-477.540) (-477.709) * (-477.952) [-479.479] (-479.737) (-478.436) -- 0:00:14
782500 -- (-481.070) [-475.680] (-478.414) (-484.008) * (-477.160) (-482.383) [-479.540] (-479.036) -- 0:00:14
783000 -- (-478.071) [-477.526] (-481.629) (-478.852) * [-478.038] (-478.631) (-478.130) (-475.028) -- 0:00:14
783500 -- [-479.009] (-477.559) (-478.268) (-481.880) * (-485.612) [-476.619] (-479.346) (-476.574) -- 0:00:14
784000 -- [-478.843] (-479.345) (-477.193) (-478.294) * (-476.969) (-481.190) [-477.446] (-477.178) -- 0:00:14
784500 -- (-481.309) (-480.709) [-476.439] (-476.973) * (-476.889) [-478.452] (-482.233) (-478.635) -- 0:00:14
785000 -- [-483.318] (-478.650) (-481.666) (-480.226) * (-478.218) (-478.286) [-476.459] (-476.202) -- 0:00:13
Average standard deviation of split frequencies: 0.004758
785500 -- (-480.313) (-479.124) (-481.803) [-477.937] * (-483.339) (-480.801) (-476.562) [-477.671] -- 0:00:13
786000 -- (-479.887) (-481.667) [-476.992] (-476.697) * (-477.745) [-476.448] (-478.953) (-479.615) -- 0:00:14
786500 -- (-476.648) [-475.471] (-477.754) (-480.253) * [-477.560] (-475.918) (-479.543) (-478.567) -- 0:00:14
787000 -- (-482.022) (-480.890) [-476.067] (-478.440) * (-474.871) (-476.913) [-476.391] (-479.526) -- 0:00:14
787500 -- (-478.579) (-476.998) (-476.439) [-477.232] * [-477.521] (-476.241) (-479.689) (-479.174) -- 0:00:14
788000 -- [-477.114] (-476.833) (-478.359) (-479.465) * (-476.013) (-479.148) (-477.528) [-474.946] -- 0:00:13
788500 -- [-475.912] (-477.825) (-476.096) (-477.514) * (-477.675) (-476.769) (-478.392) [-475.764] -- 0:00:13
789000 -- [-477.474] (-480.650) (-476.436) (-480.339) * (-477.002) (-475.722) (-477.506) [-477.502] -- 0:00:13
789500 -- [-477.408] (-475.240) (-476.584) (-477.754) * (-479.172) [-475.831] (-480.699) (-476.553) -- 0:00:13
790000 -- (-475.743) (-476.840) (-477.018) [-481.648] * (-475.424) [-476.376] (-476.045) (-478.749) -- 0:00:13
Average standard deviation of split frequencies: 0.004571
790500 -- (-477.992) [-478.814] (-478.628) (-476.138) * (-478.085) [-477.621] (-479.171) (-477.008) -- 0:00:13
791000 -- (-476.548) [-478.004] (-478.815) (-480.400) * [-476.849] (-477.514) (-481.700) (-478.091) -- 0:00:13
791500 -- (-476.246) [-480.980] (-476.743) (-476.975) * [-479.106] (-479.340) (-476.246) (-477.063) -- 0:00:13
792000 -- (-475.415) (-477.708) [-480.406] (-476.665) * (-478.647) (-477.966) [-480.679] (-479.043) -- 0:00:13
792500 -- [-477.967] (-478.421) (-480.326) (-476.953) * [-481.717] (-477.871) (-482.845) (-476.951) -- 0:00:13
793000 -- (-480.124) [-475.877] (-480.081) (-475.960) * (-476.661) (-477.025) (-481.358) [-477.574] -- 0:00:13
793500 -- (-475.354) [-477.311] (-475.850) (-476.011) * (-483.401) [-478.178] (-479.935) (-476.850) -- 0:00:13
794000 -- (-476.270) (-477.140) [-477.665] (-480.192) * (-484.121) (-479.701) (-477.627) [-475.323] -- 0:00:13
794500 -- (-482.407) [-477.867] (-478.301) (-480.015) * (-478.822) [-476.397] (-477.489) (-476.191) -- 0:00:13
795000 -- (-476.853) (-480.885) (-477.659) [-478.270] * (-480.397) [-480.130] (-479.277) (-476.763) -- 0:00:13
Average standard deviation of split frequencies: 0.005054
795500 -- (-477.964) (-476.861) (-477.059) [-475.960] * (-476.546) [-482.934] (-486.523) (-477.185) -- 0:00:13
796000 -- (-479.777) (-476.352) (-477.137) [-479.169] * (-479.092) (-478.891) [-479.186] (-479.097) -- 0:00:13
796500 -- [-478.838] (-477.540) (-477.056) (-480.682) * (-477.374) (-477.036) [-479.052] (-481.404) -- 0:00:13
797000 -- (-479.615) (-476.808) (-475.717) [-482.258] * (-476.368) [-478.339] (-478.168) (-482.311) -- 0:00:13
797500 -- (-477.312) (-476.400) (-475.803) [-481.598] * (-476.201) [-480.072] (-482.789) (-480.547) -- 0:00:13
798000 -- (-478.534) [-476.790] (-480.807) (-480.587) * [-476.713] (-477.660) (-477.155) (-476.631) -- 0:00:13
798500 -- (-477.551) [-478.348] (-477.231) (-482.168) * (-479.585) [-478.257] (-477.501) (-478.221) -- 0:00:13
799000 -- (-477.577) (-477.697) [-482.711] (-482.888) * [-480.763] (-478.790) (-476.908) (-479.623) -- 0:00:13
799500 -- (-476.600) [-474.931] (-475.827) (-478.466) * (-479.378) (-477.976) (-478.886) [-476.912] -- 0:00:13
800000 -- (-480.191) (-477.651) (-476.722) [-475.128] * [-478.174] (-479.872) (-480.401) (-479.309) -- 0:00:12
Average standard deviation of split frequencies: 0.004789
800500 -- (-480.609) (-475.378) [-480.607] (-477.510) * (-478.553) [-476.000] (-482.080) (-477.756) -- 0:00:13
801000 -- (-476.907) [-475.778] (-480.138) (-476.702) * [-476.602] (-479.258) (-479.901) (-481.609) -- 0:00:13
801500 -- (-477.393) [-480.080] (-477.881) (-480.256) * [-478.507] (-482.143) (-477.270) (-477.061) -- 0:00:13
802000 -- (-480.981) (-481.471) (-481.230) [-478.472] * [-477.426] (-475.865) (-478.582) (-476.422) -- 0:00:13
802500 -- (-481.459) (-477.317) [-477.451] (-479.962) * (-476.126) [-475.204] (-478.143) (-477.680) -- 0:00:13
803000 -- (-476.206) (-479.173) [-478.116] (-477.462) * (-479.196) (-477.424) [-476.285] (-477.951) -- 0:00:13
803500 -- (-477.333) (-478.083) (-476.981) [-477.786] * (-477.950) (-479.347) [-477.246] (-476.915) -- 0:00:12
804000 -- (-479.373) (-476.919) [-478.561] (-479.768) * (-477.771) (-478.932) (-478.800) [-479.501] -- 0:00:12
804500 -- [-475.840] (-475.821) (-480.280) (-480.991) * (-476.781) (-478.275) (-477.605) [-480.905] -- 0:00:12
805000 -- [-478.295] (-476.560) (-476.881) (-484.140) * (-480.003) (-480.507) [-478.819] (-478.739) -- 0:00:12
Average standard deviation of split frequencies: 0.004289
805500 -- (-479.569) (-477.647) [-478.913] (-485.614) * (-477.612) (-480.233) [-474.701] (-478.719) -- 0:00:12
806000 -- (-479.300) [-477.617] (-480.862) (-476.613) * (-476.446) (-478.991) [-475.623] (-478.710) -- 0:00:12
806500 -- (-478.464) [-479.697] (-478.878) (-480.750) * (-477.115) (-476.305) (-478.196) [-478.556] -- 0:00:12
807000 -- (-478.501) [-477.947] (-479.388) (-480.412) * (-477.526) (-478.669) [-476.721] (-477.073) -- 0:00:12
807500 -- (-481.790) [-478.287] (-479.839) (-481.025) * (-481.632) [-476.837] (-478.368) (-479.143) -- 0:00:12
808000 -- [-477.942] (-483.944) (-477.377) (-476.716) * (-481.650) (-478.299) [-480.512] (-480.978) -- 0:00:12
808500 -- [-476.542] (-478.106) (-480.060) (-478.826) * (-478.835) [-478.218] (-478.125) (-478.513) -- 0:00:12
809000 -- (-479.535) (-478.520) [-474.840] (-480.695) * (-477.022) (-477.965) (-478.902) [-478.169] -- 0:00:12
809500 -- (-479.499) (-477.673) (-479.461) [-477.136] * (-478.033) (-476.817) [-476.741] (-482.147) -- 0:00:12
810000 -- [-476.335] (-480.968) (-478.099) (-475.315) * [-476.342] (-480.858) (-477.001) (-476.712) -- 0:00:12
Average standard deviation of split frequencies: 0.004264
810500 -- [-478.916] (-479.731) (-478.458) (-476.750) * (-480.123) (-481.814) [-485.458] (-479.102) -- 0:00:12
811000 -- (-479.063) (-483.256) [-476.975] (-478.806) * [-479.232] (-479.641) (-490.537) (-483.558) -- 0:00:12
811500 -- (-481.186) [-479.608] (-480.049) (-478.385) * [-476.057] (-476.395) (-481.556) (-477.945) -- 0:00:12
812000 -- (-483.204) (-480.021) [-480.443] (-481.277) * [-478.128] (-477.364) (-479.292) (-481.444) -- 0:00:12
812500 -- [-484.297] (-479.810) (-480.004) (-479.189) * (-477.761) [-477.588] (-476.876) (-478.780) -- 0:00:12
813000 -- (-478.194) (-479.859) (-478.683) [-478.308] * [-478.117] (-478.035) (-477.070) (-478.312) -- 0:00:12
813500 -- [-478.892] (-479.218) (-478.467) (-478.170) * (-477.595) (-476.843) [-478.584] (-479.379) -- 0:00:12
814000 -- (-480.678) (-476.785) [-475.789] (-479.953) * [-473.805] (-477.456) (-479.573) (-476.342) -- 0:00:12
814500 -- (-480.254) (-481.897) [-477.584] (-479.805) * (-475.485) [-477.748] (-477.029) (-478.025) -- 0:00:12
815000 -- [-486.259] (-479.714) (-483.346) (-479.079) * (-478.555) (-476.174) [-481.225] (-477.421) -- 0:00:12
Average standard deviation of split frequencies: 0.004468
815500 -- (-482.246) (-480.530) [-477.522] (-482.153) * (-479.951) (-478.665) [-481.228] (-478.301) -- 0:00:12
816000 -- (-480.664) [-479.202] (-482.928) (-477.263) * (-475.073) [-477.644] (-478.582) (-476.304) -- 0:00:12
816500 -- [-475.953] (-479.443) (-478.078) (-477.139) * (-476.571) (-481.297) [-477.723] (-481.665) -- 0:00:12
817000 -- [-477.495] (-478.983) (-480.747) (-482.324) * (-481.154) (-475.992) [-478.563] (-478.602) -- 0:00:12
817500 -- (-480.481) (-479.681) (-477.004) [-477.083] * [-476.473] (-476.010) (-478.909) (-477.781) -- 0:00:12
818000 -- (-478.029) (-479.635) [-477.046] (-480.641) * (-477.625) [-478.794] (-478.138) (-481.292) -- 0:00:12
818500 -- (-479.061) (-478.683) [-479.448] (-481.527) * (-478.950) [-476.527] (-477.022) (-478.673) -- 0:00:11
819000 -- (-477.767) [-478.152] (-478.526) (-476.132) * (-475.512) (-478.873) (-478.416) [-479.867] -- 0:00:11
819500 -- (-479.049) [-478.723] (-476.299) (-477.918) * (-477.165) [-479.781] (-479.158) (-479.292) -- 0:00:11
820000 -- (-477.854) (-478.749) [-480.590] (-478.642) * (-481.486) (-480.240) [-479.317] (-478.733) -- 0:00:11
Average standard deviation of split frequencies: 0.004519
820500 -- (-480.235) (-483.240) (-477.425) [-477.759] * (-479.114) [-476.878] (-476.592) (-481.137) -- 0:00:11
821000 -- (-476.521) [-480.343] (-479.618) (-475.480) * (-481.375) [-478.196] (-479.451) (-479.583) -- 0:00:11
821500 -- [-478.100] (-478.767) (-477.399) (-477.366) * (-481.679) (-477.747) (-478.926) [-478.612] -- 0:00:11
822000 -- [-479.001] (-478.456) (-479.438) (-479.356) * [-475.755] (-480.958) (-477.836) (-479.656) -- 0:00:11
822500 -- (-479.658) (-480.777) [-476.562] (-477.730) * (-476.461) (-478.173) (-482.528) [-477.880] -- 0:00:11
823000 -- (-475.637) (-479.630) (-477.492) [-477.945] * (-481.581) [-476.100] (-484.000) (-478.743) -- 0:00:11
823500 -- (-479.118) (-478.691) (-476.685) [-476.935] * (-477.336) (-477.930) (-481.002) [-479.273] -- 0:00:11
824000 -- [-476.540] (-481.619) (-476.908) (-480.458) * (-481.206) (-479.414) [-476.822] (-477.336) -- 0:00:11
824500 -- [-475.793] (-479.893) (-480.185) (-481.221) * (-480.251) [-479.246] (-481.001) (-477.812) -- 0:00:11
825000 -- (-479.942) (-479.563) [-479.111] (-478.199) * (-477.585) [-480.924] (-477.259) (-478.395) -- 0:00:11
Average standard deviation of split frequencies: 0.004718
825500 -- (-477.836) (-482.989) (-479.944) [-479.072] * [-480.198] (-477.904) (-477.522) (-479.107) -- 0:00:11
826000 -- (-479.970) (-478.665) [-476.921] (-480.351) * (-478.267) [-479.947] (-477.032) (-479.741) -- 0:00:11
826500 -- [-477.079] (-477.158) (-476.215) (-479.383) * (-481.082) (-476.794) (-476.970) [-479.126] -- 0:00:11
827000 -- (-477.995) (-477.150) (-480.159) [-478.796] * (-479.300) [-479.965] (-478.253) (-478.657) -- 0:00:11
827500 -- (-477.860) (-476.564) [-479.998] (-483.142) * (-477.300) [-477.515] (-480.465) (-476.270) -- 0:00:11
828000 -- (-478.804) (-478.499) [-479.333] (-478.272) * (-479.448) (-478.446) [-475.742] (-478.529) -- 0:00:11
828500 -- (-480.374) (-479.717) [-475.686] (-478.605) * (-480.022) (-481.065) (-480.494) [-478.920] -- 0:00:11
829000 -- (-478.984) [-479.404] (-477.854) (-480.164) * (-479.577) (-480.849) (-479.354) [-478.572] -- 0:00:11
829500 -- (-479.748) (-478.346) (-475.958) [-476.419] * [-477.915] (-477.777) (-476.418) (-481.413) -- 0:00:11
830000 -- (-485.119) (-477.771) [-478.189] (-476.330) * (-478.092) (-477.229) [-477.774] (-479.889) -- 0:00:11
Average standard deviation of split frequencies: 0.004540
830500 -- (-481.603) (-476.372) [-475.373] (-480.162) * (-482.099) [-477.824] (-478.244) (-479.541) -- 0:00:11
831000 -- (-482.688) [-477.675] (-479.351) (-479.942) * [-479.088] (-479.548) (-477.849) (-478.747) -- 0:00:11
831500 -- (-482.065) [-475.463] (-478.315) (-478.035) * (-479.061) [-479.045] (-477.765) (-479.422) -- 0:00:11
832000 -- (-479.541) (-480.031) [-478.426] (-476.891) * (-481.415) [-479.936] (-480.194) (-477.900) -- 0:00:11
832500 -- [-481.799] (-480.070) (-478.349) (-475.850) * (-477.578) [-481.282] (-478.206) (-478.844) -- 0:00:11
833000 -- [-481.037] (-479.591) (-478.212) (-477.904) * (-479.603) [-476.248] (-478.694) (-477.306) -- 0:00:11
833500 -- (-479.282) (-478.818) (-477.581) [-477.502] * (-476.883) (-477.671) (-477.844) [-477.889] -- 0:00:10
834000 -- (-479.167) (-480.353) [-480.885] (-476.957) * (-485.586) [-478.750] (-477.642) (-478.928) -- 0:00:10
834500 -- (-479.627) (-475.515) [-478.308] (-478.137) * (-481.239) (-482.616) (-479.916) [-477.635] -- 0:00:10
835000 -- (-478.260) [-475.555] (-477.096) (-476.882) * [-479.628] (-479.686) (-479.057) (-480.483) -- 0:00:10
Average standard deviation of split frequencies: 0.004436
835500 -- [-476.890] (-475.538) (-482.177) (-482.553) * (-479.348) (-478.974) (-479.309) [-476.420] -- 0:00:10
836000 -- [-480.380] (-475.500) (-479.897) (-476.270) * (-478.066) [-479.201] (-478.681) (-479.063) -- 0:00:10
836500 -- (-482.065) [-478.264] (-479.681) (-481.808) * (-483.223) (-477.465) (-477.954) [-478.462] -- 0:00:10
837000 -- (-476.470) [-478.832] (-477.226) (-477.791) * (-480.978) (-478.630) (-478.118) [-478.319] -- 0:00:10
837500 -- [-477.974] (-478.170) (-476.454) (-480.248) * (-480.869) (-485.138) [-478.915] (-480.041) -- 0:00:10
838000 -- (-477.065) (-479.633) [-478.012] (-478.588) * [-481.838] (-478.890) (-475.273) (-479.602) -- 0:00:10
838500 -- (-476.860) (-478.217) [-474.628] (-478.803) * (-478.738) (-481.529) [-477.210] (-479.550) -- 0:00:10
839000 -- (-478.594) [-477.977] (-477.664) (-479.102) * (-480.188) (-482.061) (-478.493) [-477.144] -- 0:00:10
839500 -- (-476.730) [-477.010] (-482.323) (-475.784) * (-485.538) (-476.914) [-480.656] (-475.872) -- 0:00:10
840000 -- (-477.804) (-477.270) [-475.249] (-477.593) * (-485.673) [-475.873] (-476.862) (-477.173) -- 0:00:10
Average standard deviation of split frequencies: 0.005047
840500 -- [-479.125] (-475.965) (-476.071) (-476.920) * (-479.640) [-476.714] (-484.240) (-476.117) -- 0:00:10
841000 -- (-478.222) (-478.390) (-479.437) [-476.315] * (-476.221) (-478.548) (-478.555) [-477.265] -- 0:00:10
841500 -- (-478.092) [-481.375] (-477.518) (-479.884) * (-478.974) [-478.290] (-482.374) (-478.384) -- 0:00:10
842000 -- (-477.185) [-476.536] (-480.026) (-480.013) * (-481.175) (-478.869) [-483.189] (-477.766) -- 0:00:10
842500 -- (-478.686) [-477.152] (-478.331) (-477.827) * (-477.004) (-477.903) (-481.511) [-476.011] -- 0:00:10
843000 -- (-479.323) (-477.178) (-476.560) [-477.374] * (-477.741) [-482.147] (-481.347) (-479.750) -- 0:00:10
843500 -- (-479.257) [-477.046] (-480.269) (-476.099) * (-477.709) (-477.544) (-480.255) [-479.209] -- 0:00:10
844000 -- (-476.678) (-477.426) [-480.031] (-478.309) * (-482.740) (-478.792) (-481.912) [-478.333] -- 0:00:10
844500 -- (-482.290) [-476.087] (-476.752) (-479.048) * (-478.704) [-475.954] (-478.046) (-482.439) -- 0:00:10
845000 -- (-480.123) (-481.241) [-480.432] (-477.985) * (-475.178) [-475.929] (-476.315) (-479.346) -- 0:00:10
Average standard deviation of split frequencies: 0.004829
845500 -- (-475.364) (-477.684) (-476.972) [-474.876] * (-477.337) (-476.810) [-476.259] (-477.807) -- 0:00:10
846000 -- (-480.283) (-478.371) (-479.865) [-477.699] * (-476.727) [-478.008] (-476.348) (-477.701) -- 0:00:10
846500 -- [-475.109] (-476.739) (-476.626) (-478.054) * (-478.739) (-480.034) [-476.032] (-479.020) -- 0:00:10
847000 -- [-476.210] (-480.777) (-475.971) (-478.386) * [-477.278] (-480.434) (-479.185) (-476.895) -- 0:00:10
847500 -- (-475.564) (-481.398) (-475.978) [-479.617] * [-476.504] (-477.785) (-482.785) (-477.485) -- 0:00:10
848000 -- (-479.208) [-478.667] (-480.227) (-480.050) * (-478.527) (-478.189) (-480.819) [-478.246] -- 0:00:10
848500 -- (-478.580) (-480.357) (-481.770) [-479.710] * (-481.209) [-480.181] (-478.662) (-476.421) -- 0:00:09
849000 -- (-476.437) [-476.635] (-479.795) (-484.389) * (-478.679) (-479.499) (-475.622) [-477.256] -- 0:00:09
849500 -- (-476.494) (-476.966) (-480.587) [-478.752] * (-481.552) (-478.152) (-479.033) [-476.990] -- 0:00:09
850000 -- (-478.333) (-476.756) [-480.913] (-479.178) * [-478.880] (-481.316) (-476.517) (-480.685) -- 0:00:09
Average standard deviation of split frequencies: 0.005061
850500 -- (-477.480) [-476.743] (-481.885) (-476.910) * [-480.101] (-480.603) (-478.930) (-477.526) -- 0:00:09
851000 -- (-478.734) [-479.401] (-483.658) (-480.646) * (-477.303) (-487.268) (-477.204) [-477.401] -- 0:00:09
851500 -- [-477.756] (-480.663) (-478.308) (-476.847) * (-477.120) [-486.525] (-477.451) (-481.028) -- 0:00:09
852000 -- (-476.523) (-477.905) (-477.773) [-476.648] * (-479.227) (-480.357) [-477.522] (-481.262) -- 0:00:09
852500 -- (-479.029) [-478.944] (-478.534) (-475.879) * (-481.364) [-479.722] (-476.381) (-478.586) -- 0:00:09
853000 -- (-478.109) [-476.700] (-482.918) (-477.614) * (-478.532) (-482.524) [-478.505] (-479.296) -- 0:00:09
853500 -- [-475.214] (-480.018) (-482.167) (-476.661) * (-478.047) (-482.505) (-480.017) [-478.737] -- 0:00:09
854000 -- (-476.496) [-477.600] (-478.871) (-477.372) * [-477.514] (-477.434) (-476.359) (-478.105) -- 0:00:09
854500 -- (-479.641) [-478.620] (-477.692) (-479.881) * (-478.892) (-480.661) [-479.024] (-478.449) -- 0:00:09
855000 -- [-478.083] (-479.840) (-476.158) (-481.255) * (-478.954) (-479.926) (-477.202) [-479.520] -- 0:00:09
Average standard deviation of split frequencies: 0.005177
855500 -- [-476.905] (-477.838) (-478.070) (-478.094) * (-477.380) (-478.059) [-484.591] (-480.977) -- 0:00:09
856000 -- (-478.726) (-478.495) [-476.934] (-477.299) * [-481.543] (-477.120) (-479.682) (-478.009) -- 0:00:09
856500 -- (-475.957) (-479.750) [-478.347] (-479.536) * (-480.506) [-480.745] (-478.068) (-480.963) -- 0:00:09
857000 -- (-481.834) (-477.141) [-480.111] (-478.352) * [-480.305] (-482.213) (-477.528) (-478.551) -- 0:00:09
857500 -- (-481.690) (-476.603) [-477.875] (-478.438) * (-480.467) (-482.286) [-480.195] (-486.031) -- 0:00:09
858000 -- (-478.982) (-477.965) [-476.082] (-476.787) * (-477.207) (-477.786) (-477.536) [-477.811] -- 0:00:09
858500 -- [-477.621] (-482.582) (-478.250) (-477.882) * (-477.969) [-475.760] (-477.935) (-477.642) -- 0:00:09
859000 -- (-480.692) (-478.295) [-478.250] (-480.058) * [-476.721] (-479.503) (-481.147) (-481.025) -- 0:00:09
859500 -- (-486.803) (-478.106) (-478.943) [-483.186] * (-480.891) (-481.616) [-479.568] (-478.796) -- 0:00:09
860000 -- (-478.464) (-477.883) [-478.305] (-477.716) * [-480.259] (-476.370) (-476.844) (-478.659) -- 0:00:09
Average standard deviation of split frequencies: 0.005587
860500 -- (-477.840) (-483.531) (-478.420) [-479.727] * (-477.678) (-476.287) (-477.232) [-478.533] -- 0:00:09
861000 -- (-476.384) (-482.143) (-480.808) [-476.976] * (-479.369) [-476.586] (-480.687) (-476.527) -- 0:00:09
861500 -- (-479.023) (-480.978) [-477.106] (-477.456) * (-476.467) (-478.861) [-479.410] (-477.843) -- 0:00:09
862000 -- (-479.183) (-479.114) [-478.633] (-477.416) * (-478.370) (-478.662) [-478.122] (-480.362) -- 0:00:09
862500 -- (-480.144) [-479.910] (-479.397) (-480.369) * (-479.820) (-477.212) (-477.586) [-478.345] -- 0:00:09
863000 -- (-479.069) (-478.849) [-478.666] (-479.456) * (-479.477) (-479.406) [-479.662] (-480.673) -- 0:00:09
863500 -- [-478.912] (-481.973) (-479.799) (-480.084) * (-477.508) [-478.637] (-478.675) (-476.537) -- 0:00:09
864000 -- (-478.973) (-481.475) [-478.542] (-479.909) * [-480.066] (-479.681) (-482.041) (-479.502) -- 0:00:08
864500 -- (-482.411) (-479.247) (-479.138) [-476.419] * [-477.944] (-478.723) (-482.845) (-479.985) -- 0:00:08
865000 -- (-486.357) (-482.143) [-476.738] (-478.190) * (-478.722) [-476.422] (-478.892) (-479.991) -- 0:00:08
Average standard deviation of split frequencies: 0.005589
865500 -- (-481.904) [-480.220] (-478.460) (-478.396) * (-477.662) (-479.168) (-482.073) [-477.769] -- 0:00:08
866000 -- (-481.666) (-479.391) [-478.193] (-483.096) * (-478.511) (-482.090) [-478.956] (-481.556) -- 0:00:08
866500 -- (-479.490) (-477.689) (-479.154) [-479.101] * (-477.266) (-480.898) [-478.649] (-477.725) -- 0:00:08
867000 -- [-478.456] (-480.146) (-478.402) (-480.092) * (-480.368) [-478.889] (-477.807) (-479.410) -- 0:00:08
867500 -- (-478.606) (-477.340) (-481.757) [-478.413] * (-478.636) (-479.180) [-480.862] (-479.389) -- 0:00:08
868000 -- (-482.670) (-478.405) (-480.084) [-480.015] * [-477.544] (-478.226) (-477.036) (-478.393) -- 0:00:08
868500 -- (-476.952) [-478.972] (-478.157) (-475.749) * [-477.940] (-478.306) (-477.313) (-477.901) -- 0:00:08
869000 -- [-475.851] (-479.746) (-476.781) (-476.339) * [-476.896] (-478.679) (-475.709) (-479.041) -- 0:00:08
869500 -- (-480.434) (-478.942) [-477.586] (-476.981) * [-476.502] (-481.212) (-477.271) (-480.949) -- 0:00:08
870000 -- (-477.329) (-478.552) (-478.160) [-480.535] * (-477.058) (-480.882) (-480.562) [-475.484] -- 0:00:08
Average standard deviation of split frequencies: 0.005486
870500 -- [-478.274] (-481.612) (-476.622) (-475.781) * (-477.975) (-478.874) [-480.055] (-477.700) -- 0:00:08
871000 -- [-476.092] (-477.903) (-477.301) (-477.224) * (-477.488) [-476.984] (-477.050) (-477.711) -- 0:00:08
871500 -- (-475.120) (-476.819) (-476.310) [-478.799] * (-478.270) (-482.080) (-476.773) [-478.327] -- 0:00:08
872000 -- [-476.314] (-478.085) (-477.152) (-478.236) * (-477.495) (-479.010) (-477.065) [-476.802] -- 0:00:08
872500 -- (-480.226) (-479.410) (-478.490) [-475.465] * (-477.703) (-477.428) [-475.994] (-477.772) -- 0:00:08
873000 -- (-476.813) (-480.544) [-476.433] (-476.622) * (-477.140) (-479.093) [-477.773] (-481.474) -- 0:00:08
873500 -- (-478.662) [-478.665] (-476.773) (-476.601) * (-476.615) (-477.365) [-479.996] (-479.259) -- 0:00:08
874000 -- (-478.237) (-477.909) [-475.882] (-475.442) * (-477.229) [-479.141] (-481.248) (-479.399) -- 0:00:08
874500 -- (-480.721) (-478.845) [-477.902] (-478.041) * (-477.579) [-478.341] (-482.443) (-477.396) -- 0:00:08
875000 -- (-479.706) (-477.915) [-479.818] (-481.330) * (-477.535) [-477.015] (-481.267) (-479.678) -- 0:00:08
Average standard deviation of split frequencies: 0.005632
875500 -- (-478.466) [-477.677] (-476.518) (-483.693) * [-477.772] (-475.410) (-479.727) (-481.224) -- 0:00:08
876000 -- (-480.178) [-477.404] (-477.121) (-482.009) * [-476.275] (-477.303) (-478.500) (-480.478) -- 0:00:08
876500 -- (-484.043) [-477.329] (-477.103) (-476.980) * [-477.280] (-481.890) (-477.231) (-482.749) -- 0:00:08
877000 -- [-475.839] (-485.837) (-481.026) (-476.963) * (-476.807) (-477.195) [-478.390] (-482.219) -- 0:00:08
877500 -- (-477.855) (-477.261) (-476.383) [-477.045] * (-478.273) (-478.894) [-478.354] (-478.989) -- 0:00:08
878000 -- (-480.557) (-485.437) [-477.325] (-476.235) * (-478.159) [-478.776] (-478.393) (-477.373) -- 0:00:08
878500 -- [-478.344] (-479.044) (-475.063) (-477.427) * (-482.150) [-480.586] (-480.024) (-476.380) -- 0:00:08
879000 -- (-478.126) (-480.173) (-477.598) [-477.426] * (-477.110) [-478.682] (-479.597) (-476.122) -- 0:00:07
879500 -- [-481.770] (-477.036) (-475.896) (-478.223) * (-479.794) (-478.995) (-477.023) [-478.360] -- 0:00:07
880000 -- (-474.901) (-480.402) (-479.392) [-475.587] * (-480.850) (-475.922) (-478.180) [-475.905] -- 0:00:07
Average standard deviation of split frequencies: 0.005745
880500 -- (-475.628) (-480.739) (-476.444) [-475.653] * (-478.190) (-477.645) (-476.129) [-477.531] -- 0:00:07
881000 -- (-479.038) (-481.888) (-476.662) [-478.029] * (-478.568) [-484.525] (-477.126) (-479.303) -- 0:00:07
881500 -- (-479.580) (-481.365) [-480.261] (-478.276) * (-479.267) (-481.857) (-477.475) [-478.170] -- 0:00:07
882000 -- (-477.042) [-477.525] (-476.961) (-482.137) * (-481.383) (-484.413) [-479.136] (-477.866) -- 0:00:07
882500 -- (-479.532) (-479.038) [-477.973] (-474.252) * [-477.780] (-481.851) (-481.174) (-476.368) -- 0:00:07
883000 -- (-481.233) [-480.026] (-478.960) (-476.257) * (-478.381) (-477.342) [-481.775] (-477.433) -- 0:00:07
883500 -- (-480.892) [-475.155] (-479.737) (-476.797) * (-479.088) (-477.058) (-479.683) [-475.030] -- 0:00:07
884000 -- (-477.998) (-478.051) (-474.843) [-478.598] * (-479.430) (-476.665) [-475.988] (-476.423) -- 0:00:07
884500 -- [-478.542] (-475.325) (-476.872) (-475.737) * (-478.209) [-477.173] (-475.729) (-479.461) -- 0:00:07
885000 -- (-480.382) (-477.583) (-482.378) [-477.959] * (-479.834) (-478.079) [-478.066] (-480.671) -- 0:00:07
Average standard deviation of split frequencies: 0.006065
885500 -- (-478.492) (-476.337) [-476.470] (-481.299) * (-480.256) (-479.127) [-477.865] (-476.335) -- 0:00:07
886000 -- (-476.718) (-482.767) (-477.642) [-477.733] * (-485.066) (-476.196) (-478.737) [-480.079] -- 0:00:07
886500 -- (-476.986) (-476.931) (-474.195) [-478.671] * (-481.566) (-478.476) [-480.390] (-479.546) -- 0:00:07
887000 -- (-477.968) (-480.113) (-477.908) [-476.576] * (-477.128) [-477.696] (-478.799) (-479.476) -- 0:00:07
887500 -- (-480.313) (-478.948) (-476.068) [-476.341] * (-478.643) (-477.308) [-477.933] (-481.641) -- 0:00:07
888000 -- [-477.917] (-476.828) (-476.849) (-479.915) * (-478.780) [-477.175] (-478.945) (-479.540) -- 0:00:07
888500 -- (-480.629) (-479.462) [-477.832] (-476.703) * (-476.837) (-477.232) [-480.196] (-476.346) -- 0:00:07
889000 -- (-481.294) (-478.920) [-476.269] (-480.662) * (-477.681) [-476.855] (-479.071) (-478.973) -- 0:00:07
889500 -- [-476.199] (-475.605) (-476.721) (-482.537) * [-478.896] (-482.473) (-480.029) (-481.736) -- 0:00:07
890000 -- (-478.177) (-477.334) (-474.703) [-478.649] * (-479.421) [-478.835] (-478.774) (-482.306) -- 0:00:07
Average standard deviation of split frequencies: 0.005822
890500 -- (-478.203) [-479.223] (-477.405) (-476.652) * (-479.297) [-478.069] (-478.214) (-476.691) -- 0:00:07
891000 -- (-480.571) (-479.984) (-478.131) [-478.683] * (-481.047) (-478.501) (-476.862) [-478.504] -- 0:00:07
891500 -- (-479.016) (-481.307) (-475.688) [-479.979] * (-484.431) (-477.303) [-477.244] (-477.798) -- 0:00:07
892000 -- (-481.162) (-478.166) (-477.164) [-479.447] * (-481.215) (-476.499) (-480.705) [-478.112] -- 0:00:07
892500 -- (-480.819) (-478.810) [-478.363] (-481.847) * (-481.695) (-477.796) [-477.681] (-479.624) -- 0:00:07
893000 -- (-482.529) (-480.801) (-476.798) [-477.776] * (-480.701) [-475.845] (-485.125) (-478.990) -- 0:00:07
893500 -- (-478.380) (-482.320) [-476.764] (-475.074) * [-478.460] (-478.008) (-480.403) (-482.298) -- 0:00:07
894000 -- (-476.864) [-475.338] (-477.933) (-479.190) * (-477.759) [-478.657] (-476.093) (-484.354) -- 0:00:06
894500 -- (-477.670) (-479.448) [-477.884] (-476.574) * (-479.166) (-478.163) [-475.374] (-479.596) -- 0:00:06
895000 -- (-479.886) (-478.555) (-478.949) [-478.897] * (-479.673) [-476.140] (-478.879) (-480.000) -- 0:00:06
Average standard deviation of split frequencies: 0.006208
895500 -- (-479.647) [-477.586] (-477.740) (-476.480) * (-479.807) (-477.700) [-481.526] (-482.461) -- 0:00:06
896000 -- (-478.873) [-475.786] (-478.247) (-477.724) * (-480.509) [-478.380] (-478.113) (-478.096) -- 0:00:06
896500 -- (-480.533) (-478.552) (-481.092) [-480.809] * [-477.859] (-476.521) (-480.600) (-476.136) -- 0:00:06
897000 -- (-478.917) [-479.675] (-476.928) (-475.760) * (-475.607) (-474.911) (-479.190) [-479.320] -- 0:00:06
897500 -- [-479.189] (-476.595) (-479.948) (-478.080) * (-480.877) [-476.285] (-477.992) (-476.813) -- 0:00:06
898000 -- (-478.475) (-479.666) (-480.041) [-475.491] * (-479.339) [-481.748] (-480.215) (-477.868) -- 0:00:06
898500 -- [-475.425] (-477.400) (-478.922) (-477.089) * (-477.449) [-477.765] (-478.184) (-478.777) -- 0:00:06
899000 -- (-476.308) (-478.562) (-478.976) [-475.611] * (-479.348) (-475.198) [-482.083] (-480.934) -- 0:00:06
899500 -- (-477.647) (-480.269) [-479.938] (-475.167) * (-483.790) (-477.815) [-480.383] (-484.071) -- 0:00:06
900000 -- (-481.764) (-479.615) [-478.297] (-475.879) * (-476.809) (-479.482) [-479.864] (-479.448) -- 0:00:06
Average standard deviation of split frequencies: 0.006630
900500 -- (-479.872) [-478.689] (-479.147) (-477.351) * [-479.591] (-482.204) (-480.204) (-480.558) -- 0:00:06
901000 -- (-483.054) [-479.441] (-478.827) (-478.932) * (-480.631) (-480.670) [-479.134] (-484.110) -- 0:00:06
901500 -- [-479.516] (-479.737) (-477.815) (-477.422) * (-477.009) (-484.175) [-477.561] (-479.578) -- 0:00:06
902000 -- (-481.431) (-479.209) (-480.323) [-478.876] * [-478.251] (-477.639) (-479.910) (-481.112) -- 0:00:06
902500 -- (-480.406) (-477.940) (-477.170) [-477.585] * [-478.832] (-478.269) (-479.160) (-482.203) -- 0:00:06
903000 -- [-476.602] (-479.678) (-485.671) (-477.887) * [-476.696] (-478.574) (-479.256) (-481.849) -- 0:00:06
903500 -- (-477.450) (-479.398) (-482.589) [-482.532] * (-480.620) [-477.482] (-480.416) (-479.004) -- 0:00:06
904000 -- (-480.474) (-481.527) (-478.034) [-476.309] * (-477.128) [-479.491] (-477.103) (-477.850) -- 0:00:06
904500 -- (-475.756) (-478.371) (-479.651) [-477.956] * (-481.951) [-478.770] (-479.702) (-480.773) -- 0:00:06
905000 -- (-479.117) (-478.953) [-478.200] (-477.596) * (-476.988) (-478.405) (-478.920) [-477.763] -- 0:00:06
Average standard deviation of split frequencies: 0.006660
905500 -- (-478.069) (-480.393) (-480.994) [-476.482] * (-476.303) [-478.221] (-479.110) (-477.089) -- 0:00:06
906000 -- (-478.972) [-480.359] (-480.940) (-480.621) * [-476.813] (-478.389) (-482.162) (-477.016) -- 0:00:06
906500 -- (-485.722) (-479.878) (-479.908) [-479.804] * (-476.445) (-478.752) (-481.218) [-478.622] -- 0:00:06
907000 -- (-480.282) (-485.488) [-479.099] (-481.447) * [-476.477] (-479.225) (-482.065) (-477.232) -- 0:00:06
907500 -- (-479.244) (-479.151) [-476.900] (-476.835) * (-479.101) (-476.864) [-477.193] (-478.627) -- 0:00:06
908000 -- (-480.160) (-479.430) (-476.677) [-479.777] * [-480.211] (-478.699) (-482.785) (-477.642) -- 0:00:06
908500 -- (-479.305) [-478.597] (-478.593) (-483.675) * (-475.981) (-477.736) (-480.661) [-477.223] -- 0:00:06
909000 -- [-478.537] (-478.237) (-477.239) (-478.436) * (-476.519) (-479.235) (-476.970) [-476.996] -- 0:00:06
909500 -- (-480.320) (-477.900) (-477.775) [-479.060] * [-476.636] (-482.385) (-478.416) (-475.933) -- 0:00:05
910000 -- (-482.588) (-478.160) [-477.940] (-475.393) * (-476.154) [-478.699] (-478.713) (-475.448) -- 0:00:05
Average standard deviation of split frequencies: 0.006591
910500 -- (-479.567) (-481.977) (-476.853) [-477.884] * [-476.388] (-494.028) (-479.481) (-477.658) -- 0:00:05
911000 -- (-481.375) (-482.953) (-484.452) [-479.261] * [-476.673] (-479.520) (-476.845) (-477.253) -- 0:00:05
911500 -- (-477.555) [-479.421] (-480.924) (-477.522) * (-475.037) (-479.621) (-483.019) [-485.444] -- 0:00:05
912000 -- (-481.395) [-480.925] (-480.764) (-475.922) * (-477.701) [-477.441] (-481.462) (-476.845) -- 0:00:05
912500 -- (-477.350) (-476.875) [-476.578] (-477.263) * (-478.547) [-475.635] (-481.225) (-479.065) -- 0:00:05
913000 -- [-476.221] (-481.233) (-477.003) (-478.780) * (-480.713) [-477.258] (-482.793) (-479.880) -- 0:00:05
913500 -- (-478.353) [-479.753] (-475.907) (-477.647) * [-476.109] (-482.077) (-479.774) (-485.150) -- 0:00:05
914000 -- (-478.258) [-476.941] (-478.980) (-477.608) * [-477.635] (-480.138) (-482.834) (-478.151) -- 0:00:05
914500 -- (-478.228) [-476.766] (-477.439) (-480.467) * (-477.696) (-476.817) (-479.818) [-479.034] -- 0:00:05
915000 -- [-480.422] (-479.904) (-478.191) (-478.556) * (-478.294) [-481.300] (-480.430) (-476.081) -- 0:00:05
Average standard deviation of split frequencies: 0.007173
915500 -- (-480.535) [-475.610] (-477.085) (-477.737) * (-476.411) [-482.726] (-478.701) (-476.614) -- 0:00:05
916000 -- (-480.373) (-478.365) (-478.495) [-476.179] * (-476.337) (-478.382) (-479.774) [-475.813] -- 0:00:05
916500 -- [-478.245] (-478.567) (-479.930) (-478.795) * (-476.418) (-479.565) (-477.244) [-476.040] -- 0:00:05
917000 -- [-476.104] (-484.251) (-479.121) (-478.327) * (-479.416) (-480.271) (-480.989) [-478.984] -- 0:00:05
917500 -- (-479.420) (-481.894) [-477.399] (-477.187) * (-478.865) (-479.258) (-476.957) [-479.212] -- 0:00:05
918000 -- [-477.192] (-479.615) (-481.199) (-478.925) * (-475.878) (-479.548) (-474.909) [-474.815] -- 0:00:05
918500 -- [-479.424] (-477.564) (-480.618) (-482.734) * (-483.757) [-480.297] (-477.096) (-477.230) -- 0:00:05
919000 -- (-480.128) (-479.250) (-483.014) [-476.754] * (-478.311) [-478.380] (-479.525) (-478.618) -- 0:00:05
919500 -- (-479.220) (-476.800) [-478.660] (-478.993) * (-478.677) (-478.554) (-476.468) [-475.802] -- 0:00:05
920000 -- (-477.873) (-479.785) [-478.045] (-478.970) * (-477.453) [-477.104] (-476.511) (-477.035) -- 0:00:05
Average standard deviation of split frequencies: 0.006417
920500 -- (-477.167) (-479.628) [-478.668] (-480.495) * [-478.969] (-480.287) (-476.895) (-476.388) -- 0:00:05
921000 -- (-476.607) (-482.016) (-482.459) [-478.227] * [-476.908] (-475.460) (-476.049) (-478.964) -- 0:00:05
921500 -- (-477.777) [-479.205] (-478.750) (-476.306) * (-475.407) (-481.761) [-476.239] (-480.769) -- 0:00:05
922000 -- [-478.196] (-478.174) (-477.907) (-479.269) * [-475.680] (-480.275) (-479.346) (-476.923) -- 0:00:05
922500 -- (-478.890) (-478.059) (-477.739) [-477.584] * (-476.281) [-480.989] (-479.274) (-478.873) -- 0:00:05
923000 -- (-478.419) (-476.450) (-479.878) [-474.884] * (-480.068) [-479.409] (-480.326) (-478.195) -- 0:00:05
923500 -- (-480.529) (-477.835) (-478.165) [-478.139] * (-480.402) (-479.075) [-475.872] (-475.462) -- 0:00:05
924000 -- (-478.428) (-479.748) [-475.494] (-478.764) * (-482.206) (-476.116) [-476.828] (-477.307) -- 0:00:05
924500 -- [-478.048] (-480.783) (-480.844) (-477.691) * (-478.401) (-476.166) (-480.143) [-477.515] -- 0:00:04
925000 -- (-476.908) (-482.050) [-478.808] (-476.941) * (-478.104) (-476.461) (-481.066) [-480.886] -- 0:00:04
Average standard deviation of split frequencies: 0.007318
925500 -- (-478.579) (-480.974) [-480.255] (-477.747) * (-477.843) (-481.166) [-476.711] (-479.104) -- 0:00:04
926000 -- (-480.977) (-478.903) (-479.378) [-475.352] * [-477.034] (-478.638) (-477.784) (-479.565) -- 0:00:04
926500 -- (-478.784) (-479.660) (-477.868) [-476.811] * (-480.983) (-479.796) (-475.051) [-482.100] -- 0:00:04
927000 -- (-478.985) [-481.044] (-476.910) (-476.041) * (-485.771) (-477.873) (-477.535) [-479.317] -- 0:00:04
927500 -- (-477.335) [-476.252] (-479.245) (-477.791) * (-479.347) (-479.051) (-478.925) [-480.645] -- 0:00:04
928000 -- (-477.309) (-481.365) (-477.180) [-476.876] * (-484.342) (-480.651) [-478.486] (-478.831) -- 0:00:04
928500 -- [-475.346] (-478.298) (-478.121) (-478.339) * (-477.225) (-480.346) (-480.508) [-477.206] -- 0:00:04
929000 -- (-479.665) [-476.412] (-478.833) (-478.640) * (-480.468) (-478.349) (-476.384) [-476.529] -- 0:00:04
929500 -- (-477.376) (-481.851) (-480.281) [-478.666] * (-477.022) (-479.392) [-476.693] (-481.475) -- 0:00:04
930000 -- (-476.194) (-480.754) (-477.555) [-478.434] * (-478.267) (-481.691) (-476.109) [-477.818] -- 0:00:04
Average standard deviation of split frequencies: 0.007058
930500 -- [-475.170] (-480.891) (-480.004) (-479.284) * (-478.140) (-476.804) [-477.169] (-478.546) -- 0:00:04
931000 -- [-477.163] (-483.056) (-476.224) (-481.834) * (-475.282) (-478.913) [-482.756] (-478.842) -- 0:00:04
931500 -- (-479.104) (-480.922) (-476.184) [-477.846] * (-476.647) (-479.240) [-477.468] (-479.580) -- 0:00:04
932000 -- (-479.884) [-482.534] (-478.872) (-477.537) * (-479.546) [-477.536] (-476.880) (-480.794) -- 0:00:04
932500 -- [-475.780] (-482.520) (-479.847) (-478.169) * (-476.597) (-478.340) [-474.738] (-479.190) -- 0:00:04
933000 -- (-475.876) [-479.121] (-478.292) (-481.530) * (-478.558) [-476.777] (-477.948) (-476.862) -- 0:00:04
933500 -- [-476.627] (-479.150) (-478.795) (-478.450) * [-477.250] (-478.214) (-481.452) (-477.908) -- 0:00:04
934000 -- (-476.312) (-477.758) (-480.248) [-476.386] * (-478.225) (-481.713) (-476.344) [-477.745] -- 0:00:04
934500 -- [-476.745] (-480.854) (-482.597) (-477.867) * (-484.688) (-479.663) [-481.508] (-477.335) -- 0:00:04
935000 -- [-481.095] (-478.716) (-483.284) (-478.114) * (-481.433) (-480.723) [-477.908] (-478.400) -- 0:00:04
Average standard deviation of split frequencies: 0.006849
935500 -- [-475.869] (-482.813) (-481.652) (-480.080) * (-478.578) [-479.131] (-478.573) (-482.594) -- 0:00:04
936000 -- (-478.574) (-478.854) (-485.115) [-480.452] * (-477.079) (-477.049) [-475.215] (-480.294) -- 0:00:04
936500 -- (-482.158) (-478.744) (-484.506) [-479.374] * (-476.126) [-477.759] (-480.388) (-481.416) -- 0:00:04
937000 -- (-478.290) [-476.058] (-480.422) (-480.047) * (-480.714) (-478.781) [-477.892] (-481.441) -- 0:00:04
937500 -- [-479.862] (-476.359) (-481.125) (-477.502) * (-478.462) (-478.035) (-478.834) [-479.039] -- 0:00:04
938000 -- (-479.140) [-475.140] (-478.990) (-478.403) * (-480.003) (-477.589) [-475.692] (-476.902) -- 0:00:04
938500 -- (-477.766) [-475.479] (-477.359) (-475.635) * [-478.890] (-476.025) (-478.718) (-477.369) -- 0:00:04
939000 -- (-483.340) [-477.686] (-476.469) (-478.142) * (-477.686) (-476.020) [-477.720] (-479.499) -- 0:00:04
939500 -- (-483.031) (-477.701) (-478.329) [-477.452] * (-476.478) (-474.938) [-477.049] (-479.273) -- 0:00:03
940000 -- (-480.261) [-479.005] (-477.795) (-479.031) * (-477.276) (-475.652) (-480.061) [-482.550] -- 0:00:03
Average standard deviation of split frequencies: 0.006615
940500 -- (-479.551) (-478.835) [-477.462] (-476.010) * (-478.145) (-484.485) [-477.592] (-476.384) -- 0:00:03
941000 -- [-477.919] (-480.632) (-478.295) (-478.736) * (-479.313) [-478.364] (-477.069) (-476.503) -- 0:00:03
941500 -- [-481.917] (-477.389) (-479.919) (-476.004) * [-478.638] (-479.878) (-479.668) (-474.865) -- 0:00:03
942000 -- (-478.660) (-476.020) (-477.761) [-476.556] * (-479.683) (-478.641) (-479.549) [-478.439] -- 0:00:03
942500 -- (-489.446) (-476.692) (-477.537) [-478.661] * (-480.196) (-478.648) (-478.160) [-476.654] -- 0:00:03
943000 -- (-486.313) [-476.470] (-478.461) (-477.827) * (-478.123) (-477.993) [-475.253] (-479.243) -- 0:00:03
943500 -- (-480.038) [-478.786] (-481.564) (-480.272) * (-475.440) (-475.265) [-475.798] (-479.528) -- 0:00:03
944000 -- (-481.246) (-480.822) (-480.810) [-480.071] * (-479.543) (-477.693) (-478.694) [-478.343] -- 0:00:03
944500 -- [-479.782] (-484.426) (-479.032) (-478.034) * (-491.132) [-478.562] (-477.643) (-481.410) -- 0:00:03
945000 -- (-482.594) [-482.010] (-481.792) (-477.640) * (-480.946) [-475.940] (-483.420) (-477.470) -- 0:00:03
Average standard deviation of split frequencies: 0.006312
945500 -- [-478.026] (-478.608) (-479.300) (-479.060) * (-481.058) [-478.779] (-480.353) (-480.056) -- 0:00:03
946000 -- (-479.295) [-476.150] (-479.082) (-481.299) * (-478.344) (-482.151) (-477.377) [-478.143] -- 0:00:03
946500 -- (-478.742) (-474.458) (-476.899) [-477.032] * [-479.892] (-480.729) (-485.384) (-478.346) -- 0:00:03
947000 -- (-480.652) (-479.487) [-482.456] (-479.748) * (-479.533) (-481.120) (-478.489) [-476.204] -- 0:00:03
947500 -- (-479.210) (-479.908) [-476.350] (-479.018) * [-479.521] (-479.085) (-480.299) (-478.335) -- 0:00:03
948000 -- [-479.384] (-479.386) (-479.577) (-479.221) * (-479.574) [-477.925] (-482.582) (-479.548) -- 0:00:03
948500 -- (-479.958) [-476.965] (-479.567) (-478.626) * (-478.706) (-476.432) [-478.372] (-481.195) -- 0:00:03
949000 -- (-477.530) [-478.256] (-478.026) (-481.590) * [-477.432] (-479.232) (-478.257) (-480.134) -- 0:00:03
949500 -- (-480.963) (-476.960) [-478.392] (-480.655) * [-476.087] (-482.438) (-478.933) (-477.166) -- 0:00:03
950000 -- (-482.070) (-479.100) [-477.010] (-478.507) * (-478.638) [-479.293] (-480.039) (-477.932) -- 0:00:03
Average standard deviation of split frequencies: 0.006149
950500 -- [-477.802] (-479.237) (-480.872) (-480.622) * (-477.578) [-477.809] (-482.092) (-479.724) -- 0:00:03
951000 -- (-480.582) [-478.131] (-475.927) (-480.272) * [-479.337] (-479.480) (-478.951) (-476.003) -- 0:00:03
951500 -- (-479.732) (-482.515) (-477.571) [-477.217] * [-479.261] (-476.409) (-481.166) (-480.095) -- 0:00:03
952000 -- [-478.078] (-478.987) (-479.610) (-479.997) * (-478.361) [-475.867] (-480.694) (-480.331) -- 0:00:03
952500 -- (-478.424) (-477.659) [-476.610] (-479.159) * (-477.622) (-480.384) (-479.817) [-476.341] -- 0:00:03
953000 -- (-481.441) (-480.765) (-477.548) [-477.487] * (-477.188) [-481.052] (-479.149) (-478.598) -- 0:00:03
953500 -- (-477.211) (-477.241) (-476.730) [-477.735] * (-478.161) (-480.684) (-478.140) [-476.329] -- 0:00:03
954000 -- (-479.137) (-475.737) (-480.142) [-477.886] * (-481.420) (-477.287) [-479.011] (-484.075) -- 0:00:03
954500 -- (-477.818) (-477.171) (-477.536) [-479.344] * (-479.175) (-480.566) [-479.437] (-482.185) -- 0:00:03
955000 -- [-478.967] (-481.260) (-480.416) (-481.310) * [-477.479] (-482.843) (-482.811) (-475.463) -- 0:00:02
Average standard deviation of split frequencies: 0.006279
955500 -- [-476.538] (-477.354) (-478.563) (-476.124) * (-477.672) (-476.821) (-479.350) [-477.140] -- 0:00:02
956000 -- (-475.227) (-480.248) [-476.730] (-478.664) * (-477.974) (-478.066) (-478.306) [-475.605] -- 0:00:02
956500 -- [-481.274] (-478.535) (-478.377) (-476.529) * (-477.934) [-479.768] (-477.524) (-476.535) -- 0:00:02
957000 -- (-476.986) (-479.786) [-479.399] (-478.014) * (-477.576) [-479.218] (-481.040) (-478.298) -- 0:00:02
957500 -- (-478.082) [-479.473] (-481.432) (-478.036) * (-477.041) (-476.971) (-477.346) [-476.882] -- 0:00:02
958000 -- (-478.161) (-478.460) (-477.642) [-477.179] * (-476.220) [-479.841] (-477.699) (-477.787) -- 0:00:02
958500 -- (-477.889) (-480.624) (-478.536) [-477.699] * (-477.747) (-478.855) [-477.875] (-477.575) -- 0:00:02
959000 -- [-475.755] (-483.661) (-479.979) (-479.719) * (-476.979) (-479.714) [-480.497] (-479.778) -- 0:00:02
959500 -- (-476.636) [-482.145] (-477.036) (-479.172) * (-477.609) (-475.844) (-482.465) [-479.239] -- 0:00:02
960000 -- [-477.846] (-478.821) (-479.889) (-478.490) * (-477.291) [-477.200] (-483.714) (-478.716) -- 0:00:02
Average standard deviation of split frequencies: 0.006216
960500 -- (-477.983) [-478.446] (-477.476) (-479.980) * (-477.837) (-479.302) [-477.379] (-477.965) -- 0:00:02
961000 -- (-478.016) [-477.351] (-479.050) (-476.074) * (-476.706) [-478.933] (-479.074) (-480.030) -- 0:00:02
961500 -- (-476.907) [-479.607] (-480.776) (-477.322) * [-477.961] (-479.127) (-481.062) (-479.929) -- 0:00:02
962000 -- (-477.492) (-479.558) [-477.700] (-478.805) * [-477.715] (-478.764) (-477.228) (-478.842) -- 0:00:02
962500 -- (-480.178) (-478.531) [-477.864] (-478.290) * (-482.029) (-479.879) [-479.046] (-477.480) -- 0:00:02
963000 -- [-478.580] (-480.488) (-478.178) (-477.594) * (-482.595) [-480.631] (-475.625) (-479.424) -- 0:00:02
963500 -- (-476.185) [-476.162] (-478.825) (-477.334) * (-477.616) [-477.899] (-475.966) (-477.840) -- 0:00:02
964000 -- (-475.148) (-479.548) (-475.411) [-476.376] * (-479.190) (-480.312) (-478.143) [-477.679] -- 0:00:02
964500 -- [-478.390] (-477.906) (-476.753) (-479.017) * [-478.844] (-479.084) (-478.869) (-476.070) -- 0:00:02
965000 -- (-476.953) (-484.157) [-476.241] (-477.308) * (-478.578) [-476.990] (-479.464) (-478.489) -- 0:00:02
Average standard deviation of split frequencies: 0.006279
965500 -- [-479.605] (-483.193) (-476.421) (-479.588) * (-476.605) (-477.885) [-479.138] (-480.536) -- 0:00:02
966000 -- [-479.262] (-479.509) (-476.125) (-476.679) * [-477.264] (-481.497) (-478.884) (-479.715) -- 0:00:02
966500 -- (-478.255) [-483.118] (-475.646) (-477.955) * (-477.323) [-483.891] (-477.519) (-479.996) -- 0:00:02
967000 -- (-479.984) (-478.471) [-479.652] (-477.437) * [-477.394] (-478.714) (-477.670) (-480.592) -- 0:00:02
967500 -- (-478.975) (-477.739) (-480.599) [-477.367] * (-480.462) (-478.460) [-481.516] (-479.146) -- 0:00:02
968000 -- (-479.897) (-481.833) [-477.695] (-482.235) * (-476.566) (-478.879) (-479.247) [-481.653] -- 0:00:02
968500 -- (-481.385) (-479.858) (-480.758) [-479.353] * (-478.367) (-478.836) (-483.119) [-478.595] -- 0:00:02
969000 -- (-478.009) (-478.899) [-480.295] (-479.499) * (-478.271) (-480.963) [-476.365] (-483.819) -- 0:00:02
969500 -- (-476.412) (-478.877) [-477.398] (-477.745) * (-478.311) [-477.375] (-478.936) (-477.605) -- 0:00:02
970000 -- (-477.863) [-479.215] (-476.953) (-478.315) * [-477.141] (-478.136) (-479.081) (-476.565) -- 0:00:01
Average standard deviation of split frequencies: 0.006378
970500 -- (-479.967) (-478.079) [-477.151] (-477.809) * [-483.428] (-478.330) (-479.576) (-478.461) -- 0:00:01
971000 -- (-481.008) (-478.710) [-479.827] (-476.771) * (-476.432) (-479.758) (-480.720) [-477.981] -- 0:00:01
971500 -- [-479.178] (-480.085) (-477.151) (-474.861) * (-477.833) (-478.601) (-479.592) [-476.815] -- 0:00:01
972000 -- (-479.362) (-476.606) (-476.774) [-479.414] * (-478.083) (-480.084) [-479.059] (-483.192) -- 0:00:01
972500 -- (-481.058) (-481.041) (-485.375) [-479.095] * (-477.057) (-482.227) (-478.962) [-478.631] -- 0:00:01
973000 -- (-479.244) (-478.241) [-474.879] (-479.033) * (-477.905) [-477.374] (-479.140) (-477.825) -- 0:00:01
973500 -- (-480.691) [-476.140] (-477.449) (-477.996) * (-480.249) [-477.123] (-479.971) (-479.544) -- 0:00:01
974000 -- (-477.373) [-477.896] (-482.126) (-481.040) * [-481.601] (-477.181) (-481.596) (-481.607) -- 0:00:01
974500 -- (-481.525) (-479.850) (-479.455) [-478.566] * (-479.933) [-479.250] (-478.053) (-480.859) -- 0:00:01
975000 -- (-479.759) [-479.196] (-480.174) (-478.013) * [-477.642] (-479.030) (-479.307) (-482.503) -- 0:00:01
Average standard deviation of split frequencies: 0.006021
975500 -- (-475.616) (-477.734) (-478.352) [-480.029] * (-477.753) (-481.363) [-477.454] (-479.275) -- 0:00:01
976000 -- [-478.387] (-479.532) (-478.559) (-479.809) * [-477.392] (-478.412) (-479.937) (-480.706) -- 0:00:01
976500 -- (-479.160) (-479.097) [-484.351] (-480.116) * (-478.225) [-477.891] (-476.545) (-479.511) -- 0:00:01
977000 -- (-477.222) (-476.479) [-477.700] (-478.131) * [-477.004] (-475.956) (-477.886) (-482.028) -- 0:00:01
977500 -- [-476.626] (-477.735) (-476.493) (-479.683) * [-477.285] (-475.420) (-476.430) (-483.637) -- 0:00:01
978000 -- (-475.440) (-478.795) [-476.985] (-477.270) * (-475.271) [-477.903] (-476.652) (-477.775) -- 0:00:01
978500 -- (-478.453) [-477.919] (-480.234) (-480.256) * (-476.157) [-479.143] (-479.169) (-480.115) -- 0:00:01
979000 -- (-477.768) (-476.880) [-478.484] (-478.755) * (-479.866) (-477.919) (-475.877) [-476.479] -- 0:00:01
979500 -- (-479.511) [-476.391] (-479.954) (-480.614) * (-477.264) [-478.296] (-475.829) (-479.601) -- 0:00:01
980000 -- (-478.472) (-477.268) (-477.415) [-478.926] * [-477.921] (-477.813) (-478.780) (-477.510) -- 0:00:01
Average standard deviation of split frequencies: 0.005672
980500 -- (-477.938) [-478.392] (-478.245) (-479.411) * (-479.552) (-478.347) (-480.484) [-478.494] -- 0:00:01
981000 -- [-477.875] (-479.708) (-476.807) (-481.765) * (-477.284) [-476.719] (-477.660) (-476.672) -- 0:00:01
981500 -- (-481.883) (-478.427) (-477.085) [-484.915] * (-476.976) (-480.283) (-478.906) [-476.754] -- 0:00:01
982000 -- [-477.752] (-478.903) (-477.709) (-479.677) * (-477.582) (-479.316) [-477.614] (-479.333) -- 0:00:01
982500 -- (-479.651) (-478.145) (-477.150) [-475.289] * (-482.022) (-482.022) (-476.647) [-477.869] -- 0:00:01
983000 -- (-479.900) (-476.060) (-476.134) [-478.273] * [-478.041] (-476.798) (-483.708) (-479.783) -- 0:00:01
983500 -- (-482.162) (-477.371) [-476.676] (-478.267) * (-479.282) (-477.771) (-477.898) [-477.151] -- 0:00:01
984000 -- (-477.532) (-476.879) (-476.299) [-477.728] * (-479.382) (-476.688) [-477.697] (-476.250) -- 0:00:01
984500 -- (-476.407) (-475.822) [-476.689] (-477.865) * (-477.058) [-479.839] (-479.261) (-477.576) -- 0:00:01
985000 -- (-477.930) [-476.405] (-480.973) (-478.442) * (-475.344) [-478.674] (-476.751) (-480.654) -- 0:00:00
Average standard deviation of split frequencies: 0.005418
985500 -- (-479.745) [-479.231] (-477.174) (-478.541) * [-478.262] (-480.189) (-476.749) (-477.169) -- 0:00:00
986000 -- [-477.866] (-479.692) (-478.836) (-477.765) * [-478.816] (-479.058) (-476.453) (-477.031) -- 0:00:00
986500 -- [-478.761] (-480.499) (-477.878) (-475.758) * (-477.253) (-477.159) [-476.596] (-485.593) -- 0:00:00
987000 -- (-479.394) (-476.236) (-481.314) [-476.082] * (-480.126) (-479.331) (-478.274) [-476.252] -- 0:00:00
987500 -- (-479.462) [-478.919] (-482.140) (-475.964) * (-478.354) (-479.026) (-481.218) [-476.963] -- 0:00:00
988000 -- (-478.625) [-477.397] (-479.347) (-476.411) * (-479.890) (-476.459) (-477.276) [-477.516] -- 0:00:00
988500 -- (-478.504) [-476.680] (-478.339) (-480.409) * (-475.698) [-477.896] (-475.589) (-476.716) -- 0:00:00
989000 -- [-476.219] (-479.398) (-479.212) (-479.698) * (-477.664) (-478.376) (-477.886) [-476.386] -- 0:00:00
989500 -- (-477.328) [-478.694] (-478.392) (-482.066) * [-477.898] (-482.055) (-477.796) (-476.881) -- 0:00:00
990000 -- (-476.749) (-477.744) [-478.719] (-483.783) * (-478.887) (-476.794) (-479.316) [-476.788] -- 0:00:00
Average standard deviation of split frequencies: 0.005561
990500 -- [-477.219] (-478.504) (-474.999) (-478.405) * (-478.111) (-476.456) [-475.996] (-475.821) -- 0:00:00
991000 -- (-476.190) (-475.870) (-477.904) [-482.417] * (-477.289) (-476.284) [-478.159] (-476.893) -- 0:00:00
991500 -- [-476.129] (-476.567) (-481.820) (-489.679) * (-478.575) [-477.317] (-479.514) (-476.781) -- 0:00:00
992000 -- (-479.251) [-478.409] (-481.542) (-477.447) * (-481.559) [-477.273] (-477.956) (-480.517) -- 0:00:00
992500 -- [-476.019] (-476.987) (-478.914) (-477.986) * (-479.282) (-475.680) (-477.418) [-477.434] -- 0:00:00
993000 -- (-475.919) (-476.947) [-478.170] (-481.836) * (-476.178) [-476.586] (-481.154) (-481.660) -- 0:00:00
993500 -- (-477.536) (-478.462) [-476.773] (-480.611) * (-475.258) [-477.988] (-478.136) (-482.936) -- 0:00:00
994000 -- [-478.013] (-478.904) (-478.314) (-475.474) * [-476.270] (-476.209) (-478.893) (-479.918) -- 0:00:00
994500 -- [-477.076] (-480.263) (-476.988) (-477.695) * (-479.832) [-478.476] (-477.850) (-481.143) -- 0:00:00
995000 -- (-476.203) (-477.311) [-477.277] (-481.977) * (-482.045) [-478.284] (-479.454) (-479.646) -- 0:00:00
Average standard deviation of split frequencies: 0.005473
995500 -- (-478.229) (-485.361) (-476.557) [-480.844] * [-478.166] (-477.107) (-479.473) (-480.020) -- 0:00:00
996000 -- [-475.531] (-478.668) (-479.106) (-478.959) * (-482.468) (-477.906) (-481.536) [-476.442] -- 0:00:00
996500 -- [-476.865] (-482.551) (-477.779) (-479.290) * [-477.512] (-487.582) (-476.426) (-476.465) -- 0:00:00
997000 -- (-482.467) (-482.021) (-478.786) [-478.206] * (-479.120) (-481.548) (-478.342) [-481.156] -- 0:00:00
997500 -- (-478.744) [-479.316] (-476.475) (-480.462) * (-482.394) (-479.949) (-478.202) [-477.039] -- 0:00:00
998000 -- (-477.597) [-479.356] (-478.467) (-476.404) * (-482.013) (-479.758) (-479.532) [-478.404] -- 0:00:00
998500 -- (-478.598) [-477.680] (-476.425) (-478.391) * [-479.108] (-482.189) (-478.678) (-477.309) -- 0:00:00
999000 -- (-478.451) (-483.459) (-480.178) [-479.651] * (-476.216) (-484.351) (-477.208) [-477.511] -- 0:00:00
999500 -- (-479.721) (-477.974) [-480.544] (-479.177) * (-479.885) (-479.637) [-477.301] (-478.965) -- 0:00:00
1000000 -- (-477.909) [-479.229] (-477.620) (-480.638) * (-478.012) (-480.213) (-481.281) [-478.705] -- 0:00:00
Average standard deviation of split frequencies: 0.004931
Analysis completed in 1 mins 7 seconds
Analysis used 65.53 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -473.14
Likelihood of best state for "cold" chain of run 2 was -473.21
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.0 % ( 62 %) Dirichlet(Revmat{all})
97.8 % ( 94 %) Slider(Revmat{all})
36.6 % ( 24 %) Dirichlet(Pi{all})
36.9 % ( 21 %) Slider(Pi{all})
67.8 % ( 42 %) Multiplier(Alpha{1,2})
79.1 % ( 58 %) Multiplier(Alpha{3})
28.6 % ( 22 %) Slider(Pinvar{all})
96.9 % ( 97 %) ExtSPR(Tau{all},V{all})
68.6 % ( 64 %) ExtTBR(Tau{all},V{all})
98.0 % ( 99 %) NNI(Tau{all},V{all})
87.7 % ( 82 %) ParsSPR(Tau{all},V{all})
28.1 % ( 17 %) Multiplier(V{all})
94.5 % ( 93 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.1 % ( 61 %) Dirichlet(Revmat{all})
97.9 % ( 97 %) Slider(Revmat{all})
36.7 % ( 25 %) Dirichlet(Pi{all})
36.8 % ( 27 %) Slider(Pi{all})
67.5 % ( 38 %) Multiplier(Alpha{1,2})
78.5 % ( 45 %) Multiplier(Alpha{3})
28.4 % ( 19 %) Slider(Pinvar{all})
97.1 % ( 96 %) ExtSPR(Tau{all},V{all})
69.1 % ( 57 %) ExtTBR(Tau{all},V{all})
97.9 % ( 98 %) NNI(Tau{all},V{all})
87.8 % ( 82 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
94.5 % ( 96 %) Nodeslider(V{all})
30.4 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166076 0.82 0.66
3 | 167010 166532 0.83
4 | 166881 166915 166586
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.49
2 | 166860 0.82 0.66
3 | 166821 166646 0.83
4 | 166228 166283 167162
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -477.30
| 2 1 |
| 2 2 1 |
| 1 1 2 1 2|
| 1 1 11 1 2 1 2 2 11 21 2 |
|1 1 1 2 1 111 2 2 2 1 1 2 |
| 22 2 2 2 1 1 * 1 1 2 211 |
| 2 * *1 1 2 2 2 2 2 2 1 1|
| 1 2 2 2 1 2 2 2 2 2 1 2 1 222 1211 |
| 1 2 1* 1 1* 12 2 1 1 |
| 2 2 1 21 2 |
| 2 2 1 1 1 |
|2 1 1 2 |
| 1 2 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -479.34
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -477.04 -480.91
2 -477.13 -480.98
--------------------------------------
TOTAL -477.09 -480.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871304 0.085820 0.362002 1.454417 0.841820 1407.65 1441.25 1.000
r(A<->C){all} 0.137856 0.017652 0.000065 0.409276 0.093309 205.53 232.48 1.004
r(A<->G){all} 0.164309 0.019097 0.000084 0.448855 0.128100 234.01 281.06 1.004
r(A<->T){all} 0.167065 0.018997 0.000103 0.438343 0.133236 160.32 203.45 1.006
r(C<->G){all} 0.122833 0.014300 0.000037 0.369512 0.086355 167.61 188.67 1.008
r(C<->T){all} 0.230397 0.026036 0.000154 0.537451 0.201197 220.13 229.44 1.002
r(G<->T){all} 0.177540 0.023435 0.000085 0.485744 0.135659 223.76 264.73 1.004
pi(A){all} 0.223115 0.000514 0.179320 0.266484 0.222802 1262.12 1321.49 1.000
pi(C){all} 0.261679 0.000544 0.216506 0.306771 0.260700 1262.04 1312.84 1.000
pi(G){all} 0.318106 0.000588 0.270558 0.365462 0.317565 1044.05 1234.18 1.001
pi(T){all} 0.197100 0.000440 0.158302 0.238644 0.196765 1071.20 1229.66 1.002
alpha{1,2} 0.290074 0.096220 0.000362 0.881767 0.196103 1189.97 1219.67 1.000
alpha{3} 0.391940 0.200927 0.000109 1.310498 0.232198 1209.55 1279.87 1.000
pinvar{all} 0.989214 0.000080 0.971985 0.999591 0.991539 1028.33 1264.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .***.*
9 -- .*...*
10 -- ...*.*
11 -- .**.**
12 -- ....**
13 -- ..****
14 -- ..*.*.
15 -- .*.***
16 -- ..*..*
17 -- .*..*.
18 -- ..**..
19 -- .**...
20 -- .*.*..
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.016488 0.140573 0.163891 2
8 451 0.150233 0.000471 0.149900 0.150566 2
9 444 0.147901 0.001884 0.146569 0.149234 2
10 440 0.146569 0.000942 0.145903 0.147235 2
11 440 0.146569 0.004711 0.143238 0.149900 2
12 437 0.145570 0.012719 0.136576 0.154564 2
13 436 0.145237 0.004711 0.141905 0.148568 2
14 433 0.144237 0.000471 0.143904 0.144570 2
15 430 0.143238 0.006595 0.138574 0.147901 2
16 425 0.141572 0.001413 0.140573 0.142572 2
17 420 0.139907 0.000000 0.139907 0.139907 2
18 420 0.139907 0.004711 0.136576 0.143238 2
19 406 0.135243 0.006595 0.130580 0.139907 2
20 405 0.134910 0.010835 0.127249 0.142572 2
21 401 0.133578 0.001413 0.132578 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.089093 0.008404 0.000024 0.277882 0.059284 1.000 2
length{all}[2] 0.088293 0.008247 0.000006 0.265400 0.060499 1.000 2
length{all}[3] 0.091814 0.008860 0.000007 0.277219 0.063897 1.000 2
length{all}[4] 0.087954 0.008484 0.000006 0.273393 0.058232 1.000 2
length{all}[5] 0.088767 0.008578 0.000021 0.267578 0.061282 1.000 2
length{all}[6] 0.150352 0.015359 0.000103 0.395581 0.119773 1.000 2
length{all}[7] 0.092578 0.008689 0.000029 0.260611 0.062869 0.998 2
length{all}[8] 0.094868 0.008740 0.000150 0.293041 0.062331 1.001 2
length{all}[9] 0.091381 0.007768 0.000416 0.280445 0.065978 1.000 2
length{all}[10] 0.090681 0.007619 0.000312 0.273990 0.062879 1.002 2
length{all}[11] 0.094232 0.010002 0.000280 0.284310 0.061215 0.999 2
length{all}[12] 0.105375 0.010593 0.000012 0.310502 0.074793 1.001 2
length{all}[13] 0.089800 0.009601 0.000491 0.295445 0.058460 1.002 2
length{all}[14] 0.090509 0.008481 0.000023 0.259285 0.061760 1.006 2
length{all}[15] 0.087434 0.007396 0.000002 0.260935 0.060270 0.998 2
length{all}[16] 0.085104 0.008390 0.000212 0.254685 0.054868 0.998 2
length{all}[17] 0.089123 0.008054 0.000273 0.246169 0.063583 1.000 2
length{all}[18] 0.096519 0.009140 0.000199 0.275821 0.067782 1.000 2
length{all}[19] 0.091974 0.008233 0.000043 0.264503 0.062352 0.999 2
length{all}[20] 0.088429 0.007362 0.000542 0.257315 0.060181 0.998 2
length{all}[21] 0.088598 0.006366 0.000923 0.246838 0.068142 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004931
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------ C1 (1)
|
|------------------------------------ C2 (2)
|
|-------------------------------------- C3 (3)
+
|----------------------------------- C4 (4)
|
|------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 339
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 113 / 113 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 113 / 113 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.073489 0.107148 0.056825 0.081787 0.073688 0.071234 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -487.433060
Iterating by ming2
Initial: fx= 487.433060
x= 0.07349 0.10715 0.05683 0.08179 0.07369 0.07123 0.30000 1.30000
1 h-m-p 0.0000 0.0005 263.7103 +++ 451.912897 m 0.0005 14 | 1/8
2 h-m-p 0.0000 0.0000 2158.6666 ++ 444.262120 m 0.0000 25 | 2/8
3 h-m-p 0.0000 0.0000 50608.3175 ++ 444.192771 m 0.0000 36 | 3/8
4 h-m-p 0.0000 0.0000 283.3568 ++ 442.324716 m 0.0000 47 | 4/8
5 h-m-p 0.0000 0.0000 1689.0315 ++ 439.346787 m 0.0000 58 | 5/8
6 h-m-p 0.0012 0.5986 3.0064 ++++YYCYCCC 438.018112 6 0.3688 82 | 5/8
7 h-m-p 1.6000 8.0000 0.4593 CCCC 437.906906 3 0.3597 99 | 5/8
8 h-m-p 0.6417 8.0000 0.2575 ++ 437.459285 m 8.0000 113 | 5/8
9 h-m-p 1.6000 8.0000 1.0030 ++ 437.072580 m 8.0000 127 | 5/8
10 h-m-p 1.6000 8.0000 1.4528 ++ 436.955098 m 8.0000 138 | 5/8
11 h-m-p 1.6000 8.0000 4.6527 ++ 436.879453 m 8.0000 149 | 5/8
12 h-m-p 1.6000 8.0000 6.1147 CCC 436.864746 2 2.2777 164 | 5/8
13 h-m-p 1.6000 8.0000 7.7137 ++ 436.845690 m 8.0000 175 | 5/8
14 h-m-p 1.6000 8.0000 22.7559 CCC 436.837691 2 2.2736 190 | 5/8
15 h-m-p 1.6000 8.0000 25.7346 +YCC 436.831042 2 4.5413 205 | 5/8
16 h-m-p 1.6000 8.0000 45.4063 YC 436.827167 1 2.6330 217 | 5/8
17 h-m-p 1.6000 8.0000 60.9747 +YC 436.824222 1 4.3667 230 | 5/8
18 h-m-p 0.9373 4.6866 98.8775 +YC 436.822536 1 2.5136 243 | 5/8
19 h-m-p 0.3177 1.5886 135.2499 ++ 436.821701 m 1.5886 254 | 6/8
20 h-m-p 0.7338 3.6692 114.5890 YC 436.821581 1 1.6776 266 | 6/8
21 h-m-p 0.8149 4.0746 56.0095 ++ 436.821441 m 4.0746 277 | 7/8
22 h-m-p 1.6000 8.0000 0.0000 C 436.821441 0 1.2807 288
Out..
lnL = -436.821441
289 lfun, 289 eigenQcodon, 1734 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.048573 0.016335 0.042957 0.012071 0.031177 0.085338 999.000000 0.652043 0.431855
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.023470
np = 9
lnL0 = -460.146504
Iterating by ming2
Initial: fx= 460.146504
x= 0.04857 0.01633 0.04296 0.01207 0.03118 0.08534 951.42857 0.65204 0.43185
1 h-m-p 0.0000 0.0001 261.9858 ++ 452.601971 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 190.7774 ++ 447.107875 m 0.0002 26 | 2/9
3 h-m-p 0.0001 0.0004 78.8900 ++ 441.958482 m 0.0004 38 | 3/9
4 h-m-p 0.0010 0.0063 29.4158 ++ 438.289829 m 0.0063 50 | 4/9
5 h-m-p 0.0000 0.0001 86.6006 ++ 437.779557 m 0.0001 62 | 5/9
6 h-m-p 0.0017 0.2364 2.4003 +++YYCYCCCC 437.194624 7 0.1381 88 | 5/9
7 h-m-p 0.7302 3.6511 0.1759 YCCC 437.153294 3 1.5611 105 | 5/9
8 h-m-p 0.2544 1.2718 0.2560 ++ 437.117615 m 1.2718 121 | 6/9
9 h-m-p 1.6000 8.0000 0.0060 YC 437.116316 1 0.9068 138 | 6/9
10 h-m-p 1.6000 8.0000 0.0001 Y 437.116316 0 1.0739 153 | 6/9
11 h-m-p 1.6000 8.0000 0.0000 --C 437.116316 0 0.0350 170
Out..
lnL = -437.116316
171 lfun, 513 eigenQcodon, 2052 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.082840 0.010648 0.072149 0.078517 0.043172 0.034970 951.428584 1.255570 0.479069 0.434690 1144.153993
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000145
np = 11
lnL0 = -450.654927
Iterating by ming2
Initial: fx= 450.654927
x= 0.08284 0.01065 0.07215 0.07852 0.04317 0.03497 951.42858 1.25557 0.47907 0.43469 951.42857
1 h-m-p 0.0000 0.0004 47.5032 +++ 449.577980 m 0.0004 17 | 1/11
2 h-m-p 0.0002 0.0015 73.3360 ++ 446.603080 m 0.0015 31 | 2/11
3 h-m-p 0.0001 0.0004 205.1062 ++ 443.636270 m 0.0004 45 | 3/11
4 h-m-p 0.0072 0.0360 6.7071 +YYYCYYYYYY 440.815029 10 0.0324 70 | 3/11
5 h-m-p 0.0046 0.0228 5.2687 YC 440.813892 1 0.0006 85 | 3/11
6 h-m-p 0.0041 0.0412 0.8300 ------------.. | 3/11
7 h-m-p 0.0000 0.0003 99.2112 +++ 436.915792 m 0.0003 132 | 4/11
8 h-m-p 0.0002 0.0008 3.8138 CC 436.915091 1 0.0002 148 | 4/11
9 h-m-p 0.0160 8.0000 1.6779 -------------.. | 4/11
10 h-m-p 0.0000 0.0000 108.9445 ++ 436.864800 m 0.0000 187 | 5/11
11 h-m-p 0.0008 0.3864 0.5741 +++YCCC 436.797130 3 0.1213 209 | 5/11
12 h-m-p 1.6000 8.0000 0.0120 ++ 436.795206 m 8.0000 229 | 5/11
13 h-m-p 0.0851 8.0000 1.1274 --------------.. | 5/11
14 h-m-p 0.0002 0.0963 0.1033 Y 436.795205 0 0.0001 275 | 5/11
15 h-m-p 0.0160 8.0000 0.0217 +++++ 436.791279 m 8.0000 298 | 5/11
16 h-m-p 0.1455 8.0000 1.1953 ---------------.. | 5/11
17 h-m-p 0.0160 8.0000 0.1281 ---Y 436.791278 0 0.0001 348 | 5/11
18 h-m-p 0.0160 8.0000 0.0253 +++++ 436.785828 m 8.0000 371 | 5/11
19 h-m-p 0.1727 8.0000 1.1741 ---------------.. | 5/11
20 h-m-p 0.0160 8.0000 0.1209 --Y 436.785827 0 0.0001 420 | 5/11
21 h-m-p 0.0160 8.0000 0.0314 +++++ 436.777417 m 8.0000 443 | 5/11
22 h-m-p 0.2168 7.8254 1.1597 ---------------.. | 5/11
23 h-m-p 0.0160 8.0000 0.2507 --Y 436.777413 0 0.0001 492 | 5/11
24 h-m-p 0.0160 8.0000 0.0387 +++++ 436.763679 m 8.0000 515 | 5/11
25 h-m-p 0.2702 6.0543 1.1451 ---------------.. | 5/11
26 h-m-p 0.0160 8.0000 0.5903 --YC 436.763652 1 0.0002 565 | 5/11
27 h-m-p 0.0160 8.0000 0.0525 +++++ 436.736129 m 8.0000 588 | 5/11
28 h-m-p 0.3615 4.2203 1.1611 ---------------.. | 5/11
29 h-m-p 0.0160 8.0000 1.5744 --CC 436.735865 1 0.0002 639 | 5/11
30 h-m-p 0.0160 8.0000 0.0836 +++++ 436.655759 m 8.0000 656 | 5/11
31 h-m-p 0.4572 2.2859 1.3699 ----------------.. | 5/11
32 h-m-p 0.0160 8.0000 5.0954 -CYC 436.648495 2 0.0006 709 | 5/11
33 h-m-p 0.0165 8.0000 0.1980 ++++CCYC 436.503558 3 4.1658 732 | 5/11
34 h-m-p 0.7272 3.6359 0.0777 ++ 436.486192 m 3.6359 752 | 6/11
35 h-m-p 0.9138 8.0000 0.0807 CCC 436.481147 2 1.3348 776 | 6/11
36 h-m-p 1.6000 8.0000 0.0273 YCC 436.479872 2 0.9975 798 | 6/11
37 h-m-p 1.6000 8.0000 0.0055 C 436.479838 0 2.1820 817 | 6/11
38 h-m-p 1.3376 8.0000 0.0090 ++ 436.479561 m 8.0000 836 | 6/11
39 h-m-p 0.0792 8.0000 0.9104 ++CYC 436.476992 2 1.7267 860 | 6/11
40 h-m-p 1.6000 8.0000 0.2110 CC 436.476357 1 1.3757 881 | 6/11
41 h-m-p 0.7939 8.0000 0.3657 +C 436.475973 0 3.1757 901 | 6/11
42 h-m-p 1.6000 8.0000 0.3082 YC 436.475818 1 2.6340 921 | 6/11
43 h-m-p 1.6000 8.0000 0.3849 YC 436.475759 1 2.5671 941 | 6/11
44 h-m-p 1.6000 8.0000 0.3624 Y 436.475732 0 2.7918 960 | 6/11
45 h-m-p 1.6000 8.0000 0.3930 C 436.475720 0 2.5448 979 | 6/11
46 h-m-p 1.6000 8.0000 0.4570 Y 436.475713 0 3.5847 998 | 6/11
47 h-m-p 1.6000 8.0000 0.8062 +Y 436.475705 0 4.0897 1018 | 6/11
48 h-m-p 1.2994 8.0000 2.5375 ++ 436.475654 m 8.0000 1037 | 6/11
49 h-m-p 0.1246 0.6230 109.1517 ++ 436.475514 m 0.6230 1051 | 6/11
50 h-m-p -0.0000 -0.0000 464.8685
h-m-p: -0.00000000e+00 -0.00000000e+00 4.64868479e+02 436.475514
.. | 6/11
51 h-m-p 0.0160 8.0000 0.0449 C 436.475510 0 0.0035 1076 | 6/11
52 h-m-p 0.0227 8.0000 0.0068 +++Y 436.475484 0 1.1352 1098 | 6/11
53 h-m-p 1.6000 8.0000 0.0001 ++ 436.475484 m 8.0000 1117 | 6/11
54 h-m-p 1.0249 8.0000 0.0007 ++ 436.475484 m 8.0000 1136 | 6/11
55 h-m-p 0.0160 8.0000 5.5094 +++YC 436.474937 1 2.1223 1159 | 6/11
56 h-m-p 1.2454 6.2272 5.3815 ++ 436.471823 m 6.2272 1173 | 7/11
57 h-m-p 0.2439 8.0000 13.2213 YC 436.471435 1 0.5187 1188 | 7/11
58 h-m-p 1.6000 8.0000 2.5045 C 436.471357 0 1.9639 1202 | 7/11
59 h-m-p 1.6000 8.0000 1.3260 ++ 436.471270 m 8.0000 1216 | 7/11
60 h-m-p 0.0546 0.2728 125.7871 ++ 436.471000 m 0.2728 1230 | 8/11
61 h-m-p 0.1420 8.0000 0.0061 +YC 436.470951 1 0.9339 1246 | 8/11
62 h-m-p 1.6000 8.0000 0.0006 Y 436.470951 0 0.9711 1263 | 8/11
63 h-m-p 1.6000 8.0000 0.0000 Y 436.470951 0 1.0832 1280
Out..
lnL = -436.470951
1281 lfun, 5124 eigenQcodon, 23058 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -437.166661 S = -434.939838 -2.596121
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:07
did 20 / 39 patterns 0:07
did 30 / 39 patterns 0:07
did 39 / 39 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.048401 0.101290 0.012736 0.070361 0.068901 0.042505 999.000000 0.948439 1.936313
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.034208
np = 9
lnL0 = -472.321573
Iterating by ming2
Initial: fx= 472.321573
x= 0.04840 0.10129 0.01274 0.07036 0.06890 0.04250 951.42857 0.94844 1.93631
1 h-m-p 0.0000 0.0001 246.8995 ++ 465.063299 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 3567.5358 +YCYYYCYCCC 455.371839 10 0.0000 41 | 1/9
3 h-m-p 0.0041 0.0749 12.7837 ++YYCYCCC 454.340431 6 0.0533 64 | 1/9
4 h-m-p 0.0016 0.0081 8.7830 -----------.. | 1/9
5 h-m-p 0.0000 0.0003 327.3067 +++ 445.809108 m 0.0003 98 | 2/9
6 h-m-p 0.0000 0.0000 310.5501 ++ 442.966398 m 0.0000 110 | 3/9
7 h-m-p 0.0016 0.7947 8.7803 -----------.. | 3/9
8 h-m-p 0.0000 0.0000 183.7446 ++ 442.868744 m 0.0000 143 | 4/9
9 h-m-p 0.0000 0.0000 325.3584 ++ 441.118383 m 0.0000 155 | 5/9
10 h-m-p 0.0036 0.0811 4.0982 ++YYCYYYC 437.729793 6 0.0679 176 | 5/9
11 h-m-p 0.3361 6.7332 0.8283 CCCC 437.620201 3 0.3212 194 | 5/9
12 h-m-p 0.3684 1.8422 0.7015 YCYCCC 437.389608 5 0.7678 218 | 5/9
13 h-m-p 1.1121 5.5603 0.3506 +
QuantileBeta(0.85, 2.58176, 0.00500) = 1.000000e+00 2000 rounds
YCCC 437.227952 3 3.3836 240 | 5/9
14 h-m-p 0.2573 1.2865 0.5600 +
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
+ 437.124892 m 1.2865 256
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51636, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51649, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.51623, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
15 h-m-p 1.5601 7.8005 0.1457
QuantileBeta(0.85, 2.74373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.42583, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.63818, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.64953, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.69663, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65321, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.67492, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
C 437.116316 3 0.9405 277
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65357, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65331, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65344, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65356, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
C 437.116316 0 1.6173 292
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.65345, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
Y 437.116316 0 0.0000 319
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -437.116316
320 lfun, 3520 eigenQcodon, 19200 P(t)
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.65347, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.033578 0.089783 0.018653 0.070148 0.101846 0.052320 951.428603 0.900000 1.136528 1.057774 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000236
np = 11
lnL0 = -446.800310
Iterating by ming2
Initial: fx= 446.800310
x= 0.03358 0.08978 0.01865 0.07015 0.10185 0.05232 951.42860 0.90000 1.13653 1.05777 951.42857
1 h-m-p 0.0000 0.0013 73.4543 ++++ 440.764494 m 0.0013 18 | 1/11
2 h-m-p 0.0002 0.0012 25.0682 ++ 440.115147 m 0.0012 32 | 2/11
3 h-m-p 0.0008 0.0038 19.6700 ++ 438.796961 m 0.0038 46 | 3/11
4 h-m-p 0.0023 0.0114 3.5776 ++ 438.228386 m 0.0114 60 | 4/11
5 h-m-p 0.0003 0.0016 35.6638 ++ 436.555668 m 0.0016 74 | 5/11
6 h-m-p 1.1463 8.0000 0.0330 CYC 436.539611 2 0.1959 92 | 5/11
7 h-m-p 0.2077 8.0000 0.0311 ++YCC 436.523144 2 4.5206 117 | 5/11
8 h-m-p 1.6000 8.0000 0.0180 ++ 436.519893 m 8.0000 137 | 5/11
9 h-m-p 0.2647 3.5299 0.5430 +
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
+ 436.495615 m 3.5299 157
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60196) = 9.704439e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60169) = 9.705635e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60182) = 9.705037e-161 2000 rounds
| 6/11
10 h-m-p 0.5543 2.7716 0.9370 YCCC 436.475851 3 1.1532 182 | 6/11
11 h-m-p 1.6000 8.0000 0.0274 YC 436.475738 1 0.9454 202 | 6/11
12 h-m-p 1.0774 8.0000 0.0241 Y 436.475731 0 0.7310 221 | 6/11
13 h-m-p 1.6000 8.0000 0.0001 ++ 436.475731 m 8.0000 240 | 6/11
14 h-m-p 0.6783 8.0000 0.0014 ++ 436.475730 m 8.0000 259 | 6/11
15 h-m-p 0.6251 8.0000 0.0178 ++ 436.475724 m 8.0000 278 | 6/11
16 h-m-p 0.8955 8.0000 0.1589 ++ 436.475641 m 8.0000 297 | 6/11
17 h-m-p 0.2259 8.0000 5.6288 +
QuantileBeta(0.15, 0.00500, 2.63974) = 9.536188e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.91598) = 6.007465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55724) = 9.911292e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.20409) = 1.191326e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
C 436.474962 1 3.2633 320
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.035417e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000490e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.53761) = 1.000491e-160 2000 rounds
| 6/11
18 h-m-p 0.6367 3.1834 8.8156
QuantileBeta(0.15, 0.00500, 2.85580) = 8.675464e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.81035) = 6.197620e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
+ 436.472316 m 3.1834 334
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.855547e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12854) = 5.658027e-161 2000 rounds
| 7/11
19 h-m-p 0.0619 0.9914 50.3748
QuantileBeta(0.15, 0.00500, 5.71613) = 3.943067e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.47889) = 2.063849e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.52997) = 7.098149e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 14.36990) = 1.485269e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
C 436.471295 1 0.4044 350
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.523465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49429) = 1.472074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.49428) = 1.472075e-161 2000 rounds
| 7/11
20 h-m-p 1.6000 8.0000 0.0444
QuantileBeta(0.15, 0.00500, 14.43810) = 1.478005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.26956) = 1.496085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45992) = 1.475697e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
C 436.471180 1 0.9934 365
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.527269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45975) = 1.475714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45905) = 1.475788e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.45940) = 1.475751e-161 2000 rounds
| 7/11
21 h-m-p 0.0317 8.0000 1.3905
QuantileBeta(0.15, 0.00500, 14.48152) = 1.473418e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.54789) = 1.466461e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 14.81334) = 1.439280e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 15.87517) = 1.339935e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
+ 436.471090 m 8.0000 385
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.091608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03366) = 1.054785e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.03365) = 1.054786e-161 2000 rounds
| 7/11
22 h-m-p 0.0701 0.3506 52.1348
QuantileBeta(0.15, 0.00500, 21.87014) = 9.641679e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 27.37963) = 7.665877e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
+ 436.470967 m 0.3506 399
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.426213e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21614) = 7.175708e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.21612) = 7.175711e-162 2000 rounds
| 8/11
23 h-m-p 0.3570 1.7851 16.3642
QuantileBeta(0.15, 0.00500, 23.37390) = 9.007998e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 5.84722) = 3.846720e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
Y 436.470951 0 0.8926 414
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.510964e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459995e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.61014) = 1.459996e-161 2000 rounds
| 8/11
24 h-m-p 1.0402 5.2008 2.8083
QuantileBeta(0.15, 0.00500, 11.68911) = 1.840830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92603) = 8.427979e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
C 436.470951 0 0.9872 428
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.880145e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83772) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
| 8/11
25 h-m-p 1.6000 8.0000 0.1777
QuantileBeta(0.15, 0.00500, 12.12199) = 1.772322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.90878) = 1.805416e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.85548) = 1.813883e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.84215) = 1.816013e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83882) = 1.816546e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83799) = 1.816679e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83778) = 1.816712e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83773) = 1.816721e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83772) = 1.816723e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
Y 436.470951 0 0.0000 450
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.880145e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83802) = 1.816674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83740) = 1.816773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
| 8/11
26 h-m-p 0.0160 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816724e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
N 436.470951 0 0.0010 468
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
Out..
lnL = -436.470951
469 lfun, 5628 eigenQcodon, 30954 P(t)
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -437.149823 S = -434.939847 -2.328918
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:20
did 20 / 39 patterns 0:20
did 30 / 39 patterns 0:21
did 39 / 39 patterns 0:21
QuantileBeta(0.15, 0.00500, 11.83771) = 1.816723e-161 2000 rounds
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
NC_011896_1_WP_010908433_1_1711_MLBR_RS08095 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
NC_002677_1_NP_302112_1_984_rplS MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
NZ_CP029543_1_WP_010908433_1_1741_rplS MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
NZ_AP014567_1_WP_119607972_1_1784_rplS MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
**************************************************
NC_011896_1_WP_010908433_1_1711_MLBR_RS08095 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
NC_002677_1_NP_302112_1_984_rplS GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
NZ_CP029543_1_WP_010908433_1_1741_rplS GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
NZ_AP014567_1_WP_119607972_1_1784_rplS GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
*********************** **************************
NC_011896_1_WP_010908433_1_1711_MLBR_RS08095 ELRGKKAKIKEKR
NC_002677_1_NP_302112_1_984_rplS ELRGKKAKIKEKR
NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825 ELRGKKAKIKEKR
NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425 ELRGKKAKIKEKR
NZ_CP029543_1_WP_010908433_1_1741_rplS ELRGKKAKIKEKR
NZ_AP014567_1_WP_119607972_1_1784_rplS ELRGKKAKIKEKR
*************
>NC_011896_1_WP_010908433_1_1711_MLBR_RS08095 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC >NC_002677_1_NP_302112_1_984_rplS ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC >NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC >NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC >NZ_CP029543_1_WP_010908433_1_1741_rplS ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC >NZ_AP014567_1_WP_119607972_1_1784_rplS ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT TGGCGTCGAACGGACCTTTCTGGTACACTCGCCGAACATCGATCACATCG AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>NC_011896_1_WP_010908433_1_1711_MLBR_RS08095 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR ELRGKKAKIKEKR >NC_002677_1_NP_302112_1_984_rplS MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR ELRGKKAKIKEKR >NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR ELRGKKAKIKEKR >NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR ELRGKKAKIKEKR >NZ_CP029543_1_WP_010908433_1_1741_rplS MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR ELRGKKAKIKEKR >NZ_AP014567_1_WP_119607972_1_1784_rplS MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR ELRGKKAKIKEKR
#NEXUS
[ID: 0337908893]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908433_1_1711_MLBR_RS08095
NC_002677_1_NP_302112_1_984_rplS
NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825
NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425
NZ_CP029543_1_WP_010908433_1_1741_rplS
NZ_AP014567_1_WP_119607972_1_1784_rplS
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908433_1_1711_MLBR_RS08095,
2 NC_002677_1_NP_302112_1_984_rplS,
3 NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825,
4 NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425,
5 NZ_CP029543_1_WP_010908433_1_1741_rplS,
6 NZ_AP014567_1_WP_119607972_1_1784_rplS
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05928416,2:0.06049898,3:0.06389719,4:0.05823191,5:0.06128232,6:0.1197727);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05928416,2:0.06049898,3:0.06389719,4:0.05823191,5:0.06128232,6:0.1197727);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -477.04 -480.91
2 -477.13 -480.98
--------------------------------------
TOTAL -477.09 -480.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871304 0.085820 0.362002 1.454417 0.841820 1407.65 1441.25 1.000
r(A<->C){all} 0.137856 0.017652 0.000065 0.409276 0.093309 205.53 232.48 1.004
r(A<->G){all} 0.164309 0.019097 0.000084 0.448855 0.128100 234.01 281.06 1.004
r(A<->T){all} 0.167065 0.018997 0.000103 0.438343 0.133236 160.32 203.45 1.006
r(C<->G){all} 0.122833 0.014300 0.000037 0.369512 0.086355 167.61 188.67 1.008
r(C<->T){all} 0.230397 0.026036 0.000154 0.537451 0.201197 220.13 229.44 1.002
r(G<->T){all} 0.177540 0.023435 0.000085 0.485744 0.135659 223.76 264.73 1.004
pi(A){all} 0.223115 0.000514 0.179320 0.266484 0.222802 1262.12 1321.49 1.000
pi(C){all} 0.261679 0.000544 0.216506 0.306771 0.260700 1262.04 1312.84 1.000
pi(G){all} 0.318106 0.000588 0.270558 0.365462 0.317565 1044.05 1234.18 1.001
pi(T){all} 0.197100 0.000440 0.158302 0.238644 0.196765 1071.20 1229.66 1.002
alpha{1,2} 0.290074 0.096220 0.000362 0.881767 0.196103 1189.97 1219.67 1.000
alpha{3} 0.391940 0.200927 0.000109 1.310498 0.232198 1209.55 1279.87 1.000
pinvar{all} 0.989214 0.000080 0.971985 0.999591 0.991539 1028.33 1264.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rplS/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 113
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 4 4 4 4 4 4
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 7 7 7 7 7 7
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 4 | CCG 4 4 4 4 4 3 | CAG 3 3 3 3 3 3 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 9 9 9 9 9 9 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 9 9 9 9 9 9 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 2 2 2 2 2 2 | Gly GGT 3 3 3 3 3 3
GTC 5 5 5 5 5 5 | GCC 2 2 2 2 2 2 | GAC 5 5 5 5 5 5 | GGC 6 6 6 6 6 6
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 4 4 4 4 4 4 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 1 1 1 1 1 1 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908433_1_1711_MLBR_RS08095
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.31858 C:0.12389 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19469 C:0.25959 A:0.22419 G:0.32153
#2: NC_002677_1_NP_302112_1_984_rplS
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.31858 C:0.12389 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19469 C:0.25959 A:0.22419 G:0.32153
#3: NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.31858 C:0.12389 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19469 C:0.25959 A:0.22419 G:0.32153
#4: NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.31858 C:0.12389 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19469 C:0.25959 A:0.22419 G:0.32153
#5: NZ_CP029543_1_WP_010908433_1_1741_rplS
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.31858 C:0.12389 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19469 C:0.25959 A:0.22419 G:0.32153
#6: NZ_AP014567_1_WP_119607972_1_1784_rplS
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.32743 C:0.11504 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19764 C:0.25664 A:0.22419 G:0.32153
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 24 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 24
CTC 0 | CCC 0 | CAC 18 | CGC 42
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 19 | CCG 23 | CAG 18 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 54 | ACC 12 | AAC 12 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 54 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 12 | Gly G GGT 18
GTC 30 | GCC 12 | GAC 30 | GGC 36
GTA 6 | GCA 0 | Glu E GAA 24 | GGA 6
GTG 36 | GCG 6 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09735 C:0.23894 A:0.28319 G:0.38053
position 2: T:0.32006 C:0.12242 A:0.32743 G:0.23009
position 3: T:0.16814 C:0.41593 A:0.06195 G:0.35398
Average T:0.19518 C:0.25910 A:0.22419 G:0.32153
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -436.821441 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.008942 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008962
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.008942);
(NC_011896_1_WP_010908433_1_1711_MLBR_RS08095: 0.000004, NC_002677_1_NP_302112_1_984_rplS: 0.000004, NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825: 0.000004, NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425: 0.000004, NZ_CP029543_1_WP_010908433_1_1741_rplS: 0.000004, NZ_AP014567_1_WP_119607972_1_1784_rplS: 0.008942);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 254.1 84.9 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 254.1 84.9 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 254.1 84.9 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 254.1 84.9 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 254.1 84.9 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.009 254.1 84.9 999.0000 0.0040 0.0000 1.0 0.0
tree length for dN: 0.0040
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -437.116316 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.008874 951.428584 0.156043 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008894
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.008874);
(NC_011896_1_WP_010908433_1_1711_MLBR_RS08095: 0.000004, NC_002677_1_NP_302112_1_984_rplS: 0.000004, NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825: 0.000004, NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425: 0.000004, NZ_CP029543_1_WP_010908433_1_1741_rplS: 0.000004, NZ_AP014567_1_WP_119607972_1_1784_rplS: 0.008874);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.15604 0.84396
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.009 254.1 84.9 1.0000 0.0030 0.0030 0.8 0.3
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -436.470951 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.033680 999.000000 0.985592 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.033700
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.033680);
(NC_011896_1_WP_010908433_1_1711_MLBR_RS08095: 0.000004, NC_002677_1_NP_302112_1_984_rplS: 0.000004, NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825: 0.000004, NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425: 0.000004, NZ_CP029543_1_WP_010908433_1_1741_rplS: 0.000004, NZ_AP014567_1_WP_119607972_1_1784_rplS: 0.033680);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98559 0.00000 0.01441
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 254.1 84.9 14.3940 0.0000 0.0000 0.0 0.0
7..2 0.000 254.1 84.9 14.3940 0.0000 0.0000 0.0 0.0
7..3 0.000 254.1 84.9 14.3940 0.0000 0.0000 0.0 0.0
7..4 0.000 254.1 84.9 14.3940 0.0000 0.0000 0.0 0.0
7..5 0.000 254.1 84.9 14.3940 0.0000 0.0000 0.0 0.0
7..6 0.034 254.1 84.9 14.3940 0.0146 0.0010 3.7 0.1
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908433_1_1711_MLBR_RS08095)
Pr(w>1) post mean +- SE for w
74 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908433_1_1711_MLBR_RS08095)
Pr(w>1) post mean +- SE for w
74 P 0.723 5.044 +- 3.438
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.095 0.096 0.097 0.098 0.100 0.101 0.102 0.103 0.104 0.105
w2: 0.069 0.083 0.093 0.100 0.105 0.108 0.110 0.111 0.111 0.110
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.008
0.010 0.008 0.007
0.011 0.010 0.009 0.008 0.007
0.011 0.011 0.011 0.010 0.009 0.008 0.007
0.012 0.012 0.011 0.011 0.010 0.010 0.009 0.008 0.007
0.012 0.012 0.012 0.011 0.011 0.011 0.010 0.009 0.009 0.007 0.006
0.012 0.012 0.012 0.012 0.012 0.011 0.011 0.011 0.010 0.009 0.009 0.007 0.006
0.011 0.012 0.012 0.012 0.012 0.012 0.012 0.011 0.011 0.010 0.010 0.009 0.008 0.007 0.006
0.011 0.011 0.011 0.012 0.012 0.012 0.012 0.012 0.011 0.011 0.011 0.010 0.010 0.009 0.008 0.007 0.005
0.011 0.011 0.011 0.011 0.011 0.011 0.012 0.012 0.012 0.011 0.011 0.011 0.011 0.010 0.010 0.009 0.008 0.006 0.005
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -437.116316 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.008874 951.428603 2.653471 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008894
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.008874);
(NC_011896_1_WP_010908433_1_1711_MLBR_RS08095: 0.000004, NC_002677_1_NP_302112_1_984_rplS: 0.000004, NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825: 0.000004, NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425: 0.000004, NZ_CP029543_1_WP_010908433_1_1741_rplS: 0.000004, NZ_AP014567_1_WP_119607972_1_1784_rplS: 0.008874);
Detailed output identifying parameters
kappa (ts/tv) = 951.42860
Parameters in M7 (beta):
p = 2.65347 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 254.1 84.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.009 254.1 84.9 1.0000 0.0030 0.0030 0.8 0.3
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -436.470951 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.033680 999.000000 0.985591 0.005000 11.837712 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.033700
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.033680);
(NC_011896_1_WP_010908433_1_1711_MLBR_RS08095: 0.000004, NC_002677_1_NP_302112_1_984_rplS: 0.000004, NZ_LVXE01000006_1_WP_010908433_1_2334_A3216_RS03825: 0.000004, NZ_LYPH01000002_1_WP_010908433_1_304_A8144_RS01425: 0.000004, NZ_CP029543_1_WP_010908433_1_1741_rplS: 0.000004, NZ_AP014567_1_WP_119607972_1_1784_rplS: 0.033680);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.98559 p = 0.00500 q = 11.83771
(p1 = 0.01441) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09856 0.09856 0.09856 0.09856 0.09856 0.09856 0.09856 0.09856 0.09856 0.09856 0.01441
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 254.1 84.9 14.3943 0.0000 0.0000 0.0 0.0
7..2 0.000 254.1 84.9 14.3943 0.0000 0.0000 0.0 0.0
7..3 0.000 254.1 84.9 14.3943 0.0000 0.0000 0.0 0.0
7..4 0.000 254.1 84.9 14.3943 0.0000 0.0000 0.0 0.0
7..5 0.000 254.1 84.9 14.3943 0.0000 0.0000 0.0 0.0
7..6 0.034 254.1 84.9 14.3943 0.0146 0.0010 3.7 0.1
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908433_1_1711_MLBR_RS08095)
Pr(w>1) post mean +- SE for w
74 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908433_1_1711_MLBR_RS08095)
Pr(w>1) post mean +- SE for w
1 M 0.532 3.477 +- 3.426
2 N 0.531 3.471 +- 3.424
3 R 0.532 3.476 +- 3.425
4 L 0.535 3.495 +- 3.431
5 D 0.531 3.472 +- 3.424
6 F 0.533 3.486 +- 3.428
7 V 0.532 3.478 +- 3.426
8 D 0.531 3.472 +- 3.424
9 Q 0.534 3.492 +- 3.430
10 A 0.532 3.479 +- 3.426
11 S 0.534 3.491 +- 3.429
12 L 0.535 3.498 +- 3.431
13 R 0.533 3.484 +- 3.427
14 D 0.531 3.472 +- 3.424
15 D 0.531 3.472 +- 3.424
16 I 0.532 3.476 +- 3.425
17 P 0.534 3.488 +- 3.428
18 A 0.532 3.475 +- 3.425
19 F 0.533 3.486 +- 3.428
20 S 0.531 3.472 +- 3.424
21 P 0.534 3.488 +- 3.428
22 G 0.534 3.487 +- 3.428
23 D 0.531 3.472 +- 3.424
24 T 0.533 3.481 +- 3.427
25 I 0.532 3.476 +- 3.425
26 N 0.534 3.487 +- 3.428
27 V 0.533 3.482 +- 3.427
28 H 0.533 3.486 +- 3.428
29 V 0.532 3.478 +- 3.426
30 K 0.532 3.475 +- 3.425
31 V 0.533 3.482 +- 3.427
32 I 0.532 3.476 +- 3.425
33 E 0.532 3.476 +- 3.425
34 G 0.531 3.471 +- 3.424
35 V 0.534 3.491 +- 3.429
36 K 0.535 3.495 +- 3.430
37 E 0.532 3.476 +- 3.425
38 R 0.534 3.493 +- 3.430
39 I 0.532 3.476 +- 3.425
40 Q 0.534 3.492 +- 3.430
41 V 0.533 3.482 +- 3.427
42 F 0.533 3.486 +- 3.428
43 K 0.532 3.475 +- 3.425
44 G 0.534 3.487 +- 3.428
45 V 0.533 3.482 +- 3.427
46 V 0.532 3.478 +- 3.426
47 I 0.532 3.476 +- 3.425
48 R 0.533 3.484 +- 3.427
49 R 0.533 3.486 +- 3.428
50 Q 0.534 3.492 +- 3.430
51 G 0.531 3.471 +- 3.424
52 G 0.535 3.495 +- 3.430
53 G 0.534 3.487 +- 3.428
54 I 0.532 3.476 +- 3.425
55 R 0.533 3.484 +- 3.427
56 E 0.535 3.495 +- 3.430
57 T 0.533 3.481 +- 3.427
58 F 0.533 3.486 +- 3.428
59 T 0.532 3.478 +- 3.426
60 V 0.533 3.482 +- 3.427
61 R 0.534 3.493 +- 3.430
62 K 0.532 3.475 +- 3.425
63 E 0.535 3.495 +- 3.430
64 S 0.531 3.472 +- 3.424
65 Y 0.534 3.493 +- 3.430
66 G 0.531 3.471 +- 3.424
67 V 0.534 3.491 +- 3.429
68 G 0.531 3.471 +- 3.424
69 V 0.532 3.478 +- 3.426
70 E 0.535 3.495 +- 3.430
71 R 0.533 3.486 +- 3.428
72 T 0.532 3.478 +- 3.426
73 F 0.534 3.494 +- 3.430
74 P 0.870 5.631 +- 3.159
75 V 0.535 3.496 +- 3.431
76 H 0.533 3.486 +- 3.428
77 S 0.534 3.491 +- 3.429
78 P 0.534 3.488 +- 3.428
79 N 0.531 3.471 +- 3.424
80 I 0.532 3.476 +- 3.425
81 D 0.534 3.488 +- 3.429
82 H 0.533 3.486 +- 3.428
83 I 0.532 3.476 +- 3.425
84 E 0.532 3.476 +- 3.425
85 M 0.532 3.477 +- 3.426
86 V 0.533 3.482 +- 3.427
87 I 0.534 3.490 +- 3.429
88 R 0.534 3.493 +- 3.430
89 G 0.531 3.471 +- 3.424
90 D 0.534 3.488 +- 3.429
91 V 0.532 3.478 +- 3.426
92 R 0.533 3.484 +- 3.427
93 R 0.533 3.484 +- 3.427
94 A 0.532 3.475 +- 3.425
95 K 0.532 3.475 +- 3.425
96 L 0.535 3.495 +- 3.431
97 Y 0.534 3.493 +- 3.430
98 Y 0.534 3.493 +- 3.430
99 L 0.535 3.495 +- 3.431
100 R 0.534 3.493 +- 3.430
101 E 0.535 3.495 +- 3.430
102 L 0.535 3.495 +- 3.431
103 R 0.533 3.484 +- 3.427
104 G 0.531 3.471 +- 3.424
105 K 0.532 3.475 +- 3.425
106 K 0.532 3.475 +- 3.425
107 A 0.534 3.490 +- 3.429
108 K 0.532 3.475 +- 3.425
109 I 0.532 3.476 +- 3.425
110 K 0.532 3.475 +- 3.425
111 E 0.532 3.476 +- 3.425
112 K 0.532 3.475 +- 3.425
113 R 0.533 3.484 +- 3.427
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.103 0.107 0.111 0.113 0.114 0.112 0.107 0.097 0.081 0.055
p : 0.095 0.097 0.099 0.100 0.100 0.101 0.101 0.102 0.102 0.103
q : 0.104 0.103 0.101 0.101 0.100 0.099 0.099 0.098 0.098 0.097
ws: 0.067 0.086 0.098 0.106 0.109 0.110 0.109 0.107 0.105 0.101
Time used: 0:21
Model 1: NearlyNeutral -437.116316 Model 2: PositiveSelection -436.470951 Model 0: one-ratio -436.821441 Model 7: beta -437.116316 Model 8: beta&w>1 -436.470951 Model 0 vs 1 0.5897499999999809 Model 2 vs 1 1.2907299999999395 Model 8 vs 7 1.2907299999999395
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
