--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:44:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rplS/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -477.04 -480.91
2 -477.13 -480.98
--------------------------------------
TOTAL -477.09 -480.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871304 0.085820 0.362002 1.454417 0.841820 1407.65 1441.25 1.000
r(A<->C){all} 0.137856 0.017652 0.000065 0.409276 0.093309 205.53 232.48 1.004
r(A<->G){all} 0.164309 0.019097 0.000084 0.448855 0.128100 234.01 281.06 1.004
r(A<->T){all} 0.167065 0.018997 0.000103 0.438343 0.133236 160.32 203.45 1.006
r(C<->G){all} 0.122833 0.014300 0.000037 0.369512 0.086355 167.61 188.67 1.008
r(C<->T){all} 0.230397 0.026036 0.000154 0.537451 0.201197 220.13 229.44 1.002
r(G<->T){all} 0.177540 0.023435 0.000085 0.485744 0.135659 223.76 264.73 1.004
pi(A){all} 0.223115 0.000514 0.179320 0.266484 0.222802 1262.12 1321.49 1.000
pi(C){all} 0.261679 0.000544 0.216506 0.306771 0.260700 1262.04 1312.84 1.000
pi(G){all} 0.318106 0.000588 0.270558 0.365462 0.317565 1044.05 1234.18 1.001
pi(T){all} 0.197100 0.000440 0.158302 0.238644 0.196765 1071.20 1229.66 1.002
alpha{1,2} 0.290074 0.096220 0.000362 0.881767 0.196103 1189.97 1219.67 1.000
alpha{3} 0.391940 0.200927 0.000109 1.310498 0.232198 1209.55 1279.87 1.000
pinvar{all} 0.989214 0.000080 0.971985 0.999591 0.991539 1028.33 1264.66 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -437.116316
Model 2: PositiveSelection -436.470951
Model 0: one-ratio -436.821441
Model 7: beta -437.116316
Model 8: beta&w>1 -436.470951
Model 0 vs 1 0.5897499999999809
Model 2 vs 1 1.2907299999999395
Model 8 vs 7 1.2907299999999395
>C1
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C2
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C3
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C4
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C5
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C6
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
C1 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C2 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C3 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C4 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C5 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C6 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
**************************************************
C1 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C2 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C3 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C4 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C5 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C6 GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
*********************** **************************
C1 ELRGKKAKIKEKR
C2 ELRGKKAKIKEKR
C3 ELRGKKAKIKEKR
C4 ELRGKKAKIKEKR
C5 ELRGKKAKIKEKR
C6 ELRGKKAKIKEKR
*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3390]--->[3390]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.640 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C2 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C3 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C4 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C5 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
C6 MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
**************************************************
C1 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C2 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C3 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C4 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C5 GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
C6 GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
*********************** **************************
C1 ELRGKKAKIKEKR
C2 ELRGKKAKIKEKR
C3 ELRGKKAKIKEKR
C4 ELRGKKAKIKEKR
C5 ELRGKKAKIKEKR
C6 ELRGKKAKIKEKR
*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.12 C1 C6 99.12
TOP 5 0 99.12 C6 C1 99.12
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.12 C2 C6 99.12
TOP 5 1 99.12 C6 C2 99.12
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.12 C3 C6 99.12
TOP 5 2 99.12 C6 C3 99.12
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.12 C4 C6 99.12
TOP 5 3 99.12 C6 C4 99.12
BOT 4 5 99.12 C5 C6 99.12
TOP 5 4 99.12 C6 C5 99.12
AVG 0 C1 * 99.82
AVG 1 C2 * 99.82
AVG 2 C3 * 99.82
AVG 3 C4 * 99.82
AVG 4 C5 * 99.82
AVG 5 C6 * 99.12
TOT TOT * 99.71
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C2 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C3 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C4 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C5 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
C6 ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
**************************************************
C1 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C2 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C3 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C4 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C5 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
C6 GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
**************************************************
C1 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C2 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C3 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C4 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C5 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
C6 GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
**************************************************
C1 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C2 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C3 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C4 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C5 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
C6 GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
**************************************************
C1 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C2 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C3 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C4 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C5 TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
C6 TGGCGTCGAACGGACCTTTCTGGTACACTCGCCGAACATCGATCACATCG
******************** *****************************
C1 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C2 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C3 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C4 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C5 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
C6 AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
**************************************************
C1 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C2 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C3 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C4 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C5 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
C6 GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
***************************************
>C1
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C2
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C3
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C4
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C5
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCCGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C6
ATGAACAGGCTGGACTTCGTCGACCAGGCGTCGTTGCGCGACGACATCCC
GGCCTTCAGCCCGGGTGACACGATCAATGTGCACGTCAAGGTGATCGAGG
GCGTTAAAGAGCGTATCCAGGTGTTCAAGGGTGTGGTCATCCGCCGGCAG
GGCGGAGGTATCCGCGAAACGTTCACCGTGCGTAAGGAAAGCTATGGCGT
TGGCGTCGAACGGACCTTTCTGGTACACTCGCCGAACATCGATCACATCG
AGATGGTGATTCGTGGCGATGTCCGCCGCGCCAAGCTGTATTATCTGCGT
GAACTTCGCGGCAAGAAGGCTAAGATCAAGGAGAAGCGC
>C1
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C2
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C3
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C4
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C5
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
>C6
MNRLDFVDQASLRDDIPAFSPGDTINVHVKVIEGVKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFLVHSPNIDHIEMVIRGDVRRAKLYYLR
ELRGKKAKIKEKR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 339 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790608
Setting output file names to "/data/11res/rplS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1527838211
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0337908893
Seed = 436224347
Swapseed = 1579790608
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -762.101114 -- -24.965149
Chain 2 -- -762.101070 -- -24.965149
Chain 3 -- -762.101070 -- -24.965149
Chain 4 -- -762.100932 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -762.101114 -- -24.965149
Chain 2 -- -762.100932 -- -24.965149
Chain 3 -- -762.101114 -- -24.965149
Chain 4 -- -762.101070 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-762.101] (-762.101) (-762.101) (-762.101) * [-762.101] (-762.101) (-762.101) (-762.101)
500 -- (-486.682) (-485.383) [-483.372] (-484.445) * (-484.761) (-486.078) (-481.214) [-480.550] -- 0:00:00
1000 -- (-489.958) (-482.490) [-480.960] (-486.753) * (-480.301) (-478.659) [-477.471] (-482.469) -- 0:00:00
1500 -- (-478.796) (-483.502) [-484.562] (-483.384) * (-479.888) (-482.051) [-483.482] (-482.732) -- 0:00:00
2000 -- [-482.598] (-485.645) (-481.126) (-479.329) * (-484.717) (-482.707) (-484.848) [-476.669] -- 0:00:00
2500 -- (-484.042) [-480.507] (-491.492) (-491.847) * (-481.313) (-486.347) (-488.786) [-482.459] -- 0:00:00
3000 -- (-489.367) [-480.655] (-490.742) (-485.974) * (-484.492) [-480.674] (-484.271) (-493.527) -- 0:00:00
3500 -- (-489.608) [-489.109] (-484.440) (-480.677) * [-479.449] (-482.609) (-484.771) (-489.071) -- 0:00:00
4000 -- [-477.953] (-481.385) (-482.021) (-490.060) * [-482.915] (-479.469) (-483.207) (-493.580) -- 0:00:00
4500 -- (-483.260) (-481.878) (-479.496) [-486.887] * (-484.194) [-481.723] (-487.044) (-484.210) -- 0:00:00
5000 -- [-480.657] (-482.400) (-485.057) (-481.353) * (-489.916) (-483.698) (-480.124) [-483.110] -- 0:00:00
Average standard deviation of split frequencies: 0.107137
5500 -- [-485.502] (-484.844) (-485.099) (-481.593) * (-490.209) (-483.777) [-477.880] (-485.291) -- 0:00:00
6000 -- [-480.817] (-478.588) (-477.624) (-488.249) * (-487.273) (-482.456) [-484.656] (-485.356) -- 0:00:00
6500 -- (-488.071) (-478.270) [-482.448] (-484.619) * (-482.921) [-480.726] (-489.454) (-481.773) -- 0:00:00
7000 -- (-486.396) (-478.724) (-485.317) [-480.514] * (-479.697) (-486.300) (-484.527) [-483.329] -- 0:00:00
7500 -- (-481.057) (-479.402) [-481.784] (-484.442) * [-478.959] (-482.888) (-481.683) (-479.908) -- 0:00:00
8000 -- (-487.306) (-479.917) (-493.131) [-486.686] * (-481.010) (-487.521) [-484.759] (-486.880) -- 0:00:00
8500 -- (-480.662) [-480.581] (-483.911) (-481.170) * (-480.905) [-485.074] (-487.332) (-487.664) -- 0:00:00
9000 -- [-483.764] (-478.359) (-486.902) (-487.363) * (-481.806) (-481.206) [-479.206] (-484.839) -- 0:00:00
9500 -- [-481.296] (-479.733) (-486.281) (-487.417) * (-481.466) [-480.969] (-481.906) (-479.779) -- 0:00:00
10000 -- (-490.174) (-479.754) [-480.199] (-485.535) * [-487.325] (-485.424) (-490.737) (-487.404) -- 0:01:39
Average standard deviation of split frequencies: 0.062392
10500 -- [-482.885] (-477.617) (-486.115) (-491.298) * [-488.337] (-482.235) (-483.305) (-484.024) -- 0:01:34
11000 -- (-484.687) (-481.679) [-483.455] (-482.368) * (-481.150) (-480.018) [-485.639] (-486.865) -- 0:01:29
11500 -- (-489.690) (-481.029) (-482.813) [-481.945] * [-481.230] (-480.203) (-486.453) (-481.068) -- 0:01:25
12000 -- (-483.698) (-482.174) (-478.252) [-481.732] * [-485.621] (-487.730) (-483.527) (-492.363) -- 0:01:22
12500 -- (-479.504) (-488.769) (-480.643) [-483.798] * [-484.718] (-484.371) (-485.237) (-478.557) -- 0:01:19
13000 -- (-479.579) (-479.767) (-475.694) [-479.377] * (-483.932) [-481.170] (-481.835) (-478.273) -- 0:01:15
13500 -- [-482.365] (-479.592) (-479.260) (-482.146) * (-481.526) (-478.122) (-480.750) [-481.559] -- 0:01:13
14000 -- (-483.972) (-479.082) [-476.801] (-496.475) * [-478.239] (-479.082) (-478.789) (-479.459) -- 0:01:10
14500 -- (-481.825) (-479.167) (-476.699) [-478.957] * (-486.845) (-480.992) [-480.173] (-476.095) -- 0:01:07
15000 -- (-481.901) (-477.609) [-478.882] (-481.248) * (-482.248) (-477.456) [-486.393] (-479.089) -- 0:01:05
Average standard deviation of split frequencies: 0.046299
15500 -- (-488.493) [-476.712] (-478.179) (-480.330) * (-482.822) (-476.582) [-480.253] (-477.926) -- 0:01:03
16000 -- (-491.614) [-478.543] (-475.363) (-478.019) * (-483.245) (-478.087) (-481.687) [-476.040] -- 0:01:01
16500 -- (-481.023) (-481.420) [-478.477] (-480.604) * [-481.711] (-477.361) (-481.763) (-479.249) -- 0:00:59
17000 -- [-486.831] (-479.111) (-478.777) (-479.443) * [-479.723] (-477.295) (-477.705) (-478.097) -- 0:00:57
17500 -- [-479.391] (-476.981) (-481.961) (-484.956) * [-483.528] (-479.373) (-483.886) (-476.552) -- 0:00:56
18000 -- [-482.400] (-476.811) (-483.059) (-477.412) * (-482.615) (-475.333) [-484.246] (-476.761) -- 0:00:54
18500 -- (-484.698) (-477.101) (-483.334) [-480.284] * [-479.268] (-476.788) (-484.747) (-477.668) -- 0:00:53
19000 -- (-488.296) (-479.862) (-479.751) [-478.228] * [-481.063] (-477.910) (-480.877) (-478.783) -- 0:00:51
19500 -- (-481.690) [-476.851] (-480.327) (-481.782) * [-480.233] (-476.281) (-483.543) (-477.388) -- 0:00:50
20000 -- (-483.586) (-479.972) (-480.449) [-478.866] * (-483.836) [-477.035] (-486.380) (-478.102) -- 0:00:49
Average standard deviation of split frequencies: 0.044353
20500 -- [-482.868] (-477.084) (-481.540) (-477.885) * [-483.135] (-476.811) (-480.458) (-480.483) -- 0:00:47
21000 -- [-477.418] (-478.122) (-481.840) (-479.534) * (-482.137) (-479.964) [-477.356] (-480.174) -- 0:00:46
21500 -- [-482.864] (-474.286) (-481.578) (-479.130) * (-477.357) [-476.169] (-481.569) (-481.756) -- 0:00:45
22000 -- (-485.971) [-475.754] (-477.916) (-477.998) * (-484.014) (-478.115) [-485.069] (-477.913) -- 0:00:44
22500 -- (-479.275) [-477.341] (-478.002) (-482.368) * (-477.353) (-475.580) (-487.941) [-479.576] -- 0:00:43
23000 -- (-485.314) [-476.613] (-479.990) (-483.524) * (-481.094) (-477.401) [-488.074] (-479.056) -- 0:00:42
23500 -- (-479.993) [-476.442] (-482.127) (-477.710) * (-490.818) [-480.255] (-484.031) (-476.619) -- 0:00:41
24000 -- (-484.280) (-476.931) [-477.671] (-478.535) * (-486.514) [-481.826] (-482.014) (-479.317) -- 0:00:40
24500 -- (-485.309) (-476.771) (-476.173) [-482.139] * [-484.008] (-477.740) (-481.142) (-482.734) -- 0:00:39
25000 -- [-484.568] (-478.118) (-477.885) (-482.325) * [-482.626] (-476.076) (-480.679) (-479.205) -- 0:00:39
Average standard deviation of split frequencies: 0.028491
25500 -- [-479.730] (-476.897) (-476.680) (-479.981) * (-481.957) (-479.499) [-478.868] (-478.477) -- 0:01:16
26000 -- (-484.337) [-477.565] (-481.028) (-480.653) * (-487.224) [-475.851] (-483.807) (-480.803) -- 0:01:14
26500 -- [-477.131] (-476.062) (-479.584) (-479.695) * (-482.900) (-477.612) (-486.716) [-478.417] -- 0:01:13
27000 -- (-486.836) (-477.087) (-481.013) [-479.533] * [-487.729] (-481.489) (-490.400) (-482.121) -- 0:01:12
27500 -- (-492.007) (-477.586) (-479.219) [-478.114] * [-481.687] (-479.641) (-484.753) (-478.632) -- 0:01:10
28000 -- (-487.567) (-479.713) (-481.106) [-479.807] * [-477.576] (-477.366) (-485.940) (-480.232) -- 0:01:09
28500 -- (-479.303) (-479.081) (-478.814) [-476.343] * (-485.947) (-476.944) [-482.717] (-479.241) -- 0:01:08
29000 -- [-478.561] (-477.831) (-477.029) (-480.272) * [-483.628] (-475.543) (-488.455) (-477.835) -- 0:01:06
29500 -- [-484.966] (-482.181) (-478.125) (-478.038) * [-479.317] (-478.240) (-492.137) (-478.353) -- 0:01:05
30000 -- (-482.216) (-477.630) [-479.220] (-479.274) * (-476.468) (-479.671) (-489.325) [-481.986] -- 0:01:04
Average standard deviation of split frequencies: 0.029207
30500 -- [-483.328] (-476.255) (-479.449) (-480.471) * [-476.975] (-480.385) (-483.922) (-479.744) -- 0:01:03
31000 -- (-487.344) [-479.357] (-478.728) (-478.017) * (-481.255) [-478.502] (-482.837) (-478.817) -- 0:01:02
31500 -- (-483.963) [-476.819] (-478.815) (-479.492) * (-478.121) (-475.449) (-477.787) [-479.465] -- 0:01:01
32000 -- (-495.371) (-478.976) [-478.134] (-479.306) * [-482.621] (-476.104) (-478.821) (-476.777) -- 0:01:00
32500 -- (-480.998) [-476.831] (-478.598) (-479.113) * (-480.267) (-477.834) [-476.553] (-479.094) -- 0:00:59
33000 -- (-476.464) (-482.856) [-477.682] (-480.376) * [-480.578] (-482.510) (-479.861) (-477.301) -- 0:00:58
33500 -- [-486.095] (-479.506) (-477.766) (-480.814) * [-480.967] (-483.314) (-478.345) (-478.390) -- 0:00:57
34000 -- (-479.769) (-482.121) [-477.843] (-477.190) * [-483.225] (-484.587) (-478.089) (-477.719) -- 0:00:56
34500 -- (-479.002) (-478.559) [-476.722] (-477.045) * (-479.483) [-480.193] (-477.613) (-476.693) -- 0:00:55
35000 -- [-482.022] (-479.210) (-477.648) (-475.805) * (-492.615) [-476.106] (-479.930) (-483.742) -- 0:00:55
Average standard deviation of split frequencies: 0.033391
35500 -- [-484.166] (-484.569) (-478.586) (-477.700) * (-476.199) [-478.410] (-483.957) (-477.933) -- 0:00:54
36000 -- [-483.075] (-479.295) (-480.599) (-478.695) * [-479.652] (-476.548) (-478.763) (-475.778) -- 0:00:53
36500 -- (-478.420) (-478.872) (-480.353) [-480.670] * [-483.354] (-477.608) (-479.759) (-476.310) -- 0:00:52
37000 -- (-477.945) [-479.113] (-477.058) (-480.184) * [-481.207] (-478.605) (-478.011) (-479.442) -- 0:00:52
37500 -- (-478.070) [-480.084] (-477.276) (-480.195) * (-484.177) (-476.756) (-479.180) [-479.009] -- 0:00:51
38000 -- (-479.992) (-477.273) [-477.543] (-479.587) * [-483.884] (-482.330) (-478.394) (-479.261) -- 0:00:50
38500 -- (-479.572) (-480.754) (-479.247) [-478.806] * [-480.625] (-478.394) (-479.984) (-480.741) -- 0:00:49
39000 -- (-477.129) (-477.571) (-481.727) [-477.645] * (-487.401) (-483.526) [-478.787] (-478.470) -- 0:00:49
39500 -- (-480.584) (-479.598) [-482.298] (-486.877) * (-480.189) (-476.347) [-482.923] (-479.082) -- 0:00:48
40000 -- [-477.205] (-478.176) (-477.818) (-478.245) * [-476.384] (-477.836) (-485.339) (-479.983) -- 0:00:48
Average standard deviation of split frequencies: 0.032200
40500 -- [-477.874] (-476.643) (-481.803) (-478.482) * (-495.830) [-477.120] (-477.961) (-481.117) -- 0:01:11
41000 -- (-476.330) [-477.396] (-479.692) (-480.306) * [-480.554] (-479.582) (-480.720) (-480.602) -- 0:01:10
41500 -- [-477.353] (-480.867) (-476.705) (-477.111) * (-496.033) (-478.258) [-480.128] (-478.321) -- 0:01:09
42000 -- (-476.322) (-478.178) [-480.097] (-478.740) * (-480.524) (-479.130) (-478.800) [-477.769] -- 0:01:08
42500 -- (-478.220) [-478.983] (-476.021) (-481.714) * (-481.746) [-476.669] (-477.232) (-477.703) -- 0:01:07
43000 -- (-475.750) [-478.002] (-478.624) (-480.215) * (-476.221) (-477.050) (-477.140) [-477.802] -- 0:01:06
43500 -- (-474.920) (-480.879) [-478.337] (-480.223) * (-477.238) (-485.299) (-475.861) [-477.765] -- 0:01:05
44000 -- (-476.796) (-479.283) (-482.220) [-478.824] * (-476.110) [-476.309] (-476.594) (-482.992) -- 0:01:05
44500 -- (-477.259) (-478.105) [-477.660] (-482.827) * (-478.178) (-477.381) [-474.985] (-481.255) -- 0:01:04
45000 -- (-477.091) (-478.212) (-476.195) [-478.249] * [-478.380] (-479.311) (-478.318) (-480.231) -- 0:01:03
Average standard deviation of split frequencies: 0.030744
45500 -- (-480.067) (-478.637) (-483.987) [-476.895] * (-478.907) [-477.103] (-478.111) (-480.616) -- 0:01:02
46000 -- (-476.584) (-478.160) [-477.209] (-479.544) * (-478.090) [-474.327] (-478.757) (-478.210) -- 0:01:02
46500 -- [-476.876] (-480.197) (-478.678) (-481.532) * (-476.186) [-480.509] (-476.220) (-481.368) -- 0:01:01
47000 -- (-476.293) (-478.408) [-476.132] (-479.512) * (-480.261) [-480.076] (-478.360) (-478.982) -- 0:01:00
47500 -- [-476.463] (-476.794) (-476.600) (-479.474) * (-477.546) [-479.836] (-480.403) (-477.954) -- 0:01:00
48000 -- (-475.110) (-476.756) [-477.776] (-479.391) * (-477.965) (-478.350) (-475.812) [-478.338] -- 0:00:59
48500 -- (-475.582) (-477.265) [-476.598] (-480.218) * (-478.035) (-480.081) [-477.955] (-479.060) -- 0:00:58
49000 -- [-478.427] (-476.378) (-477.187) (-477.507) * (-478.197) (-476.622) (-476.777) [-478.811] -- 0:00:58
49500 -- (-475.410) (-476.849) [-477.653] (-478.139) * (-478.593) (-475.561) [-475.591] (-479.947) -- 0:00:57
50000 -- [-476.490] (-476.830) (-477.991) (-477.835) * (-476.979) (-477.479) (-477.236) [-482.342] -- 0:00:57
Average standard deviation of split frequencies: 0.033081
50500 -- (-476.781) [-475.990] (-476.834) (-477.559) * (-477.294) [-479.010] (-479.652) (-478.079) -- 0:00:56
51000 -- (-478.761) [-479.522] (-487.642) (-478.779) * [-476.505] (-477.410) (-477.441) (-480.393) -- 0:00:55
51500 -- [-474.860] (-480.025) (-478.242) (-483.267) * (-477.729) [-477.479] (-479.823) (-478.092) -- 0:00:55
52000 -- (-477.101) (-478.124) [-475.999] (-478.464) * (-481.887) (-478.772) [-479.584] (-478.145) -- 0:00:54
52500 -- (-479.401) (-476.125) (-477.969) [-480.598] * (-476.527) [-478.531] (-478.508) (-477.438) -- 0:00:54
53000 -- (-479.269) [-479.528] (-479.477) (-481.135) * (-478.164) [-476.423] (-480.617) (-477.701) -- 0:00:53
53500 -- (-476.460) (-477.400) (-477.902) [-479.046] * (-478.885) (-478.350) (-480.087) [-477.765] -- 0:00:53
54000 -- [-477.572] (-481.135) (-478.793) (-478.863) * (-478.567) (-479.514) [-477.790] (-475.840) -- 0:00:52
54500 -- [-476.913] (-478.167) (-479.884) (-478.873) * (-476.305) [-479.579] (-477.034) (-481.075) -- 0:00:52
55000 -- [-481.198] (-478.938) (-477.766) (-480.195) * [-477.487] (-475.696) (-479.047) (-476.789) -- 0:01:08
Average standard deviation of split frequencies: 0.034607
55500 -- (-477.981) [-476.503] (-478.634) (-478.804) * (-476.056) [-476.421] (-478.902) (-479.163) -- 0:01:08
56000 -- (-477.058) (-480.998) [-478.557] (-479.019) * (-476.373) (-480.898) (-479.612) [-475.976] -- 0:01:07
56500 -- [-476.410] (-476.632) (-477.117) (-478.430) * [-477.964] (-478.265) (-480.041) (-477.966) -- 0:01:06
57000 -- (-479.533) [-476.566] (-480.659) (-480.786) * [-478.600] (-475.605) (-483.338) (-478.707) -- 0:01:06
57500 -- (-476.793) [-478.374] (-478.478) (-480.393) * (-485.179) (-477.266) [-482.193] (-480.645) -- 0:01:05
58000 -- (-479.127) (-475.757) (-479.538) [-479.246] * (-479.023) [-479.171] (-482.403) (-479.749) -- 0:01:04
58500 -- (-474.840) (-476.826) (-479.966) [-477.132] * [-479.828] (-478.382) (-480.459) (-477.100) -- 0:01:04
59000 -- (-476.932) [-477.751] (-481.827) (-481.121) * (-483.760) (-479.435) [-479.213] (-480.068) -- 0:01:03
59500 -- [-476.046] (-482.286) (-487.251) (-479.755) * (-484.073) (-477.575) (-477.903) [-476.739] -- 0:01:03
60000 -- (-476.154) (-477.428) (-480.198) [-478.946] * (-481.260) (-476.660) [-476.016] (-478.816) -- 0:01:02
Average standard deviation of split frequencies: 0.028923
60500 -- (-477.093) [-478.515] (-478.898) (-485.589) * (-483.609) [-476.909] (-476.338) (-476.073) -- 0:01:02
61000 -- (-475.786) (-479.541) [-479.381] (-482.522) * (-478.005) (-477.720) [-477.463] (-479.915) -- 0:01:01
61500 -- (-477.882) (-478.615) [-478.322] (-480.447) * (-478.133) (-477.281) (-477.656) [-476.796] -- 0:01:01
62000 -- [-480.368] (-476.672) (-478.765) (-481.055) * [-478.241] (-476.649) (-482.592) (-477.406) -- 0:01:00
62500 -- [-475.807] (-476.310) (-479.431) (-481.133) * (-478.490) [-479.423] (-482.993) (-477.424) -- 0:01:00
63000 -- (-479.587) (-476.561) (-478.437) [-480.327] * (-478.714) (-478.688) (-485.269) [-478.243] -- 0:00:59
63500 -- (-477.313) (-479.970) (-478.589) [-481.631] * [-476.166] (-476.450) (-477.269) (-481.093) -- 0:00:58
64000 -- (-476.723) [-478.163] (-479.623) (-479.357) * [-480.401] (-479.469) (-477.600) (-478.185) -- 0:00:58
64500 -- (-477.998) (-477.588) [-479.089] (-480.015) * [-478.665] (-480.536) (-479.011) (-481.540) -- 0:00:58
65000 -- (-478.996) [-477.561] (-479.597) (-478.728) * (-482.205) [-477.817] (-478.238) (-474.893) -- 0:00:57
Average standard deviation of split frequencies: 0.030450
65500 -- [-477.800] (-476.386) (-477.739) (-478.645) * [-478.775] (-477.655) (-482.554) (-475.470) -- 0:00:57
66000 -- (-480.600) [-481.368] (-479.344) (-480.228) * (-478.799) (-478.348) (-481.014) [-476.404] -- 0:00:56
66500 -- (-480.158) (-482.164) (-480.775) [-476.929] * (-480.838) [-478.626] (-480.517) (-478.325) -- 0:00:56
67000 -- (-478.491) (-479.277) [-476.702] (-478.786) * [-476.944] (-480.339) (-485.925) (-478.762) -- 0:00:55
67500 -- [-476.088] (-476.532) (-478.745) (-478.910) * (-480.364) (-481.547) (-477.323) [-476.735] -- 0:00:55
68000 -- [-481.389] (-479.702) (-480.011) (-478.130) * [-478.018] (-480.678) (-476.899) (-478.880) -- 0:00:54
68500 -- (-483.639) [-477.712] (-475.841) (-478.477) * [-479.304] (-478.877) (-478.594) (-480.376) -- 0:00:54
69000 -- (-477.743) [-476.326] (-476.653) (-478.499) * (-477.244) (-478.034) [-476.742] (-480.880) -- 0:00:53
69500 -- (-477.926) (-476.747) (-476.190) [-478.072] * (-478.919) (-481.234) [-477.598] (-477.341) -- 0:00:53
70000 -- (-477.150) (-477.963) (-477.868) [-476.409] * [-478.582] (-479.740) (-477.228) (-479.993) -- 0:00:53
Average standard deviation of split frequencies: 0.032301
70500 -- [-477.367] (-476.762) (-481.902) (-477.283) * [-479.369] (-482.222) (-477.916) (-479.531) -- 0:01:05
71000 -- [-478.712] (-478.051) (-478.010) (-476.905) * [-480.493] (-480.820) (-476.684) (-479.213) -- 0:01:05
71500 -- (-478.456) (-478.484) [-479.196] (-478.464) * [-476.543] (-481.004) (-479.333) (-476.569) -- 0:01:04
72000 -- (-476.159) (-477.777) (-478.574) [-478.759] * (-483.193) (-477.176) [-478.165] (-479.602) -- 0:01:04
72500 -- (-476.198) (-479.445) [-479.420] (-477.613) * (-477.953) (-477.584) (-479.572) [-478.395] -- 0:01:03
73000 -- [-479.722] (-477.139) (-479.487) (-479.644) * (-477.601) [-477.777] (-481.891) (-478.503) -- 0:01:03
73500 -- (-477.766) (-478.240) (-479.409) [-475.464] * [-476.946] (-479.794) (-477.911) (-477.008) -- 0:01:03
74000 -- (-478.434) (-483.769) (-481.369) [-475.818] * (-477.478) (-479.784) (-478.951) [-475.879] -- 0:01:02
74500 -- [-477.507] (-476.956) (-476.676) (-476.647) * (-478.570) (-480.600) (-477.047) [-476.951] -- 0:01:02
75000 -- (-475.427) (-476.080) (-480.453) [-480.237] * (-478.654) (-479.791) [-478.382] (-479.757) -- 0:01:01
Average standard deviation of split frequencies: 0.035045
75500 -- (-477.962) (-482.816) [-477.958] (-478.682) * (-478.795) (-481.963) (-477.683) [-477.748] -- 0:01:01
76000 -- (-475.883) (-479.773) (-478.686) [-482.159] * (-477.343) (-479.844) (-479.600) [-476.851] -- 0:01:00
76500 -- [-476.946] (-475.764) (-477.939) (-484.009) * (-475.827) (-480.122) [-480.724] (-476.414) -- 0:01:00
77000 -- (-478.157) (-476.876) [-476.459] (-480.587) * (-478.578) (-480.510) [-478.550] (-476.470) -- 0:00:59
77500 -- (-478.996) (-478.466) [-476.259] (-481.064) * (-478.191) (-479.104) (-479.318) [-477.344] -- 0:00:59
78000 -- (-477.065) (-481.780) (-479.393) [-478.765] * (-476.968) (-480.796) [-479.566] (-484.155) -- 0:00:59
78500 -- (-480.328) (-481.951) (-479.805) [-476.952] * (-478.156) [-476.461] (-478.971) (-482.081) -- 0:00:58
79000 -- [-478.670] (-477.885) (-479.713) (-477.217) * (-480.865) (-482.628) (-478.654) [-481.576] -- 0:00:58
79500 -- [-478.024] (-478.033) (-476.361) (-476.433) * (-478.148) (-477.040) [-479.082] (-477.820) -- 0:00:57
80000 -- (-477.654) (-476.099) (-477.029) [-478.734] * (-477.064) [-478.497] (-477.112) (-479.187) -- 0:00:57
Average standard deviation of split frequencies: 0.037831
80500 -- (-479.323) [-481.162] (-480.315) (-478.442) * (-478.828) [-476.926] (-476.952) (-475.753) -- 0:00:57
81000 -- (-477.257) (-480.932) [-478.762] (-481.024) * (-480.105) (-478.391) (-478.767) [-477.063] -- 0:00:56
81500 -- [-478.246] (-480.683) (-477.868) (-481.771) * (-485.590) [-476.069] (-480.879) (-483.872) -- 0:00:56
82000 -- [-477.175] (-481.902) (-483.518) (-480.350) * (-481.463) [-477.872] (-477.512) (-483.586) -- 0:00:55
82500 -- (-475.534) (-479.985) (-476.441) [-478.285] * (-483.605) (-476.494) (-481.886) [-478.300] -- 0:00:55
83000 -- (-477.749) [-477.591] (-481.235) (-479.897) * (-478.732) [-477.657] (-479.568) (-478.266) -- 0:00:55
83500 -- (-476.927) (-477.712) [-477.939] (-478.806) * (-479.521) (-477.776) (-479.859) [-478.181] -- 0:00:54
84000 -- [-477.413] (-476.423) (-479.418) (-481.925) * (-481.160) [-477.432] (-482.701) (-476.149) -- 0:00:54
84500 -- [-476.968] (-477.924) (-485.343) (-480.517) * (-480.180) (-479.615) [-479.605] (-476.997) -- 0:00:54
85000 -- (-476.151) [-477.299] (-484.397) (-478.513) * (-483.539) (-479.659) [-485.254] (-477.640) -- 0:00:53
Average standard deviation of split frequencies: 0.033437
85500 -- [-475.050] (-477.154) (-476.985) (-479.653) * (-479.740) (-479.216) [-478.650] (-476.067) -- 0:00:53
86000 -- (-476.136) (-478.207) [-476.801] (-478.417) * [-481.148] (-477.067) (-480.149) (-480.623) -- 0:00:53
86500 -- (-475.944) [-478.221] (-481.961) (-480.591) * (-477.212) [-478.552] (-482.293) (-478.410) -- 0:01:03
87000 -- [-473.670] (-478.183) (-480.966) (-488.005) * (-477.305) (-479.140) (-479.639) [-479.186] -- 0:01:02
87500 -- [-476.985] (-475.934) (-476.303) (-478.852) * (-476.123) (-480.394) (-477.306) [-478.316] -- 0:01:02
88000 -- (-477.227) [-477.609] (-479.519) (-480.781) * [-478.687] (-479.220) (-477.501) (-479.117) -- 0:01:02
88500 -- [-476.762] (-479.635) (-480.627) (-481.581) * (-478.876) (-479.151) [-479.362] (-478.919) -- 0:01:01
89000 -- [-476.461] (-479.948) (-478.101) (-479.158) * (-476.445) [-477.628] (-477.501) (-482.063) -- 0:01:01
89500 -- [-477.235] (-479.117) (-478.090) (-479.348) * (-477.526) (-477.853) [-478.492] (-480.576) -- 0:01:01
90000 -- (-478.022) [-479.416] (-477.759) (-482.367) * (-478.159) [-476.615] (-477.749) (-480.289) -- 0:01:00
Average standard deviation of split frequencies: 0.031196
90500 -- (-480.046) (-477.234) (-476.923) [-484.092] * (-477.154) [-477.297] (-476.830) (-481.674) -- 0:01:00
91000 -- [-478.062] (-478.442) (-479.164) (-483.392) * (-479.837) [-477.988] (-477.795) (-481.775) -- 0:00:59
91500 -- [-478.722] (-476.691) (-481.784) (-478.561) * (-478.982) (-481.065) [-482.088] (-481.180) -- 0:00:59
92000 -- (-476.754) (-480.020) (-479.878) [-478.272] * [-476.335] (-478.388) (-478.321) (-477.552) -- 0:00:59
92500 -- (-477.211) (-486.912) (-477.603) [-479.962] * (-480.712) (-479.445) [-478.731] (-479.622) -- 0:00:58
93000 -- [-476.521] (-488.558) (-480.028) (-479.572) * (-475.388) (-477.920) (-479.008) [-480.894] -- 0:00:58
93500 -- (-476.559) (-480.604) (-478.384) [-478.515] * (-479.112) [-477.001] (-479.298) (-478.394) -- 0:00:58
94000 -- (-475.986) (-479.024) (-479.137) [-478.092] * [-477.035] (-481.989) (-483.679) (-477.863) -- 0:00:57
94500 -- (-475.937) [-476.880] (-479.844) (-478.494) * (-476.146) (-477.976) [-476.150] (-480.012) -- 0:00:57
95000 -- (-476.190) (-478.028) (-480.418) [-477.940] * (-479.544) (-478.128) (-479.201) [-476.683] -- 0:00:57
Average standard deviation of split frequencies: 0.031567
95500 -- [-475.801] (-477.598) (-478.407) (-479.318) * [-476.279] (-478.863) (-478.909) (-477.690) -- 0:00:56
96000 -- (-478.700) (-478.012) [-481.861] (-480.371) * (-478.980) (-479.093) [-476.192] (-478.914) -- 0:00:56
96500 -- (-480.038) (-476.281) [-481.874] (-479.842) * (-477.478) (-478.657) (-478.473) [-478.331] -- 0:00:56
97000 -- (-477.553) [-479.399] (-481.723) (-479.118) * (-477.093) (-478.057) [-478.201] (-476.148) -- 0:00:55
97500 -- (-483.666) (-476.319) (-479.560) [-478.770] * (-476.262) [-479.257] (-488.870) (-477.266) -- 0:00:55
98000 -- (-476.770) [-477.684] (-480.322) (-478.832) * (-480.686) [-475.614] (-484.424) (-480.879) -- 0:00:55
98500 -- (-479.173) [-478.508] (-479.847) (-480.436) * (-480.712) (-477.604) (-481.107) [-481.847] -- 0:00:54
99000 -- [-478.558] (-476.757) (-478.899) (-480.070) * (-478.881) (-475.739) [-479.289] (-476.165) -- 0:00:54
99500 -- (-479.312) (-478.844) [-478.197] (-477.131) * (-478.706) (-485.858) [-477.084] (-480.711) -- 0:00:54
100000 -- (-477.636) (-477.238) (-478.388) [-476.868] * (-478.438) [-482.747] (-477.586) (-479.671) -- 0:00:54
Average standard deviation of split frequencies: 0.028836
100500 -- [-478.183] (-476.135) (-477.721) (-478.463) * (-481.068) [-478.814] (-478.168) (-478.615) -- 0:00:53
101000 -- (-477.689) (-477.597) (-479.817) [-476.953] * [-479.674] (-484.222) (-479.115) (-479.909) -- 0:00:53
101500 -- [-478.146] (-480.706) (-479.773) (-477.976) * (-475.931) (-481.588) (-479.719) [-478.106] -- 0:00:53
102000 -- (-480.989) (-478.005) (-478.390) [-477.427] * (-475.928) (-482.333) [-479.090] (-478.390) -- 0:00:52
102500 -- [-476.552] (-475.478) (-479.040) (-479.161) * (-476.110) (-478.583) (-476.406) [-479.027] -- 0:01:01
103000 -- (-477.003) [-475.544] (-480.710) (-480.611) * (-478.061) (-478.687) [-476.418] (-476.973) -- 0:01:00
103500 -- [-478.216] (-477.020) (-476.755) (-477.294) * (-475.814) (-478.003) (-478.501) [-477.350] -- 0:01:00
104000 -- (-477.682) [-478.238] (-478.796) (-478.343) * (-479.555) (-480.455) [-480.734] (-479.386) -- 0:01:00
104500 -- (-477.239) [-477.356] (-478.721) (-477.557) * (-479.887) [-479.843] (-476.149) (-478.763) -- 0:00:59
105000 -- (-476.629) (-476.556) (-478.781) [-478.945] * (-477.587) (-476.255) [-476.350] (-478.863) -- 0:00:59
Average standard deviation of split frequencies: 0.026895
105500 -- (-478.559) [-477.739] (-479.077) (-478.448) * (-479.581) [-476.308] (-475.746) (-479.799) -- 0:00:59
106000 -- (-479.472) [-477.744] (-477.852) (-478.620) * (-477.305) [-476.003] (-477.464) (-476.805) -- 0:00:59
106500 -- (-476.222) [-475.512] (-479.831) (-476.884) * (-480.047) (-478.994) (-478.180) [-479.261] -- 0:00:58
107000 -- [-476.074] (-478.577) (-477.517) (-477.306) * (-477.026) (-482.044) [-478.510] (-479.711) -- 0:00:58
107500 -- (-484.031) (-477.741) [-479.018] (-476.089) * (-478.033) (-477.275) (-476.717) [-477.946] -- 0:00:58
108000 -- [-479.552] (-476.379) (-477.413) (-479.996) * (-476.802) [-478.984] (-478.482) (-478.510) -- 0:00:57
108500 -- (-481.119) (-476.686) (-483.743) [-477.247] * (-478.501) (-481.501) [-475.095] (-475.762) -- 0:00:57
109000 -- (-478.361) (-475.201) (-477.407) [-476.965] * (-479.596) (-479.167) [-477.034] (-477.215) -- 0:00:57
109500 -- (-481.062) [-478.651] (-481.253) (-476.662) * [-478.795] (-476.540) (-479.453) (-478.017) -- 0:00:56
110000 -- (-483.696) [-476.351] (-482.059) (-479.451) * (-480.137) (-477.918) (-478.192) [-477.754] -- 0:00:56
Average standard deviation of split frequencies: 0.027301
110500 -- [-479.120] (-476.207) (-480.602) (-476.326) * (-479.057) [-478.317] (-475.541) (-478.331) -- 0:00:56
111000 -- (-477.877) [-476.544] (-479.917) (-484.344) * [-477.790] (-479.036) (-483.133) (-477.681) -- 0:00:56
111500 -- [-478.422] (-479.434) (-479.303) (-481.088) * [-480.127] (-477.737) (-481.012) (-478.862) -- 0:00:55
112000 -- (-478.355) (-478.130) [-478.819] (-481.938) * (-477.955) (-478.921) (-481.694) [-476.991] -- 0:00:55
112500 -- (-478.376) (-480.213) [-478.397] (-476.163) * (-478.230) (-480.953) [-479.674] (-480.534) -- 0:00:55
113000 -- (-479.010) [-478.189] (-482.084) (-477.322) * (-479.780) (-479.018) (-476.159) [-476.227] -- 0:00:54
113500 -- (-477.170) (-481.474) [-477.344] (-480.060) * [-477.851] (-480.976) (-475.606) (-477.461) -- 0:00:54
114000 -- (-475.968) [-476.821] (-479.806) (-482.969) * (-479.101) (-480.044) [-475.699] (-480.031) -- 0:00:54
114500 -- (-479.188) [-478.231] (-478.016) (-481.316) * (-481.806) (-478.437) (-478.611) [-479.119] -- 0:00:54
115000 -- [-479.265] (-478.600) (-481.321) (-475.856) * [-478.785] (-478.041) (-479.620) (-477.271) -- 0:00:53
Average standard deviation of split frequencies: 0.026125
115500 -- (-478.980) [-478.817] (-478.976) (-478.538) * (-480.978) [-478.230] (-478.792) (-477.901) -- 0:00:53
116000 -- (-478.535) [-479.771] (-479.346) (-478.743) * (-477.275) (-476.657) [-477.751] (-477.538) -- 0:00:53
116500 -- (-479.290) (-477.780) (-476.342) [-478.662] * [-480.980] (-478.227) (-477.773) (-477.991) -- 0:00:53
117000 -- (-477.973) (-477.957) [-476.086] (-482.382) * [-477.357] (-479.053) (-474.921) (-478.024) -- 0:00:52
117500 -- [-478.639] (-478.860) (-477.231) (-479.893) * (-479.855) (-483.653) [-477.886] (-479.150) -- 0:00:52
118000 -- [-480.571] (-481.333) (-477.932) (-484.108) * (-476.523) [-478.649] (-479.328) (-478.874) -- 0:00:59
118500 -- [-477.330] (-476.741) (-481.131) (-478.079) * (-481.000) [-477.733] (-476.060) (-478.991) -- 0:00:59
119000 -- (-476.933) (-477.787) (-481.129) [-477.995] * (-481.511) (-479.968) [-478.066] (-478.675) -- 0:00:59
119500 -- [-482.040] (-477.334) (-479.966) (-476.424) * [-476.815] (-476.749) (-484.122) (-478.670) -- 0:00:58
120000 -- (-479.623) [-477.781] (-480.931) (-479.689) * [-478.370] (-477.800) (-485.382) (-479.092) -- 0:00:58
Average standard deviation of split frequencies: 0.026761
120500 -- (-477.591) (-477.731) (-482.553) [-477.247] * [-477.133] (-476.446) (-481.996) (-480.438) -- 0:00:58
121000 -- (-482.350) (-478.482) (-477.834) [-479.176] * (-478.374) [-478.091] (-482.374) (-481.378) -- 0:00:58
121500 -- (-479.251) [-476.709] (-479.495) (-477.421) * (-477.422) (-476.732) [-481.969] (-479.297) -- 0:00:57
122000 -- (-481.142) [-481.200] (-479.426) (-478.059) * (-482.833) (-480.119) [-480.325] (-477.325) -- 0:00:57
122500 -- (-478.152) (-478.841) [-477.130] (-484.285) * (-479.856) [-480.431] (-478.681) (-479.009) -- 0:00:57
123000 -- [-475.644] (-479.701) (-476.355) (-482.138) * [-475.656] (-480.024) (-477.411) (-478.338) -- 0:00:57
123500 -- (-478.082) (-479.382) [-476.121] (-483.635) * (-477.628) (-481.126) [-477.699] (-481.860) -- 0:00:56
124000 -- (-477.080) [-481.359] (-475.555) (-482.477) * (-482.467) (-479.287) (-476.289) [-479.717] -- 0:00:56
124500 -- (-479.451) (-481.890) (-479.460) [-477.976] * (-476.793) (-480.849) [-478.458] (-479.247) -- 0:00:56
125000 -- (-481.410) (-480.417) (-478.350) [-478.348] * (-478.928) (-479.160) (-478.206) [-479.067] -- 0:00:56
Average standard deviation of split frequencies: 0.026002
125500 -- (-480.629) [-481.587] (-477.337) (-478.246) * (-478.652) (-482.604) [-479.042] (-477.823) -- 0:00:55
126000 -- (-480.406) (-477.803) [-479.425] (-483.890) * (-479.677) (-483.674) [-478.571] (-477.686) -- 0:00:55
126500 -- [-476.783] (-480.203) (-480.271) (-480.957) * [-480.142] (-478.992) (-476.939) (-483.078) -- 0:00:55
127000 -- [-477.128] (-481.150) (-477.549) (-479.702) * (-480.666) (-478.391) [-477.287] (-479.813) -- 0:00:54
127500 -- (-483.263) (-476.957) (-478.378) [-477.925] * (-479.336) (-482.944) (-476.517) [-480.240] -- 0:00:54
128000 -- (-480.036) [-475.752] (-480.491) (-476.781) * [-477.451] (-478.031) (-481.947) (-478.874) -- 0:00:54
128500 -- (-479.527) (-478.656) [-478.165] (-478.062) * [-476.356] (-478.632) (-476.924) (-478.627) -- 0:00:54
129000 -- (-478.402) [-479.168] (-480.363) (-482.162) * (-476.714) (-478.830) (-482.868) [-478.637] -- 0:00:54
129500 -- [-478.085] (-478.057) (-479.137) (-481.621) * (-477.514) (-479.566) [-479.488] (-480.537) -- 0:00:53
130000 -- (-478.619) [-477.528] (-478.411) (-475.655) * (-477.107) [-476.516] (-476.259) (-481.635) -- 0:00:53
Average standard deviation of split frequencies: 0.023991
130500 -- [-478.551] (-477.491) (-482.384) (-477.149) * (-477.328) (-478.849) [-475.587] (-482.132) -- 0:00:53
131000 -- (-477.300) (-477.098) [-477.607] (-476.439) * (-482.453) (-478.541) [-479.572] (-481.447) -- 0:00:53
131500 -- (-481.502) (-478.828) [-478.502] (-478.286) * (-478.329) [-480.031] (-477.708) (-477.338) -- 0:00:52
132000 -- [-478.906] (-475.939) (-478.155) (-479.413) * (-478.228) (-477.788) [-477.828] (-477.830) -- 0:00:52
132500 -- (-479.100) [-478.112] (-479.829) (-478.902) * (-480.754) (-479.505) [-477.485] (-482.144) -- 0:00:52
133000 -- (-478.682) (-483.056) [-477.372] (-480.932) * [-477.087] (-477.379) (-477.044) (-480.705) -- 0:00:52
133500 -- [-478.474] (-480.334) (-477.337) (-478.270) * (-479.800) (-478.765) (-477.189) [-477.496] -- 0:00:51
134000 -- (-479.363) (-479.289) (-481.005) [-474.905] * [-476.907] (-482.496) (-478.467) (-478.603) -- 0:00:58
134500 -- (-479.430) [-481.269] (-475.896) (-476.991) * [-478.813] (-476.482) (-477.831) (-484.130) -- 0:00:57
135000 -- (-479.982) [-480.553] (-477.987) (-479.297) * (-479.162) [-478.906] (-477.114) (-481.589) -- 0:00:57
Average standard deviation of split frequencies: 0.022530
135500 -- (-477.717) (-477.220) (-476.494) [-479.540] * (-477.616) (-480.280) [-476.242] (-478.163) -- 0:00:57
136000 -- (-477.579) (-477.243) [-479.598] (-478.153) * (-476.611) (-479.307) [-479.020] (-480.548) -- 0:00:57
136500 -- (-482.008) (-479.028) (-477.459) [-477.153] * [-479.447] (-476.649) (-480.338) (-479.864) -- 0:00:56
137000 -- (-479.782) (-478.663) [-476.457] (-479.023) * (-477.034) (-479.930) [-478.376] (-480.423) -- 0:00:56
137500 -- (-477.243) [-481.235] (-479.450) (-479.223) * (-477.453) [-478.678] (-480.236) (-480.714) -- 0:00:56
138000 -- (-481.625) (-477.914) (-478.193) [-479.510] * (-479.358) [-479.765] (-478.616) (-482.880) -- 0:00:56
138500 -- (-477.696) [-478.668] (-479.639) (-478.567) * [-475.492] (-478.088) (-476.903) (-487.294) -- 0:00:55
139000 -- (-479.747) [-478.588] (-480.853) (-477.947) * (-475.816) [-476.555] (-481.037) (-482.649) -- 0:00:55
139500 -- [-476.846] (-477.010) (-479.869) (-480.621) * [-478.953] (-476.967) (-481.102) (-481.225) -- 0:00:55
140000 -- (-480.025) [-480.570] (-477.649) (-483.478) * [-481.058] (-478.411) (-479.374) (-478.877) -- 0:00:55
Average standard deviation of split frequencies: 0.021597
140500 -- [-481.005] (-480.289) (-476.472) (-482.166) * (-478.090) (-478.235) [-477.787] (-482.848) -- 0:00:55
141000 -- (-477.439) [-476.372] (-478.082) (-483.097) * (-480.039) [-478.126] (-481.486) (-483.817) -- 0:00:54
141500 -- (-477.706) (-478.973) (-477.859) [-477.164] * [-480.797] (-478.329) (-480.173) (-483.080) -- 0:00:54
142000 -- (-479.061) (-478.929) [-475.915] (-478.521) * [-477.373] (-479.358) (-478.779) (-479.272) -- 0:00:54
142500 -- [-482.515] (-476.918) (-479.834) (-476.597) * (-478.070) (-479.842) [-474.716] (-478.952) -- 0:00:54
143000 -- (-477.973) (-479.105) [-477.340] (-475.688) * [-476.115] (-479.335) (-477.718) (-480.667) -- 0:00:53
143500 -- [-477.075] (-478.881) (-476.763) (-477.115) * [-479.105] (-479.890) (-482.049) (-479.853) -- 0:00:53
144000 -- (-478.719) [-479.449] (-477.673) (-477.221) * [-481.073] (-478.472) (-475.752) (-478.929) -- 0:00:53
144500 -- (-481.155) (-480.047) [-481.493] (-479.585) * (-477.640) [-477.960] (-478.216) (-478.825) -- 0:00:53
145000 -- (-480.781) (-481.564) [-476.148] (-476.269) * (-477.910) (-481.608) [-477.185] (-482.532) -- 0:00:53
Average standard deviation of split frequencies: 0.020019
145500 -- (-479.167) (-478.764) [-475.647] (-474.820) * (-477.693) [-480.425] (-474.353) (-479.598) -- 0:00:52
146000 -- [-481.883] (-482.553) (-477.860) (-477.220) * (-476.064) [-479.938] (-480.803) (-481.460) -- 0:00:52
146500 -- (-476.214) (-479.527) [-476.926] (-475.674) * (-477.402) (-478.619) [-478.107] (-481.057) -- 0:00:52
147000 -- (-476.754) [-477.216] (-476.804) (-477.326) * (-478.471) [-479.135] (-478.886) (-484.764) -- 0:00:52
147500 -- (-478.066) [-476.246] (-478.461) (-481.159) * (-477.811) (-479.270) [-476.654] (-478.465) -- 0:00:52
148000 -- (-476.932) (-477.662) (-479.765) [-479.752] * (-479.743) (-476.452) [-480.162] (-483.193) -- 0:00:51
148500 -- (-477.055) (-478.343) [-480.056] (-478.364) * [-480.829] (-479.210) (-481.303) (-479.704) -- 0:00:51
149000 -- (-479.939) [-477.309] (-478.612) (-475.756) * (-480.304) [-477.889] (-479.259) (-477.128) -- 0:00:51
149500 -- [-483.200] (-480.769) (-476.874) (-477.469) * (-476.788) (-477.710) [-477.042] (-478.188) -- 0:00:56
150000 -- (-482.863) (-480.455) [-478.616] (-477.828) * [-479.644] (-477.881) (-477.582) (-479.748) -- 0:00:56
Average standard deviation of split frequencies: 0.021078
150500 -- [-475.647] (-482.406) (-476.961) (-477.999) * (-478.643) (-475.763) [-474.872] (-475.825) -- 0:00:56
151000 -- (-478.310) [-477.908] (-477.148) (-476.396) * (-479.927) (-479.074) [-477.390] (-477.764) -- 0:00:56
151500 -- (-476.569) (-480.013) (-479.443) [-479.413] * [-481.091] (-478.820) (-475.702) (-479.949) -- 0:00:56
152000 -- (-478.589) (-478.287) (-476.164) [-478.044] * (-480.295) [-478.443] (-475.904) (-479.138) -- 0:00:55
152500 -- [-479.109] (-475.971) (-477.051) (-479.020) * (-479.846) [-478.439] (-479.271) (-480.315) -- 0:00:55
153000 -- [-477.682] (-478.612) (-479.005) (-480.529) * [-477.437] (-477.100) (-477.989) (-479.808) -- 0:00:55
153500 -- (-477.022) (-478.803) [-477.643] (-477.335) * (-478.261) [-477.003] (-478.379) (-477.895) -- 0:00:55
154000 -- (-474.690) (-478.509) [-476.311] (-480.520) * [-478.583] (-478.015) (-476.592) (-476.870) -- 0:00:54
154500 -- (-475.822) (-479.649) [-478.420] (-478.733) * (-478.048) (-477.334) [-477.339] (-479.068) -- 0:00:54
155000 -- [-478.767] (-479.349) (-476.269) (-475.734) * (-483.122) (-477.819) (-478.641) [-476.902] -- 0:00:54
Average standard deviation of split frequencies: 0.020994
155500 -- [-476.871] (-479.410) (-477.576) (-476.699) * (-479.912) [-476.421] (-476.738) (-479.895) -- 0:00:54
156000 -- [-477.006] (-479.525) (-478.058) (-478.495) * (-482.087) [-478.651] (-476.362) (-480.299) -- 0:00:54
156500 -- (-477.781) [-476.191] (-478.402) (-480.623) * (-480.180) [-475.860] (-476.851) (-478.276) -- 0:00:53
157000 -- (-476.015) (-477.853) [-477.436] (-480.544) * (-478.489) (-480.465) [-474.850] (-478.461) -- 0:00:53
157500 -- [-476.716] (-478.161) (-480.207) (-480.949) * (-480.234) (-475.792) [-478.634] (-480.026) -- 0:00:53
158000 -- (-478.085) [-479.285] (-478.181) (-478.117) * [-478.853] (-477.445) (-477.198) (-479.098) -- 0:00:53
158500 -- (-479.642) (-479.348) (-479.440) [-478.497] * (-479.003) (-479.746) [-477.179] (-481.813) -- 0:00:53
159000 -- (-478.780) (-478.738) [-477.203] (-478.639) * [-481.156] (-476.726) (-481.058) (-479.518) -- 0:00:52
159500 -- [-478.570] (-484.194) (-478.155) (-478.698) * (-478.320) (-477.969) (-484.550) [-475.510] -- 0:00:52
160000 -- (-478.731) (-484.267) [-479.247] (-483.001) * [-478.267] (-476.184) (-481.182) (-483.689) -- 0:00:52
Average standard deviation of split frequencies: 0.021156
160500 -- [-475.862] (-479.988) (-480.664) (-478.024) * (-480.534) [-478.315] (-479.164) (-477.632) -- 0:00:52
161000 -- [-477.275] (-479.499) (-475.401) (-477.403) * (-478.390) [-479.653] (-480.241) (-478.892) -- 0:00:52
161500 -- [-478.829] (-478.628) (-476.974) (-475.668) * (-478.303) [-478.724] (-481.407) (-478.039) -- 0:00:51
162000 -- (-477.952) (-479.864) [-476.626] (-477.902) * (-477.982) (-477.047) (-477.419) [-475.877] -- 0:00:51
162500 -- (-478.081) (-479.525) [-478.258] (-477.023) * (-479.043) [-476.146] (-477.126) (-477.841) -- 0:00:51
163000 -- (-476.310) (-480.584) [-477.525] (-476.974) * (-479.381) [-477.527] (-479.206) (-477.337) -- 0:00:51
163500 -- [-477.280] (-479.163) (-478.752) (-477.952) * (-480.402) (-476.008) (-484.765) [-476.509] -- 0:00:51
164000 -- (-477.304) (-478.663) (-479.789) [-481.782] * (-480.300) (-477.821) (-479.047) [-475.883] -- 0:00:50
164500 -- (-474.249) (-480.336) (-478.863) [-477.054] * (-479.552) (-478.145) (-479.075) [-476.305] -- 0:00:50
165000 -- (-477.135) [-477.202] (-476.342) (-477.087) * (-480.085) (-478.292) (-478.440) [-476.053] -- 0:00:50
Average standard deviation of split frequencies: 0.019595
165500 -- [-475.570] (-480.178) (-475.727) (-478.884) * (-481.010) (-478.408) [-479.703] (-475.036) -- 0:00:55
166000 -- (-476.515) (-479.532) (-476.802) [-477.086] * [-477.357] (-480.257) (-478.569) (-476.441) -- 0:00:55
166500 -- [-479.540] (-480.445) (-479.816) (-477.469) * (-483.472) (-476.614) [-480.286] (-477.452) -- 0:00:55
167000 -- [-478.962] (-476.252) (-478.125) (-476.270) * [-477.556] (-478.362) (-486.074) (-483.387) -- 0:00:54
167500 -- (-475.809) (-477.678) (-478.393) [-477.619] * [-480.219] (-480.131) (-478.650) (-479.394) -- 0:00:54
168000 -- (-480.946) (-476.657) [-475.246] (-478.280) * (-477.685) (-478.548) (-478.231) [-483.143] -- 0:00:54
168500 -- (-478.437) (-475.873) [-478.848] (-475.861) * [-479.442] (-478.342) (-479.054) (-478.341) -- 0:00:54
169000 -- [-475.997] (-477.457) (-478.003) (-477.831) * [-480.555] (-477.744) (-479.005) (-479.319) -- 0:00:54
169500 -- [-477.685] (-478.471) (-480.237) (-476.130) * [-477.800] (-481.972) (-481.420) (-479.383) -- 0:00:53
170000 -- (-478.135) [-478.147] (-476.828) (-477.306) * (-481.194) (-476.329) [-479.051] (-475.242) -- 0:00:53
Average standard deviation of split frequencies: 0.019335
170500 -- (-477.743) (-476.626) [-477.963] (-477.988) * [-479.757] (-478.493) (-478.686) (-480.269) -- 0:00:53
171000 -- (-480.662) [-476.722] (-476.974) (-476.866) * (-480.011) (-477.033) [-477.227] (-479.247) -- 0:00:53
171500 -- (-478.175) (-478.211) [-477.130] (-477.494) * (-484.403) (-477.800) (-479.238) [-478.223] -- 0:00:53
172000 -- (-479.158) (-478.754) [-476.221] (-479.500) * (-480.653) (-478.325) [-478.243] (-477.189) -- 0:00:52
172500 -- [-476.875] (-478.915) (-477.515) (-478.366) * (-480.223) (-478.193) [-475.559] (-476.792) -- 0:00:52
173000 -- (-477.362) (-477.193) [-475.480] (-478.577) * [-476.734] (-477.795) (-475.956) (-477.019) -- 0:00:52
173500 -- (-480.753) (-478.488) (-476.206) [-480.351] * (-477.764) (-477.430) [-475.136] (-478.887) -- 0:00:52
174000 -- (-483.823) [-478.143] (-475.995) (-479.171) * (-478.567) (-478.874) [-478.469] (-480.927) -- 0:00:52
174500 -- (-484.771) [-479.868] (-477.893) (-476.664) * (-481.406) [-477.575] (-475.866) (-486.655) -- 0:00:52
175000 -- (-479.911) (-479.909) [-478.426] (-476.877) * [-478.570] (-474.612) (-476.768) (-483.182) -- 0:00:51
Average standard deviation of split frequencies: 0.021427
175500 -- [-480.575] (-479.562) (-479.695) (-476.790) * (-478.612) [-477.084] (-479.617) (-479.575) -- 0:00:51
176000 -- (-479.743) (-479.342) (-478.100) [-476.469] * (-482.073) (-477.613) [-478.520] (-478.997) -- 0:00:51
176500 -- (-479.526) (-478.993) (-476.093) [-478.639] * (-480.256) (-480.839) [-480.070] (-476.940) -- 0:00:51
177000 -- (-481.271) [-478.940] (-480.132) (-481.209) * (-481.565) (-478.410) (-479.197) [-478.004] -- 0:00:51
177500 -- (-479.612) [-476.877] (-477.223) (-476.174) * (-486.013) [-482.546] (-477.563) (-475.961) -- 0:00:50
178000 -- (-477.899) (-478.313) [-477.926] (-478.027) * [-478.048] (-478.995) (-477.342) (-480.465) -- 0:00:50
178500 -- [-475.527] (-480.284) (-481.754) (-478.538) * (-479.336) (-484.089) [-477.916] (-476.940) -- 0:00:50
179000 -- (-477.096) (-482.305) [-479.955] (-481.689) * (-477.608) (-480.703) [-478.634] (-479.834) -- 0:00:50
179500 -- [-476.440] (-488.544) (-479.052) (-484.049) * (-475.775) [-477.868] (-477.834) (-481.174) -- 0:00:50
180000 -- (-475.508) (-478.988) [-475.673] (-481.877) * (-477.787) (-477.197) [-476.720] (-484.367) -- 0:00:50
Average standard deviation of split frequencies: 0.019638
180500 -- [-478.144] (-481.061) (-479.656) (-480.351) * (-477.708) (-477.997) (-479.082) [-479.236] -- 0:00:54
181000 -- (-478.692) (-480.981) [-477.805] (-479.931) * [-480.939] (-478.788) (-479.004) (-480.697) -- 0:00:54
181500 -- (-479.896) (-480.977) [-476.750] (-476.593) * (-482.171) (-478.466) [-478.817] (-480.526) -- 0:00:54
182000 -- (-481.891) [-484.595] (-478.392) (-477.499) * [-478.104] (-479.695) (-480.521) (-477.792) -- 0:00:53
182500 -- (-480.568) [-481.619] (-479.975) (-478.728) * (-477.915) [-480.327] (-480.809) (-477.506) -- 0:00:53
183000 -- (-480.786) (-479.618) (-477.353) [-477.503] * [-477.704] (-481.137) (-478.004) (-477.754) -- 0:00:53
183500 -- (-478.604) [-480.630] (-478.737) (-477.421) * (-478.523) [-476.680] (-479.944) (-478.407) -- 0:00:53
184000 -- (-478.811) [-479.188] (-478.432) (-477.138) * (-478.315) [-478.399] (-479.507) (-479.196) -- 0:00:53
184500 -- [-478.434] (-477.425) (-481.277) (-477.259) * [-476.615] (-479.376) (-477.333) (-474.862) -- 0:00:53
185000 -- (-479.415) (-478.233) [-479.537] (-479.768) * (-476.305) (-476.844) [-476.917] (-479.053) -- 0:00:52
Average standard deviation of split frequencies: 0.017500
185500 -- (-477.205) (-478.517) (-479.411) [-476.522] * (-477.801) (-479.494) [-477.778] (-475.789) -- 0:00:52
186000 -- (-476.820) (-479.388) [-477.681] (-481.354) * [-476.769] (-479.368) (-476.283) (-476.362) -- 0:00:52
186500 -- [-477.782] (-481.418) (-485.437) (-480.293) * (-475.476) (-479.375) (-477.455) [-476.946] -- 0:00:52
187000 -- (-479.990) (-480.207) [-476.379] (-481.464) * (-478.879) (-478.267) [-478.580] (-476.520) -- 0:00:52
187500 -- (-476.620) (-478.396) (-477.320) [-480.026] * [-477.330] (-478.651) (-478.533) (-477.201) -- 0:00:52
188000 -- (-477.876) (-479.088) [-477.808] (-482.562) * (-475.878) (-480.874) [-477.200] (-477.394) -- 0:00:51
188500 -- (-476.675) (-480.624) (-477.161) [-482.024] * [-474.598] (-483.596) (-476.641) (-476.934) -- 0:00:51
189000 -- (-477.551) [-479.203] (-484.362) (-478.917) * [-474.740] (-478.273) (-480.559) (-477.222) -- 0:00:51
189500 -- (-478.470) (-479.767) [-477.550] (-478.393) * (-476.409) (-485.264) (-475.340) [-479.227] -- 0:00:51
190000 -- (-476.582) [-479.555] (-477.433) (-480.560) * (-477.067) (-480.747) [-478.839] (-478.608) -- 0:00:51
Average standard deviation of split frequencies: 0.017801
190500 -- (-479.225) (-479.546) [-479.958] (-479.443) * (-479.266) (-478.334) (-479.115) [-479.499] -- 0:00:50
191000 -- [-476.136] (-483.246) (-479.800) (-477.514) * (-478.642) [-479.131] (-478.112) (-478.290) -- 0:00:50
191500 -- (-480.072) (-483.724) [-481.268] (-475.228) * (-477.849) (-478.251) (-475.333) [-477.789] -- 0:00:50
192000 -- (-476.200) [-480.534] (-478.005) (-476.562) * (-480.657) [-476.240] (-477.986) (-478.361) -- 0:00:50
192500 -- [-478.186] (-480.494) (-480.269) (-476.154) * (-483.625) (-479.457) (-476.534) [-477.973] -- 0:00:50
193000 -- (-476.227) (-477.620) (-480.607) [-476.726] * (-477.420) (-479.807) [-476.317] (-478.436) -- 0:00:50
193500 -- (-477.794) (-475.772) (-478.481) [-477.546] * [-476.752] (-481.965) (-480.741) (-477.056) -- 0:00:50
194000 -- [-475.873] (-477.314) (-477.372) (-477.424) * (-475.532) [-477.984] (-479.524) (-477.218) -- 0:00:49
194500 -- (-476.474) (-479.054) (-476.750) [-477.228] * (-475.757) (-477.597) (-480.033) [-482.865] -- 0:00:49
195000 -- (-482.311) (-479.850) (-478.826) [-477.987] * (-477.241) (-476.478) (-480.343) [-478.514] -- 0:00:53
Average standard deviation of split frequencies: 0.019494
195500 -- (-478.440) (-476.980) (-477.238) [-479.491] * (-480.238) (-477.665) [-476.030] (-478.015) -- 0:00:53
196000 -- (-478.450) (-478.239) [-476.857] (-473.910) * (-483.810) [-477.423] (-476.360) (-478.194) -- 0:00:53
196500 -- (-478.790) (-477.806) (-479.361) [-478.692] * [-480.294] (-477.856) (-476.317) (-480.623) -- 0:00:53
197000 -- [-476.660] (-476.674) (-480.745) (-478.108) * (-476.363) (-479.066) [-475.986] (-476.417) -- 0:00:52
197500 -- (-478.208) [-477.782] (-478.947) (-480.646) * (-480.429) (-477.808) (-477.394) [-478.620] -- 0:00:52
198000 -- (-481.320) [-476.974] (-479.365) (-482.252) * (-477.465) (-478.967) [-475.118] (-476.931) -- 0:00:52
198500 -- (-482.584) (-480.970) (-479.257) [-479.749] * [-478.559] (-476.401) (-480.299) (-481.633) -- 0:00:52
199000 -- [-479.503] (-477.464) (-479.665) (-476.506) * (-476.308) (-477.470) (-480.538) [-478.440] -- 0:00:52
199500 -- [-476.688] (-479.911) (-480.280) (-479.386) * [-477.874] (-477.978) (-477.287) (-478.542) -- 0:00:52
200000 -- (-479.310) (-476.892) [-478.431] (-483.686) * (-478.355) [-482.748] (-476.725) (-476.426) -- 0:00:51
Average standard deviation of split frequencies: 0.017928
200500 -- [-479.333] (-478.166) (-479.204) (-481.087) * [-479.913] (-477.414) (-476.554) (-477.436) -- 0:00:51
201000 -- (-478.917) (-480.054) (-477.397) [-480.241] * (-478.467) [-477.143] (-476.844) (-480.176) -- 0:00:51
201500 -- [-477.427] (-476.273) (-478.124) (-479.159) * (-479.275) (-477.455) (-479.505) [-478.073] -- 0:00:51
202000 -- (-476.383) [-478.000] (-477.728) (-483.383) * [-475.937] (-486.188) (-481.910) (-478.951) -- 0:00:51
202500 -- (-479.367) [-478.592] (-477.452) (-480.563) * [-476.471] (-479.598) (-481.583) (-478.839) -- 0:00:51
203000 -- (-475.796) [-480.032] (-479.592) (-476.509) * (-477.839) (-482.372) (-480.337) [-477.648] -- 0:00:51
203500 -- [-482.600] (-476.154) (-477.303) (-476.983) * (-477.403) (-477.608) (-481.048) [-478.124] -- 0:00:50
204000 -- (-477.879) [-476.319] (-482.092) (-481.090) * [-483.061] (-479.153) (-478.689) (-479.483) -- 0:00:50
204500 -- (-477.112) (-482.759) (-477.003) [-479.354] * (-481.335) (-479.927) [-476.388] (-477.723) -- 0:00:50
205000 -- (-481.238) (-477.799) (-476.694) [-479.852] * (-478.058) (-480.508) (-477.674) [-476.010] -- 0:00:50
Average standard deviation of split frequencies: 0.017464
205500 -- (-479.254) [-479.475] (-477.311) (-479.144) * (-480.054) (-476.520) [-482.158] (-480.097) -- 0:00:50
206000 -- [-478.548] (-480.003) (-478.273) (-483.373) * [-478.522] (-477.782) (-480.120) (-479.408) -- 0:00:50
206500 -- (-477.080) (-479.130) (-476.604) [-478.563] * (-479.119) (-477.033) (-482.071) [-482.772] -- 0:00:49
207000 -- (-481.131) (-488.872) (-475.270) [-479.325] * (-479.939) [-477.436] (-478.761) (-481.555) -- 0:00:49
207500 -- (-479.160) [-479.488] (-480.086) (-477.679) * (-480.746) [-477.064] (-479.100) (-479.473) -- 0:00:49
208000 -- (-477.030) [-478.020] (-479.026) (-478.895) * (-480.225) (-476.442) [-479.324] (-478.295) -- 0:00:49
208500 -- (-477.636) [-481.199] (-479.794) (-477.731) * [-477.522] (-476.264) (-480.236) (-480.575) -- 0:00:53
209000 -- (-479.623) [-477.687] (-479.805) (-479.043) * [-480.860] (-480.147) (-477.451) (-480.955) -- 0:00:52
209500 -- [-483.775] (-480.392) (-479.749) (-477.252) * [-479.840] (-476.210) (-485.852) (-479.250) -- 0:00:52
210000 -- (-479.136) [-478.112] (-474.999) (-479.543) * [-476.964] (-476.767) (-479.444) (-480.015) -- 0:00:52
Average standard deviation of split frequencies: 0.017901
210500 -- (-475.749) (-477.416) (-475.124) [-476.760] * (-479.629) (-478.801) [-476.561] (-480.901) -- 0:00:52
211000 -- [-476.923] (-476.208) (-475.286) (-479.854) * [-478.351] (-477.040) (-476.133) (-478.285) -- 0:00:52
211500 -- (-477.821) (-477.260) (-483.902) [-480.992] * (-482.960) (-477.167) [-479.226] (-480.548) -- 0:00:52
212000 -- [-476.611] (-480.869) (-484.457) (-479.998) * (-480.629) (-481.069) [-476.988] (-479.443) -- 0:00:52
212500 -- (-479.186) [-476.688] (-480.568) (-480.894) * (-479.689) [-480.178] (-476.514) (-478.396) -- 0:00:51
213000 -- [-476.401] (-477.800) (-479.864) (-478.535) * (-476.489) (-477.687) (-476.284) [-477.017] -- 0:00:51
213500 -- [-477.731] (-478.947) (-478.426) (-478.851) * [-481.437] (-477.448) (-479.433) (-478.017) -- 0:00:51
214000 -- (-477.579) (-476.858) (-477.382) [-478.554] * [-477.442] (-478.035) (-477.393) (-475.907) -- 0:00:51
214500 -- [-477.597] (-479.621) (-479.800) (-478.548) * [-478.867] (-478.024) (-477.256) (-477.549) -- 0:00:51
215000 -- [-480.561] (-479.931) (-480.916) (-479.437) * [-476.789] (-480.350) (-479.658) (-480.975) -- 0:00:51
Average standard deviation of split frequencies: 0.018914
215500 -- (-478.708) (-477.081) [-477.661] (-480.163) * (-479.865) [-477.884] (-480.349) (-480.031) -- 0:00:50
216000 -- (-479.664) (-477.905) [-478.886] (-479.425) * [-480.364] (-481.813) (-477.279) (-478.133) -- 0:00:50
216500 -- (-478.768) (-477.397) [-480.123] (-479.752) * (-477.627) [-476.154] (-478.699) (-478.065) -- 0:00:50
217000 -- (-479.550) (-477.469) [-477.756] (-478.466) * (-479.421) (-478.324) [-477.663] (-478.876) -- 0:00:50
217500 -- (-478.595) [-476.926] (-477.670) (-478.126) * (-479.962) [-477.167] (-480.143) (-477.105) -- 0:00:50
218000 -- (-479.678) [-476.681] (-478.377) (-477.591) * (-480.064) (-477.712) (-477.816) [-478.363] -- 0:00:50
218500 -- (-477.461) [-477.882] (-482.475) (-479.067) * [-481.961] (-478.065) (-480.565) (-476.609) -- 0:00:50
219000 -- (-478.225) [-477.214] (-477.065) (-480.730) * (-483.681) (-475.780) (-478.029) [-479.279] -- 0:00:49
219500 -- (-478.382) [-480.188] (-478.893) (-478.287) * (-480.469) [-483.893] (-475.809) (-479.361) -- 0:00:49
220000 -- (-478.130) [-480.502] (-478.462) (-481.540) * [-478.011] (-478.845) (-479.436) (-483.057) -- 0:00:49
Average standard deviation of split frequencies: 0.017565
220500 -- (-481.390) [-475.543] (-479.368) (-478.157) * [-478.714] (-480.148) (-481.373) (-478.960) -- 0:00:49
221000 -- [-477.483] (-481.352) (-479.226) (-481.721) * (-482.234) [-477.830] (-478.267) (-477.858) -- 0:00:49
221500 -- (-483.435) (-480.908) (-479.169) [-479.313] * (-481.160) [-478.849] (-482.746) (-476.625) -- 0:00:49
222000 -- (-480.768) [-475.924] (-478.965) (-478.996) * (-477.961) (-477.871) [-478.545] (-476.043) -- 0:00:49
222500 -- (-479.034) (-477.442) (-480.327) [-477.981] * (-479.830) (-480.911) (-480.517) [-476.360] -- 0:00:48
223000 -- (-478.740) (-477.737) (-480.611) [-479.547] * (-480.398) [-480.088] (-478.892) (-479.825) -- 0:00:48
223500 -- (-479.997) [-477.810] (-480.396) (-478.895) * (-479.258) [-476.728] (-477.648) (-478.877) -- 0:00:48
224000 -- (-482.402) [-476.106] (-479.613) (-480.370) * (-479.123) [-481.479] (-480.827) (-479.597) -- 0:00:48
224500 -- [-475.327] (-477.017) (-479.275) (-478.111) * (-479.031) (-481.966) [-475.902] (-477.719) -- 0:00:51
225000 -- (-478.033) [-476.050] (-477.750) (-484.028) * (-477.996) (-478.855) (-477.961) [-478.820] -- 0:00:51
Average standard deviation of split frequencies: 0.016791
225500 -- (-476.239) [-482.407] (-478.790) (-481.840) * (-480.060) (-477.586) (-476.585) [-477.896] -- 0:00:51
226000 -- (-480.914) (-479.117) [-479.280] (-479.056) * (-479.901) (-481.253) (-480.010) [-479.068] -- 0:00:51
226500 -- (-480.623) [-476.653] (-479.195) (-480.872) * (-478.491) [-477.874] (-476.824) (-478.053) -- 0:00:51
227000 -- (-481.117) (-477.053) (-481.397) [-478.171] * (-480.825) [-476.931] (-479.830) (-479.995) -- 0:00:51
227500 -- [-476.220] (-479.892) (-479.281) (-479.898) * (-478.799) (-477.170) (-477.531) [-482.451] -- 0:00:50
228000 -- (-480.318) (-476.883) [-478.472] (-480.487) * (-478.805) (-479.441) (-478.092) [-476.444] -- 0:00:50
228500 -- (-478.088) (-477.336) [-479.764] (-480.322) * (-484.602) (-483.224) [-478.107] (-476.289) -- 0:00:50
229000 -- (-480.569) (-475.294) (-480.511) [-478.910] * (-481.021) (-478.642) [-477.282] (-477.554) -- 0:00:50
229500 -- (-486.139) (-479.626) [-480.896] (-478.970) * (-482.451) (-484.145) (-481.502) [-478.923] -- 0:00:50
230000 -- (-484.069) (-479.384) (-485.618) [-483.077] * (-480.411) (-480.223) [-480.131] (-478.327) -- 0:00:50
Average standard deviation of split frequencies: 0.016887
230500 -- (-484.171) (-478.491) (-476.025) [-483.908] * (-479.862) [-478.480] (-476.674) (-478.143) -- 0:00:50
231000 -- [-479.523] (-476.048) (-479.969) (-479.722) * (-480.523) (-477.547) [-477.695] (-477.154) -- 0:00:49
231500 -- (-479.835) [-478.048] (-482.298) (-479.972) * (-483.961) [-480.273] (-475.331) (-478.993) -- 0:00:49
232000 -- (-478.529) (-477.372) [-479.630] (-481.335) * (-478.156) (-479.693) (-476.481) [-478.230] -- 0:00:49
232500 -- (-479.777) (-476.561) (-477.863) [-478.050] * [-481.024] (-478.640) (-479.291) (-479.407) -- 0:00:49
233000 -- (-477.931) (-476.172) [-475.907] (-481.168) * (-479.261) (-479.085) [-481.775] (-476.439) -- 0:00:49
233500 -- [-478.392] (-477.510) (-480.402) (-479.112) * (-477.808) (-479.427) [-479.627] (-480.717) -- 0:00:49
234000 -- (-478.798) (-475.913) (-480.810) [-481.014] * (-481.148) (-477.353) (-481.532) [-478.749] -- 0:00:49
234500 -- (-478.675) [-478.316] (-480.757) (-478.846) * (-480.214) (-477.641) [-477.614] (-481.667) -- 0:00:48
235000 -- (-476.477) [-477.219] (-479.224) (-477.359) * (-479.226) (-481.217) [-477.065] (-481.148) -- 0:00:48
Average standard deviation of split frequencies: 0.015559
235500 -- (-477.303) (-475.982) [-478.918] (-481.755) * (-478.339) [-476.401] (-477.275) (-479.391) -- 0:00:48
236000 -- (-478.881) (-476.278) (-481.069) [-480.511] * (-483.025) [-478.610] (-476.255) (-480.463) -- 0:00:48
236500 -- (-476.984) [-478.056] (-479.585) (-478.921) * (-478.791) [-479.513] (-479.775) (-483.052) -- 0:00:48
237000 -- (-479.410) (-476.264) [-477.845] (-480.103) * (-479.362) [-478.133] (-478.761) (-481.045) -- 0:00:48
237500 -- (-476.972) (-476.714) [-477.124] (-482.169) * (-476.767) (-477.978) [-477.493] (-481.237) -- 0:00:48
238000 -- (-476.750) [-476.423] (-478.810) (-480.541) * (-481.491) (-476.714) [-475.509] (-481.549) -- 0:00:48
238500 -- (-477.248) (-477.333) [-478.875] (-478.903) * (-479.815) [-476.656] (-477.934) (-481.505) -- 0:00:47
239000 -- (-481.572) (-479.359) [-479.928] (-480.613) * (-480.766) [-476.393] (-478.246) (-481.372) -- 0:00:47
239500 -- (-477.115) (-480.518) [-478.481] (-476.755) * (-478.205) [-477.013] (-476.831) (-479.907) -- 0:00:47
240000 -- (-482.305) (-475.822) [-478.147] (-478.494) * (-479.368) (-481.049) [-476.316] (-478.558) -- 0:00:47
Average standard deviation of split frequencies: 0.015154
240500 -- (-481.134) [-475.436] (-479.504) (-479.828) * (-479.456) (-479.698) [-478.028] (-479.776) -- 0:00:50
241000 -- (-477.221) [-480.497] (-476.173) (-479.064) * (-478.034) (-477.112) (-475.758) [-477.777] -- 0:00:50
241500 -- (-478.926) [-478.607] (-477.905) (-483.385) * (-478.921) (-477.785) [-474.422] (-476.505) -- 0:00:50
242000 -- (-476.599) [-476.368] (-479.385) (-479.352) * (-479.758) [-477.653] (-474.989) (-477.923) -- 0:00:50
242500 -- (-482.753) (-478.352) (-477.941) [-479.266] * (-479.255) [-474.804] (-480.367) (-482.901) -- 0:00:49
243000 -- (-476.941) (-478.841) [-476.311] (-479.873) * [-478.940] (-478.029) (-479.195) (-477.677) -- 0:00:49
243500 -- [-477.348] (-478.817) (-476.461) (-480.563) * [-481.613] (-483.596) (-478.250) (-475.321) -- 0:00:49
244000 -- (-477.746) [-478.094] (-478.698) (-481.853) * (-480.831) (-476.762) (-480.353) [-477.590] -- 0:00:49
244500 -- (-482.011) (-478.080) [-477.616] (-480.647) * (-478.136) (-479.609) (-475.989) [-476.163] -- 0:00:49
245000 -- (-477.527) [-475.919] (-479.389) (-479.499) * (-477.678) (-477.830) (-476.588) [-477.505] -- 0:00:49
Average standard deviation of split frequencies: 0.013733
245500 -- (-480.323) [-476.535] (-480.318) (-479.135) * (-479.570) (-477.621) (-476.206) [-477.496] -- 0:00:49
246000 -- [-477.153] (-478.207) (-479.493) (-483.320) * (-480.195) (-478.216) (-476.451) [-478.453] -- 0:00:49
246500 -- (-477.531) (-476.958) [-477.700] (-480.477) * (-481.021) [-477.455] (-478.576) (-477.703) -- 0:00:48
247000 -- (-479.197) (-476.147) (-482.780) [-476.142] * [-478.607] (-479.665) (-478.819) (-477.813) -- 0:00:48
247500 -- (-478.519) (-480.734) [-482.457] (-480.997) * (-478.058) (-479.976) (-481.100) [-476.036] -- 0:00:48
248000 -- [-480.199] (-479.015) (-478.009) (-478.828) * (-476.475) (-479.603) (-480.627) [-476.877] -- 0:00:48
248500 -- [-478.319] (-476.305) (-477.883) (-480.215) * [-479.178] (-479.250) (-481.504) (-481.266) -- 0:00:48
249000 -- (-479.163) [-479.399] (-478.011) (-480.014) * (-478.534) (-479.643) (-481.362) [-476.429] -- 0:00:48
249500 -- (-479.443) [-475.581] (-476.506) (-477.943) * (-483.060) (-478.146) (-479.303) [-476.058] -- 0:00:48
250000 -- (-476.478) (-479.854) (-480.694) [-477.565] * [-479.806] (-480.174) (-476.959) (-477.464) -- 0:00:48
Average standard deviation of split frequencies: 0.015243
250500 -- [-480.237] (-476.434) (-477.934) (-478.849) * (-478.798) [-479.077] (-478.391) (-479.874) -- 0:00:47
251000 -- (-476.653) [-480.470] (-476.664) (-478.898) * (-478.176) [-479.573] (-479.597) (-481.288) -- 0:00:47
251500 -- (-477.318) (-479.219) (-477.977) [-478.761] * (-478.199) (-478.845) (-476.842) [-476.712] -- 0:00:47
252000 -- (-477.036) (-477.237) [-478.924] (-481.127) * [-480.175] (-481.674) (-480.538) (-477.606) -- 0:00:47
252500 -- (-481.384) (-478.109) [-476.314] (-476.882) * (-479.330) [-478.231] (-477.927) (-477.902) -- 0:00:47
253000 -- (-482.985) (-475.862) (-474.605) [-477.064] * (-476.953) (-477.990) [-477.546] (-480.357) -- 0:00:47
253500 -- (-481.096) [-477.607] (-483.319) (-478.482) * (-479.318) (-477.462) (-478.523) [-477.783] -- 0:00:47
254000 -- (-478.537) [-475.607] (-481.548) (-478.353) * [-480.634] (-479.373) (-478.367) (-477.535) -- 0:00:46
254500 -- (-481.475) [-477.284] (-478.680) (-482.318) * (-478.114) [-479.716] (-479.896) (-477.534) -- 0:00:46
255000 -- (-480.492) (-476.468) [-476.489] (-480.033) * [-479.230] (-479.930) (-479.880) (-477.075) -- 0:00:46
Average standard deviation of split frequencies: 0.014936
255500 -- (-478.263) (-476.161) [-478.405] (-478.139) * [-483.681] (-480.494) (-479.286) (-477.713) -- 0:00:46
256000 -- (-477.225) [-476.468] (-477.205) (-477.870) * (-481.066) (-482.317) (-477.164) [-477.190] -- 0:00:46
256500 -- (-476.930) [-475.895] (-478.262) (-478.371) * [-479.439] (-487.652) (-477.644) (-477.575) -- 0:00:49
257000 -- [-477.386] (-476.997) (-478.541) (-476.141) * (-483.630) (-476.756) [-478.424] (-479.822) -- 0:00:49
257500 -- [-476.639] (-476.982) (-480.230) (-475.896) * (-481.239) [-481.464] (-479.074) (-480.193) -- 0:00:49
258000 -- (-478.646) (-475.676) (-482.378) [-478.877] * (-481.839) [-476.942] (-479.905) (-476.776) -- 0:00:48
258500 -- (-477.951) (-475.280) [-480.032] (-481.925) * [-478.664] (-476.160) (-479.757) (-477.555) -- 0:00:48
259000 -- (-480.247) (-478.974) [-480.641] (-479.277) * (-480.176) (-478.954) (-480.953) [-479.007] -- 0:00:48
259500 -- (-482.653) (-478.860) [-478.026] (-479.034) * [-476.313] (-480.579) (-479.134) (-478.577) -- 0:00:48
260000 -- (-480.847) [-475.528] (-477.786) (-482.068) * [-478.896] (-478.676) (-478.867) (-486.144) -- 0:00:48
Average standard deviation of split frequencies: 0.014787
260500 -- (-475.661) [-477.939] (-478.060) (-482.556) * (-477.103) [-478.714] (-477.169) (-480.106) -- 0:00:48
261000 -- [-478.017] (-479.862) (-476.768) (-481.557) * (-477.721) (-479.221) (-476.130) [-479.957] -- 0:00:48
261500 -- (-478.270) (-487.451) [-480.052] (-476.930) * (-479.308) (-475.338) [-475.904] (-480.287) -- 0:00:48
262000 -- (-479.925) (-477.419) (-481.273) [-477.154] * (-479.701) (-476.034) [-479.629] (-478.665) -- 0:00:47
262500 -- (-479.842) [-477.724] (-477.079) (-474.753) * (-477.759) [-476.589] (-478.135) (-482.194) -- 0:00:47
263000 -- (-475.396) (-480.412) [-477.061] (-479.926) * (-480.335) (-478.544) (-482.939) [-476.938] -- 0:00:47
263500 -- (-477.845) [-479.168] (-479.862) (-479.469) * (-479.944) [-478.978] (-479.554) (-477.755) -- 0:00:47
264000 -- [-478.617] (-482.552) (-480.196) (-477.975) * (-478.596) (-477.665) (-478.220) [-478.977] -- 0:00:47
264500 -- (-477.923) (-478.344) (-479.963) [-478.753] * (-476.492) [-479.745] (-477.023) (-479.782) -- 0:00:47
265000 -- (-477.988) [-476.198] (-477.711) (-479.682) * (-479.682) (-478.953) (-477.652) [-477.614] -- 0:00:47
Average standard deviation of split frequencies: 0.013431
265500 -- (-479.283) [-478.349] (-475.283) (-477.847) * (-478.514) [-476.854] (-482.212) (-476.758) -- 0:00:47
266000 -- (-478.182) (-480.196) [-477.620] (-476.884) * [-478.358] (-475.247) (-481.009) (-476.812) -- 0:00:46
266500 -- (-479.185) (-478.732) (-476.394) [-476.212] * [-477.945] (-475.153) (-478.010) (-478.400) -- 0:00:46
267000 -- (-476.368) [-476.601] (-476.648) (-478.008) * (-477.815) [-477.143] (-476.224) (-479.603) -- 0:00:46
267500 -- (-477.622) (-478.452) (-481.506) [-480.418] * (-478.746) [-478.409] (-477.118) (-479.490) -- 0:00:46
268000 -- (-477.572) [-478.113] (-478.681) (-476.454) * (-477.948) [-477.709] (-478.425) (-476.786) -- 0:00:46
268500 -- (-478.364) (-479.077) [-477.581] (-476.935) * [-479.195] (-477.215) (-477.836) (-478.080) -- 0:00:46
269000 -- (-480.736) (-481.102) (-478.342) [-477.582] * (-481.048) [-475.008] (-479.919) (-476.486) -- 0:00:46
269500 -- (-482.228) [-479.434] (-477.576) (-479.360) * [-477.428] (-479.852) (-478.487) (-476.498) -- 0:00:46
270000 -- (-479.976) (-476.388) [-477.457] (-479.879) * [-479.944] (-478.755) (-478.297) (-478.528) -- 0:00:45
Average standard deviation of split frequencies: 0.013523
270500 -- [-481.487] (-477.847) (-477.556) (-482.175) * (-479.290) (-478.720) [-477.474] (-478.068) -- 0:00:48
271000 -- (-479.069) [-479.100] (-481.582) (-483.244) * (-479.996) (-477.248) (-476.407) [-479.322] -- 0:00:48
271500 -- [-476.854] (-478.062) (-481.032) (-480.875) * (-482.454) (-479.110) (-476.358) [-477.191] -- 0:00:48
272000 -- (-478.571) (-483.095) (-483.468) [-480.999] * [-479.704] (-477.237) (-477.439) (-478.252) -- 0:00:48
272500 -- (-477.189) [-477.637] (-479.638) (-480.431) * (-479.015) (-476.231) (-477.286) [-478.741] -- 0:00:48
273000 -- (-479.059) (-479.551) (-479.126) [-478.183] * (-477.641) (-476.546) [-476.885] (-480.144) -- 0:00:47
273500 -- (-480.625) [-479.905] (-479.352) (-477.281) * (-477.634) [-477.819] (-484.496) (-480.058) -- 0:00:47
274000 -- (-479.222) [-478.218] (-479.100) (-478.523) * (-476.354) [-480.036] (-479.488) (-477.269) -- 0:00:47
274500 -- [-479.161] (-478.918) (-480.341) (-479.285) * (-482.590) (-480.540) [-479.276] (-480.438) -- 0:00:47
275000 -- (-481.321) [-479.722] (-479.204) (-479.135) * (-475.561) [-480.584] (-475.329) (-477.937) -- 0:00:47
Average standard deviation of split frequencies: 0.013362
275500 -- (-483.621) (-478.437) (-482.084) [-477.815] * (-479.389) [-475.704] (-477.166) (-481.271) -- 0:00:47
276000 -- (-478.808) (-479.546) (-478.508) [-475.853] * [-479.815] (-480.573) (-478.660) (-483.431) -- 0:00:47
276500 -- (-479.277) (-478.884) (-482.615) [-480.202] * [-475.985] (-476.386) (-477.939) (-479.571) -- 0:00:47
277000 -- (-479.011) (-478.672) (-482.867) [-479.050] * [-476.509] (-478.639) (-483.714) (-478.928) -- 0:00:46
277500 -- (-477.944) [-480.397] (-480.136) (-476.114) * (-475.823) (-480.975) [-480.203] (-482.534) -- 0:00:46
278000 -- (-478.565) (-477.298) (-479.715) [-481.692] * (-477.740) (-479.065) [-480.450] (-481.725) -- 0:00:46
278500 -- (-478.660) (-480.274) (-482.922) [-480.266] * (-477.964) (-479.559) [-479.849] (-487.573) -- 0:00:46
279000 -- [-478.795] (-475.274) (-482.620) (-479.317) * (-476.808) (-478.899) [-478.940] (-478.059) -- 0:00:46
279500 -- (-478.530) [-478.015] (-479.817) (-477.221) * [-477.443] (-479.989) (-480.910) (-478.623) -- 0:00:46
280000 -- (-479.398) [-479.358] (-485.385) (-477.139) * (-478.628) [-476.108] (-476.249) (-478.394) -- 0:00:46
Average standard deviation of split frequencies: 0.012844
280500 -- [-480.091] (-479.440) (-479.766) (-478.880) * (-476.894) (-479.379) (-478.162) [-478.186] -- 0:00:46
281000 -- (-478.176) [-478.039] (-481.504) (-474.503) * (-476.981) (-478.785) [-477.768] (-479.599) -- 0:00:46
281500 -- (-477.397) [-481.651] (-480.335) (-476.506) * [-477.844] (-481.404) (-478.389) (-479.198) -- 0:00:45
282000 -- (-480.360) (-478.051) (-477.069) [-477.153] * [-476.697] (-477.024) (-477.546) (-479.646) -- 0:00:45
282500 -- (-479.212) (-478.180) (-477.231) [-475.278] * (-479.727) [-478.390] (-479.838) (-478.741) -- 0:00:45
283000 -- (-478.901) (-477.119) [-478.404] (-478.279) * (-478.378) (-479.890) (-479.520) [-476.912] -- 0:00:45
283500 -- [-477.950] (-478.350) (-477.106) (-478.862) * (-478.230) (-479.714) (-478.417) [-478.275] -- 0:00:45
284000 -- [-480.198] (-478.215) (-477.298) (-478.520) * (-480.349) (-478.763) [-477.775] (-478.971) -- 0:00:45
284500 -- (-483.640) (-477.237) [-476.945] (-476.002) * [-478.190] (-479.151) (-480.127) (-479.319) -- 0:00:45
285000 -- (-476.607) (-478.810) (-480.159) [-480.253] * (-477.928) (-480.046) (-477.336) [-476.796] -- 0:00:45
Average standard deviation of split frequencies: 0.013644
285500 -- (-478.842) (-475.146) [-477.712] (-480.248) * [-476.043] (-480.707) (-482.853) (-480.534) -- 0:00:45
286000 -- [-478.019] (-477.511) (-477.038) (-484.197) * (-476.761) [-478.328] (-479.744) (-481.363) -- 0:00:44
286500 -- (-477.438) (-478.294) (-478.927) [-479.084] * (-480.114) (-477.699) (-480.473) [-478.063] -- 0:00:47
287000 -- (-475.462) (-476.793) (-482.131) [-481.313] * (-480.044) (-477.814) (-483.874) [-478.960] -- 0:00:47
287500 -- (-479.582) [-478.895] (-478.881) (-479.557) * [-477.380] (-477.674) (-484.505) (-478.377) -- 0:00:47
288000 -- (-478.335) [-477.162] (-480.758) (-478.902) * (-478.413) [-475.282] (-478.887) (-477.577) -- 0:00:46
288500 -- [-479.896] (-478.724) (-477.861) (-476.549) * (-478.218) [-478.387] (-482.188) (-478.624) -- 0:00:46
289000 -- [-478.099] (-478.577) (-477.810) (-477.499) * (-481.481) [-476.573] (-485.382) (-481.009) -- 0:00:46
289500 -- (-478.991) (-478.059) [-478.986] (-479.742) * [-478.328] (-476.256) (-477.918) (-480.253) -- 0:00:46
290000 -- [-477.297] (-480.040) (-478.461) (-479.956) * [-477.598] (-480.854) (-478.322) (-480.210) -- 0:00:46
Average standard deviation of split frequencies: 0.012879
290500 -- (-480.684) (-478.103) [-478.317] (-480.025) * [-479.228] (-477.148) (-486.014) (-481.247) -- 0:00:46
291000 -- (-476.103) (-476.141) (-477.264) [-478.726] * (-483.914) (-481.102) [-477.916] (-476.763) -- 0:00:46
291500 -- (-482.468) (-479.067) [-478.701] (-479.333) * (-480.769) [-477.530] (-478.636) (-477.399) -- 0:00:46
292000 -- (-478.540) [-479.555] (-477.493) (-474.798) * (-477.600) (-480.804) [-476.136] (-480.262) -- 0:00:46
292500 -- (-476.273) (-477.549) (-486.582) [-475.427] * (-477.395) [-475.832] (-477.220) (-477.140) -- 0:00:45
293000 -- [-477.642] (-475.527) (-478.016) (-486.234) * [-477.959] (-480.608) (-476.417) (-480.626) -- 0:00:45
293500 -- (-480.967) (-476.108) (-479.008) [-478.567] * (-479.812) [-476.130] (-478.620) (-479.782) -- 0:00:45
294000 -- (-476.488) [-480.128] (-477.211) (-477.234) * (-479.531) (-478.844) [-478.797] (-481.388) -- 0:00:45
294500 -- (-480.107) (-477.477) (-476.732) [-478.485] * (-478.951) (-476.348) [-478.434] (-481.241) -- 0:00:45
295000 -- (-476.946) [-478.977] (-482.842) (-474.636) * (-479.397) [-477.042] (-479.124) (-477.226) -- 0:00:45
Average standard deviation of split frequencies: 0.012647
295500 -- (-476.394) (-481.281) (-480.583) [-477.633] * (-479.809) (-476.524) (-478.093) [-480.904] -- 0:00:45
296000 -- (-478.395) [-479.353] (-481.907) (-477.533) * [-482.080] (-476.892) (-484.159) (-479.129) -- 0:00:45
296500 -- (-479.422) (-480.793) [-480.561] (-479.730) * (-477.592) (-476.475) (-478.474) [-483.122] -- 0:00:45
297000 -- [-478.169] (-475.094) (-480.149) (-477.682) * (-478.028) (-475.967) [-478.979] (-479.512) -- 0:00:44
297500 -- (-475.878) (-477.793) (-487.964) [-476.393] * (-477.588) (-478.079) [-476.049] (-477.931) -- 0:00:44
298000 -- (-481.496) (-476.577) (-477.259) [-476.064] * (-480.326) (-476.459) [-478.300] (-479.994) -- 0:00:44
298500 -- (-485.441) (-479.068) [-481.364] (-479.076) * (-476.205) (-481.357) (-479.320) [-476.776] -- 0:00:44
299000 -- (-477.569) (-478.526) (-481.493) [-475.462] * (-478.113) [-475.829] (-479.723) (-477.647) -- 0:00:44
299500 -- (-478.908) [-481.306] (-478.771) (-477.187) * (-479.346) (-478.473) [-479.459] (-475.347) -- 0:00:44
300000 -- (-479.966) (-478.159) (-481.069) [-476.872] * [-476.703] (-481.253) (-480.174) (-476.317) -- 0:00:44
Average standard deviation of split frequencies: 0.012266
300500 -- (-478.434) [-477.045] (-478.453) (-476.826) * (-476.944) [-480.568] (-482.781) (-481.703) -- 0:00:46
301000 -- [-478.112] (-477.081) (-478.283) (-480.954) * [-479.080] (-479.908) (-482.009) (-477.478) -- 0:00:46
301500 -- (-477.224) (-478.869) (-478.598) [-477.418] * (-479.338) (-477.367) [-477.631] (-479.125) -- 0:00:46
302000 -- [-477.096] (-476.282) (-478.005) (-479.273) * (-478.488) (-479.657) [-478.816] (-480.796) -- 0:00:46
302500 -- (-478.185) [-479.105] (-479.513) (-479.511) * (-483.783) (-481.480) (-477.348) [-475.341] -- 0:00:46
303000 -- (-476.843) (-477.717) (-479.501) [-476.973] * [-477.846] (-480.673) (-477.492) (-480.901) -- 0:00:46
303500 -- (-479.714) (-478.389) [-477.120] (-477.721) * (-479.529) (-477.516) (-478.430) [-479.249] -- 0:00:45
304000 -- (-476.558) [-478.353] (-475.723) (-478.492) * (-481.231) (-478.676) [-483.088] (-479.184) -- 0:00:45
304500 -- (-475.436) [-478.600] (-477.680) (-483.333) * (-480.127) (-481.242) [-478.712] (-478.241) -- 0:00:45
305000 -- [-478.515] (-480.141) (-475.509) (-482.201) * (-478.617) (-478.580) (-482.133) [-480.950] -- 0:00:45
Average standard deviation of split frequencies: 0.012234
305500 -- (-478.406) [-478.362] (-478.360) (-486.964) * (-480.059) (-477.434) [-478.091] (-479.831) -- 0:00:45
306000 -- (-476.650) [-476.245] (-479.658) (-480.196) * (-475.918) [-479.288] (-477.115) (-477.678) -- 0:00:45
306500 -- (-477.830) [-479.068] (-483.456) (-476.665) * [-477.635] (-475.256) (-477.085) (-478.129) -- 0:00:45
307000 -- [-477.287] (-477.517) (-478.294) (-482.466) * [-483.624] (-475.830) (-482.848) (-478.078) -- 0:00:45
307500 -- (-475.115) (-482.913) [-476.816] (-476.423) * (-480.429) [-476.376] (-479.197) (-483.780) -- 0:00:45
308000 -- (-480.677) (-480.475) [-478.272] (-479.092) * (-480.796) (-479.777) (-478.994) [-477.432] -- 0:00:44
308500 -- [-482.138] (-480.398) (-477.013) (-478.307) * [-476.031] (-479.052) (-478.954) (-480.087) -- 0:00:44
309000 -- (-477.213) (-480.043) [-477.297] (-478.035) * (-477.045) (-477.867) [-476.654] (-480.165) -- 0:00:44
309500 -- [-477.735] (-479.622) (-475.564) (-476.525) * (-478.099) (-477.806) [-477.023] (-478.949) -- 0:00:44
310000 -- (-479.401) [-477.249] (-479.069) (-479.552) * (-476.734) (-476.381) (-476.723) [-479.770] -- 0:00:44
Average standard deviation of split frequencies: 0.013572
310500 -- [-478.944] (-481.002) (-476.473) (-478.241) * (-477.151) (-477.049) [-477.249] (-481.077) -- 0:00:44
311000 -- [-475.607] (-477.992) (-478.370) (-478.087) * (-482.015) (-481.101) [-477.979] (-479.987) -- 0:00:44
311500 -- [-478.255] (-480.268) (-480.271) (-478.517) * [-476.938] (-477.673) (-477.298) (-481.034) -- 0:00:44
312000 -- [-476.172] (-478.127) (-476.463) (-477.016) * (-486.473) (-477.344) [-476.686] (-485.091) -- 0:00:44
312500 -- (-480.904) (-477.252) [-476.059] (-478.378) * (-485.309) (-477.479) (-483.192) [-477.907] -- 0:00:44
313000 -- (-476.888) [-476.997] (-479.200) (-476.658) * (-476.379) [-477.611] (-474.579) (-479.233) -- 0:00:43
313500 -- (-481.800) [-479.290] (-486.730) (-479.463) * (-474.652) (-476.928) [-477.810] (-476.433) -- 0:00:43
314000 -- (-477.794) [-478.396] (-482.825) (-482.189) * (-477.014) [-475.975] (-478.370) (-477.019) -- 0:00:43
314500 -- (-483.060) (-477.571) [-483.707] (-476.798) * (-476.373) (-477.785) [-475.760] (-478.835) -- 0:00:43
315000 -- [-480.094] (-478.113) (-479.012) (-478.669) * [-480.134] (-477.498) (-475.562) (-483.331) -- 0:00:43
Average standard deviation of split frequencies: 0.013075
315500 -- (-478.644) (-480.084) (-478.800) [-475.832] * (-483.848) (-477.118) [-477.984] (-477.995) -- 0:00:43
316000 -- (-482.007) [-478.083] (-475.107) (-480.194) * (-478.059) (-478.652) [-480.505] (-478.214) -- 0:00:45
316500 -- (-479.628) (-478.037) [-474.741] (-480.260) * (-480.341) [-475.880] (-478.587) (-478.101) -- 0:00:45
317000 -- [-477.312] (-476.772) (-476.673) (-478.712) * (-477.081) [-477.540] (-480.058) (-476.833) -- 0:00:45
317500 -- (-475.579) (-476.495) [-478.142] (-477.234) * (-478.370) (-478.347) [-479.185] (-477.756) -- 0:00:45
318000 -- (-478.522) (-476.178) (-477.160) [-479.493] * (-478.259) [-478.689] (-481.481) (-479.844) -- 0:00:45
318500 -- (-482.661) (-476.489) [-479.655] (-485.505) * [-477.558] (-480.077) (-483.179) (-479.320) -- 0:00:44
319000 -- (-481.253) [-475.774] (-481.092) (-479.293) * (-476.952) (-476.756) (-480.032) [-478.760] -- 0:00:44
319500 -- (-482.003) [-475.536] (-477.967) (-476.931) * (-478.220) (-479.809) (-479.977) [-478.261] -- 0:00:44
320000 -- [-476.390] (-478.709) (-476.672) (-482.639) * [-477.834] (-478.148) (-479.641) (-482.240) -- 0:00:44
Average standard deviation of split frequencies: 0.013577
320500 -- (-477.721) [-478.455] (-476.055) (-479.561) * [-476.921] (-482.455) (-476.637) (-483.483) -- 0:00:44
321000 -- (-479.652) [-476.828] (-479.539) (-482.160) * [-478.089] (-484.829) (-476.273) (-480.757) -- 0:00:44
321500 -- (-477.824) [-477.347] (-478.383) (-478.758) * (-479.329) (-479.632) (-476.493) [-479.766] -- 0:00:44
322000 -- [-479.142] (-480.402) (-479.516) (-480.459) * (-480.861) (-479.836) [-475.844] (-480.473) -- 0:00:44
322500 -- (-477.702) (-480.355) [-476.013] (-476.424) * (-480.424) (-479.423) [-477.539] (-480.387) -- 0:00:44
323000 -- (-478.436) [-477.652] (-478.266) (-478.325) * [-479.667] (-480.924) (-480.625) (-479.413) -- 0:00:44
323500 -- [-476.487] (-476.570) (-476.172) (-478.100) * (-478.741) (-480.955) [-477.423] (-479.700) -- 0:00:43
324000 -- (-476.505) (-478.843) (-478.142) [-477.140] * (-476.267) [-478.976] (-476.887) (-477.300) -- 0:00:43
324500 -- (-477.617) (-475.693) (-478.235) [-476.976] * (-481.610) [-479.109] (-477.209) (-478.426) -- 0:00:43
325000 -- (-479.641) [-476.184] (-480.202) (-478.860) * (-477.959) (-479.063) [-479.400] (-478.584) -- 0:00:43
Average standard deviation of split frequencies: 0.013577
325500 -- [-476.837] (-478.301) (-480.915) (-477.664) * [-476.776] (-480.521) (-477.753) (-481.521) -- 0:00:43
326000 -- [-478.002] (-477.985) (-478.211) (-480.249) * (-479.688) (-479.521) [-477.029] (-479.801) -- 0:00:43
326500 -- [-480.755] (-483.755) (-482.552) (-479.442) * (-480.880) (-477.982) [-479.076] (-485.024) -- 0:00:43
327000 -- (-477.781) [-477.440] (-475.958) (-478.340) * (-476.903) [-478.458] (-478.037) (-478.239) -- 0:00:43
327500 -- (-478.544) (-477.104) (-478.954) [-478.520] * (-477.713) (-481.767) (-479.363) [-478.632] -- 0:00:43
328000 -- [-475.970] (-484.015) (-480.966) (-479.536) * (-477.462) (-479.369) (-477.473) [-477.259] -- 0:00:43
328500 -- (-475.574) (-477.778) [-477.158] (-477.315) * (-479.098) [-482.913] (-477.173) (-477.687) -- 0:00:42
329000 -- (-478.571) (-482.396) (-477.713) [-476.829] * (-480.676) (-478.875) [-475.394] (-478.953) -- 0:00:42
329500 -- (-476.764) (-479.344) [-476.670] (-480.573) * (-479.353) (-481.046) [-475.204] (-485.449) -- 0:00:42
330000 -- (-478.398) (-478.696) (-476.386) [-477.462] * [-476.989] (-480.294) (-476.770) (-480.082) -- 0:00:42
Average standard deviation of split frequencies: 0.013939
330500 -- [-477.151] (-480.144) (-480.433) (-476.022) * [-476.887] (-479.302) (-477.692) (-479.189) -- 0:00:42
331000 -- (-478.924) (-479.569) (-478.333) [-479.574] * [-479.455] (-480.261) (-476.069) (-480.720) -- 0:00:42
331500 -- (-478.852) (-477.623) [-482.584] (-478.548) * (-476.672) (-478.520) [-478.794] (-480.205) -- 0:00:42
332000 -- (-481.200) [-479.069] (-478.491) (-481.223) * [-477.274] (-476.053) (-478.980) (-477.177) -- 0:00:44
332500 -- (-477.792) (-477.010) (-480.649) [-478.001] * [-479.126] (-480.515) (-477.224) (-478.954) -- 0:00:44
333000 -- [-476.364] (-476.229) (-478.182) (-477.024) * (-476.042) (-480.753) (-478.075) [-480.000] -- 0:00:44
333500 -- (-475.380) [-477.559] (-478.769) (-476.028) * (-478.579) (-479.082) (-480.119) [-477.712] -- 0:00:43
334000 -- (-480.139) [-478.451] (-477.634) (-477.407) * [-477.802] (-478.691) (-482.073) (-480.486) -- 0:00:43
334500 -- (-476.473) (-479.015) [-478.671] (-478.171) * (-477.889) (-479.522) (-479.623) [-479.311] -- 0:00:43
335000 -- (-476.788) (-476.344) [-478.563] (-477.562) * (-478.425) (-479.995) [-478.255] (-478.736) -- 0:00:43
Average standard deviation of split frequencies: 0.013040
335500 -- (-477.080) [-476.937] (-480.067) (-477.404) * [-477.102] (-478.068) (-480.734) (-478.139) -- 0:00:43
336000 -- (-481.576) (-478.589) (-478.763) [-481.708] * (-476.770) (-479.042) (-476.959) [-479.282] -- 0:00:43
336500 -- [-478.045] (-479.893) (-480.382) (-477.712) * [-476.799] (-478.501) (-477.765) (-477.374) -- 0:00:43
337000 -- (-476.470) [-478.622] (-481.164) (-476.439) * (-480.110) [-478.258] (-478.525) (-478.245) -- 0:00:43
337500 -- (-478.242) (-478.105) [-476.860] (-477.672) * (-475.770) (-479.397) (-478.686) [-478.772] -- 0:00:43
338000 -- [-477.364] (-478.160) (-476.910) (-476.501) * (-476.785) (-478.618) [-478.167] (-480.050) -- 0:00:43
338500 -- (-478.788) (-481.706) (-482.234) [-475.662] * [-479.951] (-477.869) (-480.341) (-481.072) -- 0:00:42
339000 -- (-482.133) [-477.468] (-481.443) (-480.149) * (-477.672) [-479.093] (-478.988) (-477.615) -- 0:00:42
339500 -- (-476.477) [-476.850] (-477.001) (-480.720) * [-477.058] (-478.493) (-484.141) (-477.626) -- 0:00:42
340000 -- (-480.873) (-478.010) [-477.189] (-479.039) * [-476.993] (-479.131) (-480.687) (-475.867) -- 0:00:42
Average standard deviation of split frequencies: 0.012535
340500 -- [-479.117] (-480.164) (-478.346) (-478.067) * [-476.405] (-480.535) (-477.914) (-477.500) -- 0:00:42
341000 -- (-476.605) (-476.986) (-476.766) [-477.159] * (-479.723) (-478.635) [-476.824] (-476.381) -- 0:00:42
341500 -- (-477.280) [-478.026] (-477.976) (-475.128) * (-485.910) [-483.294] (-479.223) (-478.378) -- 0:00:42
342000 -- [-476.764] (-481.951) (-479.710) (-477.877) * (-478.256) (-482.607) (-478.037) [-479.342] -- 0:00:42
342500 -- [-479.039] (-478.310) (-480.282) (-478.839) * (-479.225) (-478.465) [-477.543] (-480.033) -- 0:00:42
343000 -- (-479.222) (-476.927) [-479.160] (-478.440) * (-477.615) [-477.393] (-478.575) (-483.406) -- 0:00:42
343500 -- (-479.896) (-477.230) [-478.618] (-478.359) * (-477.624) (-478.101) (-479.950) [-477.422] -- 0:00:42
344000 -- (-478.348) (-476.043) (-477.894) [-477.620] * (-477.541) (-479.141) (-477.911) [-476.592] -- 0:00:41
344500 -- (-478.923) (-479.276) [-479.590] (-478.664) * (-474.933) (-478.021) [-478.402] (-477.795) -- 0:00:41
345000 -- (-477.356) [-477.851] (-482.071) (-481.910) * (-479.250) (-481.728) (-481.025) [-478.923] -- 0:00:41
Average standard deviation of split frequencies: 0.011941
345500 -- (-481.139) (-477.435) [-475.818] (-479.267) * [-476.566] (-477.772) (-475.727) (-477.626) -- 0:00:41
346000 -- (-478.998) (-480.626) (-477.992) [-476.302] * (-476.630) [-477.596] (-483.201) (-478.650) -- 0:00:41
346500 -- (-477.784) (-479.477) [-478.032] (-481.318) * (-478.025) (-478.008) [-479.594] (-480.452) -- 0:00:41
347000 -- (-479.942) (-480.356) (-478.145) [-478.063] * (-478.367) (-479.279) [-482.675] (-477.220) -- 0:00:41
347500 -- (-479.016) [-479.242] (-478.585) (-478.282) * (-476.220) (-483.023) [-478.563] (-479.712) -- 0:00:41
348000 -- [-479.610] (-479.029) (-479.444) (-476.155) * (-479.592) (-483.853) [-475.464] (-477.243) -- 0:00:43
348500 -- (-478.856) (-480.809) (-478.719) [-479.673] * [-478.215] (-479.688) (-478.564) (-479.974) -- 0:00:42
349000 -- (-479.003) (-481.757) [-476.874] (-479.866) * (-478.190) [-478.521] (-476.485) (-475.012) -- 0:00:42
349500 -- (-477.324) [-475.310] (-478.044) (-482.045) * (-477.814) (-478.799) (-478.574) [-478.575] -- 0:00:42
350000 -- (-478.340) [-477.038] (-477.067) (-479.294) * (-481.065) [-479.597] (-476.724) (-477.518) -- 0:00:42
Average standard deviation of split frequencies: 0.010596
350500 -- (-477.143) (-477.726) (-479.175) [-479.102] * (-478.311) [-479.852] (-477.201) (-478.010) -- 0:00:42
351000 -- [-475.756] (-476.945) (-482.159) (-478.783) * (-476.774) (-484.177) (-480.914) [-480.636] -- 0:00:42
351500 -- [-478.400] (-477.916) (-477.118) (-478.871) * (-479.247) [-477.777] (-477.670) (-478.904) -- 0:00:42
352000 -- [-479.716] (-479.372) (-479.764) (-481.362) * (-477.217) [-477.178] (-477.651) (-477.692) -- 0:00:42
352500 -- (-480.069) [-479.389] (-480.330) (-480.308) * (-479.845) (-478.686) (-476.421) [-476.681] -- 0:00:42
353000 -- [-479.816] (-479.640) (-478.162) (-482.630) * (-479.766) (-477.894) (-478.210) [-476.277] -- 0:00:42
353500 -- (-479.215) (-475.821) (-478.322) [-479.491] * (-478.265) [-480.904] (-475.593) (-478.150) -- 0:00:42
354000 -- (-476.683) (-477.024) [-476.746] (-479.858) * (-476.314) (-477.632) [-478.969] (-480.728) -- 0:00:41
354500 -- (-479.790) (-474.685) [-476.407] (-479.728) * [-480.116] (-482.063) (-478.059) (-477.839) -- 0:00:41
355000 -- (-481.231) (-478.948) [-486.925] (-479.397) * [-479.907] (-479.642) (-475.402) (-479.238) -- 0:00:41
Average standard deviation of split frequencies: 0.011995
355500 -- (-483.213) (-479.036) [-476.199] (-476.574) * (-477.841) (-480.648) [-475.510] (-480.920) -- 0:00:41
356000 -- [-477.747] (-479.916) (-477.876) (-477.566) * (-478.433) (-481.138) (-476.365) [-476.589] -- 0:00:41
356500 -- [-478.610] (-476.227) (-478.850) (-478.933) * (-479.269) (-480.745) [-480.356] (-480.158) -- 0:00:41
357000 -- (-478.852) [-479.039] (-479.454) (-478.276) * (-479.464) (-477.610) [-475.939] (-480.429) -- 0:00:41
357500 -- [-479.491] (-480.104) (-477.691) (-481.251) * (-479.093) [-478.924] (-477.199) (-482.155) -- 0:00:41
358000 -- (-479.097) [-482.609] (-479.131) (-478.177) * (-480.820) [-478.322] (-476.894) (-484.721) -- 0:00:41
358500 -- [-481.281] (-480.393) (-480.419) (-477.241) * [-478.702] (-479.852) (-478.661) (-481.198) -- 0:00:41
359000 -- (-481.082) (-478.900) [-477.705] (-478.673) * [-480.532] (-477.275) (-476.520) (-485.053) -- 0:00:41
359500 -- (-480.025) (-478.666) [-480.505] (-478.927) * (-477.776) [-476.750] (-478.220) (-485.606) -- 0:00:40
360000 -- (-478.686) (-479.012) [-477.579] (-478.580) * (-480.004) (-478.326) [-475.486] (-479.480) -- 0:00:40
Average standard deviation of split frequencies: 0.012071
360500 -- (-486.809) [-476.931] (-477.377) (-478.976) * (-479.360) [-483.598] (-476.579) (-476.935) -- 0:00:40
361000 -- (-481.831) (-483.728) [-482.704] (-480.655) * (-481.211) (-477.971) (-476.069) [-478.232] -- 0:00:40
361500 -- [-476.217] (-480.335) (-480.466) (-481.108) * (-479.341) (-479.757) (-478.796) [-478.370] -- 0:00:40
362000 -- (-477.163) (-480.817) (-478.794) [-478.380] * (-478.137) [-479.492] (-477.007) (-475.670) -- 0:00:40
362500 -- (-478.096) (-484.002) (-477.887) [-479.166] * [-479.981] (-481.172) (-477.027) (-481.908) -- 0:00:40
363000 -- (-479.636) [-476.580] (-481.020) (-482.170) * (-481.744) (-478.654) [-478.976] (-476.665) -- 0:00:40
363500 -- (-478.568) [-477.539] (-477.944) (-481.396) * (-478.933) [-479.385] (-476.295) (-482.981) -- 0:00:40
364000 -- [-478.124] (-478.860) (-479.130) (-478.769) * (-479.430) (-478.645) [-477.218] (-485.728) -- 0:00:41
364500 -- (-476.295) [-476.876] (-481.968) (-478.462) * (-479.986) [-481.120] (-482.328) (-478.200) -- 0:00:41
365000 -- [-479.663] (-478.944) (-478.651) (-481.024) * (-480.689) (-479.760) [-476.513] (-476.981) -- 0:00:41
Average standard deviation of split frequencies: 0.011520
365500 -- (-476.531) (-478.297) (-477.645) [-478.996] * [-479.008] (-476.531) (-478.775) (-477.736) -- 0:00:41
366000 -- (-480.696) (-476.840) [-477.353] (-480.617) * (-476.511) [-476.341] (-478.104) (-477.206) -- 0:00:41
366500 -- (-477.597) (-476.162) [-478.144] (-478.574) * (-478.246) (-479.015) (-476.289) [-476.795] -- 0:00:41
367000 -- (-478.642) (-475.906) (-475.458) [-475.480] * (-481.275) [-480.890] (-479.078) (-475.259) -- 0:00:41
367500 -- (-476.338) (-480.947) (-479.052) [-481.476] * [-480.933] (-485.455) (-478.573) (-477.121) -- 0:00:41
368000 -- [-475.730] (-476.024) (-482.234) (-477.445) * (-480.128) (-480.720) (-478.873) [-478.069] -- 0:00:41
368500 -- (-480.649) (-476.275) (-478.262) [-475.238] * (-481.948) (-483.597) [-478.861] (-477.454) -- 0:00:41
369000 -- (-486.371) (-479.327) (-478.785) [-477.957] * (-476.919) (-478.714) (-477.458) [-478.003] -- 0:00:41
369500 -- (-482.419) (-477.344) (-476.777) [-477.296] * [-478.340] (-480.125) (-481.927) (-481.353) -- 0:00:40
370000 -- (-478.369) (-476.328) (-477.943) [-477.929] * (-479.022) [-478.494] (-479.814) (-475.288) -- 0:00:40
Average standard deviation of split frequencies: 0.011371
370500 -- (-478.697) (-475.484) [-480.074] (-478.556) * [-484.144] (-479.530) (-483.135) (-478.186) -- 0:00:40
371000 -- (-477.993) [-478.029] (-478.479) (-478.213) * (-482.095) (-480.786) (-478.694) [-475.077] -- 0:00:40
371500 -- (-475.645) (-477.295) (-477.657) [-475.976] * [-480.195] (-481.318) (-477.355) (-475.596) -- 0:00:40
372000 -- (-481.944) [-478.216] (-484.290) (-475.529) * (-486.125) (-481.784) (-475.100) [-477.166] -- 0:00:40
372500 -- (-477.034) [-477.174] (-477.353) (-476.149) * [-482.577] (-480.431) (-476.132) (-477.693) -- 0:00:40
373000 -- (-476.145) (-479.531) [-481.194] (-476.405) * (-482.927) (-477.515) [-478.070] (-481.950) -- 0:00:40
373500 -- (-478.442) [-476.891] (-478.476) (-478.316) * (-482.251) (-477.506) (-481.155) [-478.097] -- 0:00:40
374000 -- (-477.355) (-477.823) (-477.327) [-475.993] * (-481.329) (-481.709) [-478.564] (-476.009) -- 0:00:40
374500 -- (-476.179) (-475.840) [-476.713] (-478.516) * (-479.351) [-476.980] (-479.814) (-476.922) -- 0:00:40
375000 -- (-478.367) [-475.878] (-477.879) (-475.672) * (-478.509) (-479.302) [-480.364] (-476.724) -- 0:00:40
Average standard deviation of split frequencies: 0.010472
375500 -- (-478.191) [-475.158] (-479.744) (-480.004) * (-480.394) (-476.016) [-475.503] (-484.302) -- 0:00:39
376000 -- (-477.110) (-477.906) (-482.202) [-476.515] * (-482.461) (-478.188) (-478.854) [-481.034] -- 0:00:39
376500 -- (-478.176) (-480.583) [-477.244] (-477.831) * [-479.383] (-480.865) (-482.203) (-477.884) -- 0:00:39
377000 -- [-477.344] (-476.909) (-477.753) (-479.970) * (-477.977) (-478.809) (-480.441) [-476.362] -- 0:00:39
377500 -- (-477.075) (-476.191) (-475.549) [-477.367] * (-477.667) (-479.643) (-478.510) [-479.410] -- 0:00:39
378000 -- (-480.527) [-476.918] (-478.375) (-476.914) * (-480.017) (-479.938) (-477.400) [-478.182] -- 0:00:39
378500 -- (-477.886) (-476.261) [-481.083] (-476.270) * (-484.873) (-479.955) [-477.189] (-482.960) -- 0:00:39
379000 -- [-479.862] (-477.802) (-478.172) (-477.540) * (-479.628) [-480.929] (-478.509) (-480.705) -- 0:00:39
379500 -- (-479.447) [-476.078] (-475.543) (-478.236) * [-480.890] (-478.984) (-477.978) (-479.784) -- 0:00:39
380000 -- (-480.032) (-477.919) (-477.547) [-479.279] * (-479.047) (-476.502) [-476.468] (-482.266) -- 0:00:40
Average standard deviation of split frequencies: 0.009033
380500 -- [-478.720] (-477.413) (-481.491) (-477.719) * (-479.264) (-477.291) (-477.143) [-478.532] -- 0:00:40
381000 -- [-476.216] (-481.342) (-475.711) (-476.349) * (-477.128) (-477.773) [-477.898] (-478.313) -- 0:00:40
381500 -- (-483.513) (-477.496) [-476.528] (-478.713) * [-480.136] (-483.251) (-478.208) (-479.033) -- 0:00:40
382000 -- (-478.176) [-478.073] (-477.625) (-475.929) * (-478.613) [-479.687] (-485.286) (-477.930) -- 0:00:40
382500 -- (-477.759) [-479.474] (-476.059) (-481.150) * [-478.164] (-480.770) (-478.850) (-478.679) -- 0:00:40
383000 -- [-477.772] (-478.488) (-475.123) (-482.985) * (-479.570) [-477.966] (-480.367) (-483.367) -- 0:00:40
383500 -- (-476.870) (-475.944) (-480.234) [-479.309] * (-480.446) [-477.556] (-478.218) (-480.619) -- 0:00:40
384000 -- (-479.561) [-478.046] (-477.237) (-476.900) * (-482.592) (-478.233) [-478.388] (-478.276) -- 0:00:40
384500 -- [-476.283] (-478.435) (-477.559) (-476.581) * (-480.399) (-479.254) (-477.839) [-479.801] -- 0:00:40
385000 -- (-477.037) (-476.948) (-478.809) [-478.087] * (-478.107) (-479.915) (-477.544) [-476.531] -- 0:00:39
Average standard deviation of split frequencies: 0.008764
385500 -- (-477.522) [-476.991] (-476.554) (-476.137) * (-480.396) (-478.314) [-477.296] (-478.731) -- 0:00:39
386000 -- (-478.476) (-481.351) (-480.062) [-478.738] * (-482.715) (-481.357) [-475.498] (-479.932) -- 0:00:39
386500 -- [-476.685] (-475.600) (-481.311) (-479.458) * (-478.623) [-481.484] (-476.510) (-479.878) -- 0:00:39
387000 -- [-479.143] (-476.727) (-476.063) (-484.047) * (-478.399) (-476.011) [-478.274] (-477.929) -- 0:00:39
387500 -- (-481.397) [-477.565] (-477.462) (-477.603) * [-476.234] (-478.817) (-481.512) (-479.876) -- 0:00:39
388000 -- (-478.330) [-478.860] (-477.101) (-475.743) * [-476.702] (-477.374) (-477.668) (-479.772) -- 0:00:39
388500 -- (-479.138) [-479.890] (-477.805) (-478.935) * (-479.094) (-478.326) (-480.171) [-478.259] -- 0:00:39
389000 -- (-478.044) (-476.992) (-479.192) [-477.622] * (-477.022) (-478.888) (-482.475) [-478.135] -- 0:00:39
389500 -- (-482.234) (-478.509) [-478.809] (-481.775) * [-479.132] (-479.313) (-483.880) (-476.689) -- 0:00:39
390000 -- (-480.376) (-479.037) [-476.401] (-478.620) * (-475.914) [-479.227] (-481.586) (-481.580) -- 0:00:39
Average standard deviation of split frequencies: 0.008660
390500 -- [-476.968] (-477.743) (-480.236) (-478.654) * (-477.592) (-479.357) (-481.940) [-480.349] -- 0:00:39
391000 -- [-475.930] (-475.540) (-476.279) (-479.514) * (-477.996) (-482.104) (-477.795) [-478.373] -- 0:00:38
391500 -- [-475.579] (-478.638) (-475.692) (-478.092) * (-477.890) (-481.567) (-480.765) [-478.718] -- 0:00:38
392000 -- (-476.337) [-479.959] (-480.147) (-476.971) * [-476.855] (-479.461) (-484.134) (-476.163) -- 0:00:38
392500 -- (-475.027) [-476.558] (-477.834) (-479.244) * (-476.625) (-478.123) (-479.375) [-477.972] -- 0:00:38
393000 -- (-477.769) [-476.992] (-478.871) (-479.153) * (-478.851) (-480.560) (-479.286) [-478.164] -- 0:00:38
393500 -- (-477.093) (-480.713) [-475.670] (-479.395) * (-481.427) (-479.993) [-477.578] (-476.826) -- 0:00:38
394000 -- (-479.233) (-479.071) [-476.488] (-477.967) * (-479.941) (-476.968) [-476.383] (-479.962) -- 0:00:38
394500 -- (-479.825) [-476.869] (-482.657) (-478.984) * (-480.677) [-476.153] (-476.873) (-477.186) -- 0:00:38
395000 -- (-479.372) (-480.212) (-479.064) [-476.694] * (-477.359) (-479.469) (-475.439) [-479.892] -- 0:00:38
Average standard deviation of split frequencies: 0.008779
395500 -- (-478.091) (-480.472) (-475.337) [-478.159] * (-477.948) (-483.822) (-476.453) [-477.113] -- 0:00:39
396000 -- (-479.892) (-477.091) (-480.349) [-479.332] * [-476.046] (-487.241) (-479.157) (-477.003) -- 0:00:39
396500 -- (-479.383) (-479.276) (-484.840) [-478.995] * [-476.214] (-479.869) (-480.511) (-476.383) -- 0:00:39
397000 -- [-478.527] (-482.336) (-477.425) (-477.154) * (-480.038) (-477.468) [-477.464] (-480.227) -- 0:00:39
397500 -- (-477.122) (-480.302) [-477.973] (-482.090) * (-478.446) (-478.810) [-477.810] (-479.972) -- 0:00:39
398000 -- (-479.307) (-480.350) (-477.703) [-480.701] * (-478.938) [-479.341] (-477.305) (-477.153) -- 0:00:39
398500 -- (-480.057) (-479.562) (-478.204) [-478.948] * (-477.877) (-479.129) (-476.597) [-478.690] -- 0:00:39
399000 -- (-480.904) (-479.206) [-481.296] (-478.763) * (-476.584) [-480.405] (-478.677) (-484.127) -- 0:00:39
399500 -- [-478.216] (-479.587) (-478.590) (-482.577) * (-476.303) (-479.852) [-478.631] (-480.613) -- 0:00:39
400000 -- [-476.634] (-478.815) (-478.958) (-478.534) * (-476.082) (-478.610) [-479.646] (-480.182) -- 0:00:39
Average standard deviation of split frequencies: 0.007868
400500 -- [-477.779] (-477.454) (-479.872) (-475.887) * (-482.262) [-476.851] (-476.808) (-481.246) -- 0:00:38
401000 -- (-478.773) (-478.420) [-477.590] (-478.539) * (-479.076) [-477.541] (-476.768) (-478.155) -- 0:00:38
401500 -- (-479.340) [-477.090] (-478.645) (-475.241) * [-478.271] (-476.773) (-477.468) (-480.166) -- 0:00:38
402000 -- (-477.173) (-476.435) [-478.266] (-474.673) * (-476.980) [-476.129] (-478.479) (-480.650) -- 0:00:38
402500 -- (-476.624) (-484.194) (-476.905) [-477.117] * (-478.550) (-477.554) [-476.552] (-479.041) -- 0:00:38
403000 -- (-477.599) (-480.041) (-476.394) [-476.557] * [-477.588] (-477.274) (-478.172) (-478.998) -- 0:00:38
403500 -- (-481.354) [-476.787] (-478.086) (-482.745) * (-477.502) (-479.730) [-477.039] (-477.693) -- 0:00:38
404000 -- (-478.688) (-476.388) [-476.140] (-478.328) * (-478.325) [-476.911] (-486.594) (-479.486) -- 0:00:38
404500 -- (-477.329) [-479.739] (-478.011) (-476.414) * (-479.427) (-479.016) (-477.611) [-479.275] -- 0:00:38
405000 -- (-477.661) (-480.252) [-476.013] (-478.094) * [-478.978] (-474.905) (-479.783) (-481.349) -- 0:00:38
Average standard deviation of split frequencies: 0.008563
405500 -- (-477.396) (-481.180) [-478.304] (-477.472) * [-479.709] (-476.162) (-478.551) (-483.850) -- 0:00:38
406000 -- (-478.519) [-476.295] (-478.135) (-478.756) * (-480.575) (-479.227) [-476.673] (-483.095) -- 0:00:38
406500 -- (-481.685) [-478.083] (-480.692) (-479.023) * (-479.949) [-478.627] (-478.810) (-478.548) -- 0:00:37
407000 -- (-480.544) (-476.089) (-479.114) [-477.341] * (-478.921) [-480.202] (-474.726) (-476.685) -- 0:00:37
407500 -- (-480.272) (-478.735) [-479.001] (-478.555) * [-479.609] (-476.704) (-475.596) (-478.706) -- 0:00:37
408000 -- (-479.065) (-479.589) (-480.482) [-478.518] * (-481.402) (-479.116) [-475.854] (-479.807) -- 0:00:37
408500 -- (-478.365) [-478.904] (-479.896) (-477.421) * (-479.301) (-477.626) [-482.028] (-480.041) -- 0:00:37
409000 -- (-476.481) (-478.819) (-475.681) [-480.753] * (-482.365) (-476.021) (-479.870) [-478.277] -- 0:00:37
409500 -- (-475.828) [-479.488] (-477.855) (-478.973) * (-478.691) (-476.775) (-478.856) [-479.245] -- 0:00:37
410000 -- (-479.655) [-477.604] (-478.471) (-475.071) * (-480.372) (-478.394) (-478.339) [-479.056] -- 0:00:37
Average standard deviation of split frequencies: 0.009386
410500 -- (-478.953) (-480.646) [-477.519] (-478.027) * (-477.548) [-479.171] (-480.359) (-478.236) -- 0:00:37
411000 -- (-476.100) (-481.175) [-478.415] (-479.928) * [-480.080] (-479.700) (-477.523) (-477.973) -- 0:00:37
411500 -- (-477.025) [-478.413] (-475.837) (-476.575) * (-482.085) (-479.494) [-476.470] (-475.932) -- 0:00:38
412000 -- (-478.069) (-477.562) [-474.782] (-476.947) * (-478.160) [-478.904] (-478.268) (-477.622) -- 0:00:38
412500 -- (-476.662) (-480.711) [-475.108] (-477.648) * (-479.447) (-482.198) (-481.452) [-479.111] -- 0:00:38
413000 -- (-477.695) (-480.684) (-475.860) [-477.934] * (-476.961) (-477.948) [-477.908] (-479.954) -- 0:00:38
413500 -- (-477.496) (-479.550) (-475.483) [-477.761] * (-476.177) (-480.716) [-478.101] (-483.364) -- 0:00:38
414000 -- (-478.376) (-479.153) (-479.051) [-476.294] * (-478.589) [-478.175] (-477.019) (-480.181) -- 0:00:38
414500 -- (-477.706) (-481.771) (-478.991) [-478.173] * (-478.563) (-481.987) (-474.959) [-476.118] -- 0:00:38
415000 -- (-478.665) [-479.842] (-477.946) (-479.131) * (-481.253) [-481.076] (-478.390) (-477.735) -- 0:00:38
Average standard deviation of split frequencies: 0.009065
415500 -- (-478.099) (-478.252) (-482.072) [-477.930] * [-479.131] (-476.679) (-480.734) (-478.528) -- 0:00:37
416000 -- [-477.850] (-478.566) (-480.502) (-481.457) * (-476.771) [-477.090] (-479.048) (-475.132) -- 0:00:37
416500 -- (-476.435) (-478.597) [-477.210] (-481.874) * (-479.838) (-479.166) [-480.552] (-476.231) -- 0:00:37
417000 -- (-477.059) [-480.767] (-475.325) (-478.502) * (-480.369) (-478.302) [-476.354] (-480.538) -- 0:00:37
417500 -- (-478.095) (-476.805) (-476.377) [-476.318] * (-479.278) [-475.693] (-479.372) (-479.025) -- 0:00:37
418000 -- [-478.978] (-478.210) (-477.006) (-481.408) * (-477.169) (-480.160) (-481.436) [-479.934] -- 0:00:37
418500 -- (-479.613) (-483.399) (-476.752) [-480.956] * (-478.055) [-477.723] (-478.500) (-479.793) -- 0:00:37
419000 -- (-478.276) (-484.119) (-481.262) [-481.227] * [-478.134] (-477.691) (-479.197) (-482.436) -- 0:00:37
419500 -- (-476.079) (-479.057) (-478.602) [-476.157] * (-479.343) [-478.434] (-481.359) (-478.417) -- 0:00:37
420000 -- (-478.399) (-479.990) (-478.177) [-476.320] * (-476.690) (-482.655) (-478.071) [-477.530] -- 0:00:37
Average standard deviation of split frequencies: 0.008475
420500 -- [-477.423] (-479.777) (-476.193) (-478.754) * [-478.082] (-482.970) (-477.423) (-478.657) -- 0:00:37
421000 -- (-478.983) [-478.503] (-479.124) (-478.255) * (-477.364) [-478.536] (-478.233) (-480.504) -- 0:00:37
421500 -- (-477.086) [-478.775] (-479.976) (-478.680) * [-480.934] (-479.503) (-479.722) (-478.681) -- 0:00:37
422000 -- (-476.803) (-479.319) (-481.984) [-478.730] * [-475.926] (-482.894) (-478.971) (-479.246) -- 0:00:36
422500 -- (-480.114) (-477.364) (-482.666) [-482.043] * (-480.795) (-482.455) (-478.249) [-477.299] -- 0:00:36
423000 -- [-478.645] (-479.967) (-477.662) (-477.851) * [-478.530] (-479.359) (-477.909) (-481.754) -- 0:00:36
423500 -- [-477.342] (-480.477) (-478.013) (-480.165) * (-478.341) (-480.236) (-476.389) [-478.169] -- 0:00:36
424000 -- (-476.838) (-480.730) (-482.955) [-478.020] * (-480.781) (-481.076) [-477.390] (-482.218) -- 0:00:36
424500 -- [-477.096] (-478.382) (-480.772) (-479.149) * (-477.884) (-480.312) (-480.632) [-478.510] -- 0:00:36
425000 -- [-478.862] (-481.763) (-479.697) (-478.152) * (-478.734) [-480.179] (-477.427) (-481.189) -- 0:00:36
Average standard deviation of split frequencies: 0.008507
425500 -- (-482.085) (-476.706) (-479.925) [-481.740] * [-479.526] (-483.353) (-478.806) (-477.366) -- 0:00:36
426000 -- (-481.044) (-479.307) [-478.837] (-481.982) * (-476.983) [-481.837] (-477.025) (-478.326) -- 0:00:36
426500 -- (-484.484) [-476.544] (-480.168) (-479.853) * (-478.605) [-481.918] (-478.397) (-478.247) -- 0:00:36
427000 -- (-481.086) (-484.096) (-478.014) [-478.028] * (-477.971) (-479.283) [-476.328] (-478.699) -- 0:00:36
427500 -- (-478.191) [-477.729] (-479.590) (-476.152) * (-477.672) (-478.179) (-479.025) [-478.447] -- 0:00:37
428000 -- (-478.703) (-475.929) (-478.761) [-480.794] * [-478.328] (-478.221) (-476.384) (-478.090) -- 0:00:37
428500 -- [-476.680] (-483.176) (-478.681) (-478.556) * (-478.841) [-477.464] (-479.923) (-478.407) -- 0:00:37
429000 -- [-477.020] (-477.626) (-479.115) (-478.269) * (-479.763) (-480.759) [-477.546] (-476.603) -- 0:00:37
429500 -- (-480.958) (-480.602) [-478.185] (-478.775) * [-482.144] (-479.711) (-477.949) (-478.489) -- 0:00:37
430000 -- (-480.835) (-478.122) (-478.963) [-478.877] * (-482.982) (-477.743) [-476.113] (-480.550) -- 0:00:37
Average standard deviation of split frequencies: 0.009236
430500 -- (-478.407) (-477.717) [-478.803] (-478.703) * (-476.488) [-477.503] (-477.408) (-476.647) -- 0:00:37
431000 -- (-476.201) (-478.770) [-476.117] (-478.431) * [-479.783] (-477.942) (-487.164) (-479.978) -- 0:00:36
431500 -- [-478.875] (-477.813) (-476.973) (-479.280) * (-478.015) [-476.263] (-482.197) (-476.248) -- 0:00:36
432000 -- (-476.603) (-475.435) (-482.054) [-479.474] * (-481.161) (-479.876) [-477.850] (-477.634) -- 0:00:36
432500 -- [-478.193] (-476.980) (-480.596) (-478.836) * (-479.324) (-480.388) (-479.574) [-476.968] -- 0:00:36
433000 -- (-477.825) (-479.803) [-477.650] (-479.026) * (-478.118) (-478.153) [-476.979] (-484.923) -- 0:00:36
433500 -- [-474.922] (-481.187) (-476.918) (-477.999) * [-478.289] (-477.722) (-482.600) (-482.107) -- 0:00:36
434000 -- [-477.658] (-484.882) (-475.663) (-478.107) * (-478.373) (-481.297) (-479.048) [-478.340] -- 0:00:36
434500 -- (-479.044) [-481.093] (-477.615) (-479.233) * (-482.611) (-480.824) [-477.919] (-480.565) -- 0:00:36
435000 -- (-478.715) [-476.728] (-480.077) (-480.517) * (-479.957) (-482.133) (-477.481) [-479.720] -- 0:00:36
Average standard deviation of split frequencies: 0.010069
435500 -- (-478.014) [-477.555] (-476.803) (-482.081) * [-477.514] (-480.857) (-478.432) (-478.429) -- 0:00:36
436000 -- (-478.959) (-478.264) [-477.482] (-479.092) * [-480.315] (-479.756) (-479.416) (-479.853) -- 0:00:36
436500 -- (-476.240) [-477.867] (-477.456) (-479.111) * (-478.037) (-480.564) [-478.409] (-478.014) -- 0:00:36
437000 -- (-481.231) (-475.972) (-477.411) [-478.492] * (-484.845) (-480.466) (-477.608) [-479.031] -- 0:00:36
437500 -- (-481.176) (-477.351) (-477.752) [-479.037] * (-481.966) (-479.367) (-477.743) [-478.974] -- 0:00:36
438000 -- [-479.186] (-477.107) (-477.103) (-481.997) * [-479.671] (-478.471) (-478.529) (-479.172) -- 0:00:35
438500 -- (-477.208) [-477.508] (-476.994) (-480.672) * (-479.517) (-478.408) [-479.045] (-478.738) -- 0:00:35
439000 -- (-478.609) (-475.984) [-478.653] (-479.323) * (-478.326) (-478.170) (-475.757) [-479.730] -- 0:00:35
439500 -- (-479.361) (-475.580) (-478.419) [-477.792] * [-478.466] (-479.572) (-477.985) (-479.968) -- 0:00:35
440000 -- [-476.449] (-479.244) (-477.701) (-477.637) * [-478.958] (-479.844) (-480.096) (-481.830) -- 0:00:35
Average standard deviation of split frequencies: 0.009360
440500 -- (-477.384) (-478.934) [-474.729] (-477.973) * (-479.840) [-477.913] (-476.841) (-483.044) -- 0:00:35
441000 -- (-477.478) (-478.949) (-475.943) [-477.074] * (-477.571) (-483.321) [-475.850] (-481.504) -- 0:00:35
441500 -- [-479.155] (-479.303) (-479.250) (-480.455) * (-482.459) (-479.501) [-477.655] (-480.543) -- 0:00:35
442000 -- (-479.861) (-479.265) (-481.174) [-478.455] * (-481.135) (-478.630) [-477.305] (-479.834) -- 0:00:35
442500 -- (-477.265) (-479.160) [-475.801] (-480.399) * (-478.550) (-479.700) (-479.335) [-476.926] -- 0:00:35
443000 -- (-477.693) [-475.244] (-476.651) (-478.539) * [-478.290] (-480.866) (-478.117) (-480.523) -- 0:00:36
443500 -- (-477.404) (-478.526) [-484.868] (-480.039) * [-479.161] (-479.498) (-476.502) (-477.612) -- 0:00:36
444000 -- (-478.368) [-477.313] (-487.147) (-479.083) * (-482.067) [-480.395] (-477.798) (-478.568) -- 0:00:36
444500 -- (-477.889) [-477.007] (-478.630) (-479.483) * (-478.855) [-480.397] (-479.531) (-478.432) -- 0:00:36
445000 -- (-479.704) (-478.994) [-479.714] (-483.175) * [-478.067] (-480.066) (-478.362) (-476.840) -- 0:00:36
Average standard deviation of split frequencies: 0.009182
445500 -- (-481.570) [-476.414] (-479.262) (-480.791) * (-477.583) (-480.645) (-478.894) [-476.778] -- 0:00:36
446000 -- [-475.992] (-478.176) (-478.299) (-477.734) * (-479.376) (-478.008) (-479.116) [-480.450] -- 0:00:36
446500 -- (-477.507) (-477.430) [-479.536] (-477.441) * (-480.319) [-478.174] (-478.818) (-478.038) -- 0:00:35
447000 -- (-476.503) (-477.289) [-479.281] (-479.993) * [-477.646] (-482.946) (-479.687) (-478.472) -- 0:00:35
447500 -- [-479.055] (-480.508) (-478.545) (-477.508) * [-477.108] (-482.235) (-483.901) (-481.357) -- 0:00:35
448000 -- (-478.615) [-477.073] (-482.587) (-474.952) * (-477.857) [-479.164] (-479.285) (-478.706) -- 0:00:35
448500 -- (-476.647) (-477.058) (-479.118) [-477.490] * (-481.231) (-479.097) [-480.186] (-480.099) -- 0:00:35
449000 -- (-479.783) (-478.646) [-475.877] (-477.416) * (-476.171) [-479.576] (-480.361) (-483.520) -- 0:00:35
449500 -- [-478.229] (-476.647) (-475.313) (-479.379) * (-475.073) (-487.915) [-481.551] (-480.354) -- 0:00:35
450000 -- [-479.142] (-476.255) (-476.049) (-477.764) * (-476.362) [-477.651] (-481.224) (-479.275) -- 0:00:35
Average standard deviation of split frequencies: 0.009205
450500 -- (-477.705) [-475.679] (-476.306) (-475.720) * [-476.450] (-477.279) (-479.162) (-479.941) -- 0:00:35
451000 -- (-480.060) (-480.693) [-478.206] (-479.260) * [-477.770] (-476.797) (-476.541) (-481.117) -- 0:00:35
451500 -- (-478.594) (-480.046) (-477.701) [-477.549] * (-475.732) (-477.559) [-477.425] (-476.664) -- 0:00:35
452000 -- [-475.848] (-479.718) (-480.412) (-475.441) * [-477.565] (-478.167) (-478.136) (-480.616) -- 0:00:35
452500 -- (-479.892) (-479.350) (-481.022) [-477.190] * [-476.864] (-479.068) (-478.173) (-478.018) -- 0:00:35
453000 -- [-476.936] (-479.391) (-477.719) (-477.863) * (-478.343) (-476.620) (-481.929) [-479.049] -- 0:00:35
453500 -- [-476.216] (-476.465) (-479.690) (-476.742) * (-477.055) (-476.703) [-480.628] (-480.809) -- 0:00:34
454000 -- (-478.322) [-477.391] (-479.273) (-479.021) * (-475.880) (-478.016) [-477.668] (-477.005) -- 0:00:34
454500 -- (-479.001) (-479.087) (-481.300) [-478.838] * (-478.479) (-477.896) [-478.636] (-479.027) -- 0:00:34
455000 -- [-476.570] (-476.823) (-479.514) (-479.959) * (-477.924) (-478.809) [-475.398] (-476.546) -- 0:00:34
Average standard deviation of split frequencies: 0.008822
455500 -- [-479.999] (-476.560) (-478.990) (-480.039) * (-478.594) [-479.205] (-478.965) (-476.340) -- 0:00:34
456000 -- (-482.865) (-480.336) (-477.458) [-479.945] * (-477.533) (-478.205) (-477.313) [-474.751] -- 0:00:34
456500 -- (-475.750) (-477.531) [-480.611] (-478.519) * (-475.198) (-483.034) (-477.372) [-474.659] -- 0:00:34
457000 -- (-477.440) [-479.745] (-480.373) (-477.481) * (-473.899) (-477.768) (-477.499) [-476.301] -- 0:00:34
457500 -- (-481.225) (-478.946) [-479.913] (-477.679) * [-477.367] (-478.461) (-480.479) (-479.132) -- 0:00:34
458000 -- (-478.671) (-478.974) (-477.343) [-477.160] * (-480.985) (-480.572) (-478.841) [-477.108] -- 0:00:34
458500 -- (-477.189) (-478.984) [-480.412] (-479.794) * (-478.214) [-480.073] (-481.467) (-477.332) -- 0:00:34
459000 -- (-482.508) [-480.230] (-483.166) (-475.672) * (-480.427) (-479.361) [-475.941] (-476.350) -- 0:00:35
459500 -- (-481.401) (-480.138) [-480.820] (-477.468) * (-480.598) (-482.373) [-475.334] (-476.528) -- 0:00:35
460000 -- [-478.466] (-480.046) (-480.922) (-476.571) * (-482.677) (-479.735) (-477.289) [-478.229] -- 0:00:35
Average standard deviation of split frequencies: 0.009346
460500 -- (-479.495) [-476.172] (-480.546) (-478.446) * [-477.276] (-479.051) (-480.169) (-478.085) -- 0:00:35
461000 -- [-476.615] (-478.522) (-478.522) (-479.194) * (-481.406) (-480.079) (-481.753) [-476.422] -- 0:00:35
461500 -- (-480.724) (-478.368) (-476.789) [-476.797] * (-485.297) (-480.675) (-478.876) [-479.433] -- 0:00:35
462000 -- (-480.355) (-477.413) (-477.082) [-477.115] * (-481.496) (-478.675) [-476.144] (-477.069) -- 0:00:34
462500 -- (-480.186) (-479.343) (-486.333) [-477.543] * [-475.229] (-479.664) (-476.085) (-480.033) -- 0:00:34
463000 -- [-477.652] (-479.985) (-480.359) (-476.899) * [-477.662] (-479.675) (-477.010) (-479.654) -- 0:00:34
463500 -- (-477.983) (-478.295) (-484.021) [-477.755] * (-477.014) [-477.712] (-477.313) (-480.815) -- 0:00:34
464000 -- (-480.415) (-478.296) [-474.529] (-477.238) * [-478.989] (-481.721) (-480.338) (-481.608) -- 0:00:34
464500 -- (-479.470) (-476.135) (-479.832) [-481.290] * (-475.811) (-483.698) [-482.262] (-481.118) -- 0:00:34
465000 -- (-478.166) [-477.904] (-483.355) (-476.472) * (-475.917) [-478.375] (-482.706) (-478.567) -- 0:00:34
Average standard deviation of split frequencies: 0.009878
465500 -- (-478.512) (-477.571) [-479.532] (-477.190) * [-478.007] (-478.696) (-479.131) (-475.421) -- 0:00:34
466000 -- (-476.555) (-479.598) (-479.775) [-478.151] * (-479.297) [-480.857] (-474.908) (-476.618) -- 0:00:34
466500 -- (-478.246) [-476.947] (-479.732) (-477.395) * (-476.454) (-479.084) [-476.220] (-475.135) -- 0:00:34
467000 -- (-477.070) (-476.657) (-482.546) [-475.752] * (-478.561) (-480.044) (-485.059) [-476.898] -- 0:00:34
467500 -- (-476.339) [-476.398] (-478.586) (-478.635) * (-478.971) [-478.347] (-477.539) (-474.894) -- 0:00:34
468000 -- (-476.966) (-478.263) [-481.205] (-477.261) * (-480.044) (-478.829) (-480.005) [-478.533] -- 0:00:34
468500 -- (-476.561) (-477.447) [-479.866] (-477.989) * [-478.237] (-478.431) (-478.516) (-479.977) -- 0:00:34
469000 -- [-476.306] (-477.630) (-478.832) (-477.793) * (-477.329) (-475.623) [-476.526] (-480.846) -- 0:00:33
469500 -- [-479.744] (-478.124) (-477.273) (-480.467) * (-477.364) (-478.457) [-476.670] (-482.552) -- 0:00:33
470000 -- [-477.353] (-478.461) (-478.239) (-475.897) * (-478.938) [-476.255] (-478.794) (-479.951) -- 0:00:33
Average standard deviation of split frequencies: 0.009682
470500 -- [-474.959] (-483.591) (-479.732) (-479.520) * (-477.387) [-477.947] (-480.399) (-478.043) -- 0:00:33
471000 -- (-480.011) (-481.488) [-480.752] (-478.567) * [-478.174] (-477.416) (-479.334) (-480.962) -- 0:00:33
471500 -- (-475.764) (-483.008) [-479.288] (-483.565) * (-479.187) (-476.620) (-479.416) [-477.228] -- 0:00:33
472000 -- (-477.395) (-478.342) (-476.051) [-484.248] * (-481.638) (-475.755) [-479.269] (-478.763) -- 0:00:33
472500 -- (-479.415) (-479.018) (-477.971) [-480.428] * (-480.816) [-476.005] (-477.803) (-476.607) -- 0:00:33
473000 -- (-478.081) [-479.602] (-478.402) (-477.528) * [-479.190] (-479.782) (-479.781) (-478.177) -- 0:00:33
473500 -- (-478.827) (-476.042) [-478.857] (-476.966) * (-476.973) (-479.392) (-477.325) [-477.789] -- 0:00:33
474000 -- (-476.975) (-477.616) (-480.165) [-481.111] * (-478.162) [-479.605] (-483.170) (-479.382) -- 0:00:33
474500 -- (-476.387) [-480.466] (-478.454) (-477.089) * (-478.497) (-476.785) (-483.281) [-476.291] -- 0:00:33
475000 -- [-476.483] (-476.316) (-477.183) (-480.681) * (-478.331) (-484.973) (-482.970) [-477.974] -- 0:00:34
Average standard deviation of split frequencies: 0.009507
475500 -- (-476.299) [-476.027] (-476.825) (-483.232) * (-477.966) (-483.328) [-477.650] (-479.886) -- 0:00:34
476000 -- (-476.840) (-477.618) [-477.136] (-479.450) * (-479.809) (-482.862) (-478.239) [-478.217] -- 0:00:34
476500 -- [-480.485] (-477.016) (-485.771) (-480.866) * (-480.391) [-477.114] (-481.342) (-478.928) -- 0:00:34
477000 -- [-480.249] (-477.212) (-476.902) (-480.989) * [-477.405] (-475.982) (-479.761) (-476.458) -- 0:00:33
477500 -- (-479.013) [-483.686] (-476.063) (-483.419) * (-480.105) [-476.440] (-476.485) (-477.576) -- 0:00:33
478000 -- (-479.438) [-478.794] (-481.555) (-480.013) * (-482.240) (-474.694) (-479.190) [-475.548] -- 0:00:33
478500 -- (-475.771) [-475.934] (-481.458) (-478.091) * (-478.526) (-477.150) [-478.470] (-480.323) -- 0:00:33
479000 -- (-478.857) (-476.761) (-475.693) [-479.232] * (-480.322) (-475.123) [-476.771] (-479.209) -- 0:00:33
479500 -- (-479.498) (-477.937) [-476.546] (-477.624) * [-478.484] (-477.244) (-480.219) (-481.806) -- 0:00:33
480000 -- (-476.122) [-477.727] (-478.621) (-476.474) * (-482.077) (-478.345) (-482.830) [-477.902] -- 0:00:33
Average standard deviation of split frequencies: 0.009611
480500 -- (-477.399) [-479.670] (-479.730) (-477.246) * (-480.195) [-478.381] (-477.921) (-480.186) -- 0:00:33
481000 -- (-478.136) [-481.606] (-479.911) (-481.359) * (-478.120) (-477.707) (-478.358) [-476.785] -- 0:00:33
481500 -- (-480.692) [-476.332] (-481.290) (-479.010) * (-478.102) (-478.556) [-476.048] (-479.415) -- 0:00:33
482000 -- (-475.842) (-478.346) [-479.486] (-480.712) * [-476.192] (-477.847) (-478.446) (-478.698) -- 0:00:33
482500 -- (-475.502) (-477.841) [-476.836] (-478.811) * (-479.966) (-478.560) (-478.424) [-480.211] -- 0:00:33
483000 -- (-475.937) [-477.756] (-480.840) (-481.570) * (-479.899) (-478.066) (-481.104) [-477.920] -- 0:00:33
483500 -- (-476.036) (-480.698) (-480.043) [-481.343] * [-478.815] (-478.165) (-477.639) (-477.110) -- 0:00:33
484000 -- (-474.997) [-475.906] (-477.923) (-480.137) * (-479.014) (-478.394) [-477.845] (-479.646) -- 0:00:33
484500 -- (-475.729) (-479.008) [-477.223] (-485.985) * (-477.865) [-478.621] (-481.825) (-478.522) -- 0:00:32
485000 -- (-476.175) (-483.719) (-477.758) [-479.972] * (-475.243) (-478.951) (-477.587) [-477.676] -- 0:00:32
Average standard deviation of split frequencies: 0.009376
485500 -- (-481.228) [-477.663] (-477.215) (-477.875) * (-478.977) (-475.823) [-477.149] (-479.407) -- 0:00:32
486000 -- [-479.265] (-479.401) (-482.744) (-478.263) * (-476.379) [-477.742] (-477.900) (-478.781) -- 0:00:32
486500 -- (-480.185) (-477.498) [-478.714] (-477.937) * [-480.186] (-476.285) (-475.888) (-478.011) -- 0:00:32
487000 -- (-477.765) [-478.118] (-479.248) (-480.246) * (-478.828) (-478.669) (-475.874) [-477.421] -- 0:00:32
487500 -- (-478.139) [-478.557] (-479.258) (-479.980) * [-479.470] (-476.108) (-478.474) (-478.549) -- 0:00:32
488000 -- (-479.671) (-479.561) (-479.051) [-476.742] * (-480.646) [-476.432] (-476.718) (-480.853) -- 0:00:32
488500 -- (-478.082) (-480.728) [-475.627] (-481.243) * (-476.757) [-478.647] (-476.910) (-480.690) -- 0:00:32
489000 -- (-477.870) (-480.141) (-478.611) [-481.318] * (-477.971) (-475.934) [-475.810] (-477.551) -- 0:00:32
489500 -- [-478.874] (-480.248) (-478.855) (-478.744) * (-479.062) (-481.650) [-477.191] (-478.576) -- 0:00:32
490000 -- (-476.745) (-476.425) [-476.898] (-481.070) * (-481.107) [-475.392] (-478.326) (-479.030) -- 0:00:32
Average standard deviation of split frequencies: 0.010229
490500 -- (-479.673) [-477.020] (-477.860) (-479.968) * (-478.113) [-476.405] (-479.198) (-478.484) -- 0:00:33
491000 -- (-478.714) (-477.926) (-479.771) [-477.151] * (-480.033) (-480.956) [-478.268] (-477.961) -- 0:00:33
491500 -- (-478.416) (-480.677) [-477.182] (-480.049) * (-478.151) (-478.202) (-478.865) [-480.118] -- 0:00:33
492000 -- (-481.005) (-480.549) (-477.306) [-475.752] * (-476.263) (-479.249) (-479.586) [-478.038] -- 0:00:33
492500 -- (-476.996) (-477.729) [-477.003] (-480.294) * (-477.083) [-482.601] (-478.064) (-480.478) -- 0:00:32
493000 -- (-476.644) (-477.765) [-480.813] (-476.736) * [-476.118] (-482.785) (-482.643) (-479.640) -- 0:00:32
493500 -- (-477.267) [-477.756] (-476.708) (-476.266) * (-478.530) [-478.881] (-478.123) (-478.893) -- 0:00:32
494000 -- (-478.910) (-478.755) [-479.380] (-475.144) * (-480.530) [-476.100] (-478.146) (-476.430) -- 0:00:32
494500 -- (-478.197) [-479.537] (-479.868) (-475.780) * (-479.898) (-480.449) (-477.958) [-477.476] -- 0:00:32
495000 -- [-480.985] (-477.015) (-479.171) (-477.100) * (-478.869) [-477.289] (-476.820) (-478.756) -- 0:00:32
Average standard deviation of split frequencies: 0.009694
495500 -- (-477.127) [-482.839] (-479.729) (-478.113) * [-477.829] (-477.442) (-478.847) (-483.016) -- 0:00:32
496000 -- (-478.008) (-477.586) [-479.691] (-479.094) * (-475.767) [-486.264] (-476.545) (-476.469) -- 0:00:32
496500 -- (-477.498) [-476.787] (-478.163) (-481.225) * (-477.496) (-478.826) [-480.170] (-480.596) -- 0:00:32
497000 -- [-477.535] (-480.891) (-477.019) (-477.278) * (-477.397) [-479.788] (-479.434) (-479.023) -- 0:00:32
497500 -- (-476.711) (-480.192) (-479.919) [-479.993] * (-478.846) (-478.389) [-481.921] (-478.618) -- 0:00:32
498000 -- [-477.079] (-480.285) (-479.230) (-478.600) * [-477.425] (-481.052) (-482.633) (-478.140) -- 0:00:32
498500 -- (-477.476) (-480.187) (-476.410) [-479.717] * [-480.085] (-478.610) (-482.166) (-480.129) -- 0:00:32
499000 -- (-478.173) (-478.808) (-478.120) [-478.930] * [-475.503] (-481.842) (-477.489) (-478.509) -- 0:00:32
499500 -- (-480.615) (-478.302) (-478.148) [-480.022] * (-476.868) (-478.037) (-478.901) [-478.563] -- 0:00:32
500000 -- (-478.008) (-479.041) [-478.649] (-481.510) * (-482.319) [-477.090] (-482.557) (-479.997) -- 0:00:32
Average standard deviation of split frequencies: 0.010063
500500 -- (-479.880) (-480.678) [-477.300] (-481.021) * (-477.043) (-480.882) (-477.237) [-481.834] -- 0:00:31
501000 -- (-479.965) (-491.512) [-479.481] (-475.737) * [-476.741] (-480.213) (-478.856) (-481.094) -- 0:00:31
501500 -- (-478.802) (-480.797) (-480.443) [-478.520] * (-477.577) (-480.967) [-478.836] (-479.504) -- 0:00:31
502000 -- (-477.816) (-477.456) (-476.184) [-478.450] * (-476.975) (-477.582) [-478.008] (-478.052) -- 0:00:31
502500 -- [-478.250] (-480.848) (-479.337) (-480.115) * (-476.991) (-478.299) [-476.261] (-479.792) -- 0:00:31
503000 -- (-478.246) [-477.320] (-478.370) (-483.263) * [-476.854] (-477.975) (-478.287) (-479.321) -- 0:00:31
503500 -- [-475.075] (-481.366) (-479.220) (-480.254) * [-475.464] (-475.271) (-480.893) (-482.930) -- 0:00:31
504000 -- [-476.148] (-478.607) (-478.556) (-478.449) * (-475.362) (-479.587) [-479.351] (-484.759) -- 0:00:31
504500 -- [-477.898] (-480.095) (-479.932) (-480.253) * [-475.405] (-478.524) (-481.633) (-480.736) -- 0:00:31
505000 -- (-476.392) (-484.916) (-477.257) [-475.274] * [-476.205] (-478.374) (-476.883) (-489.815) -- 0:00:31
Average standard deviation of split frequencies: 0.010364
505500 -- (-475.406) (-480.153) (-477.510) [-477.426] * [-475.954] (-480.003) (-476.111) (-479.128) -- 0:00:31
506000 -- (-475.051) (-479.370) [-475.776] (-478.894) * (-480.689) (-478.041) (-477.408) [-477.184] -- 0:00:32
506500 -- (-478.828) [-478.828] (-478.909) (-480.028) * (-476.387) (-477.584) [-476.162] (-475.196) -- 0:00:32
507000 -- [-477.879] (-476.830) (-480.000) (-479.449) * (-484.684) [-477.889] (-478.165) (-478.156) -- 0:00:32
507500 -- (-479.012) [-476.899] (-482.158) (-477.112) * (-480.789) (-477.159) (-476.554) [-478.683] -- 0:00:32
508000 -- (-482.002) (-479.326) (-478.865) [-478.737] * (-480.249) (-479.938) [-476.182] (-477.921) -- 0:00:31
508500 -- (-477.534) (-478.304) (-482.027) [-480.929] * (-478.603) (-481.356) [-477.377] (-479.556) -- 0:00:31
509000 -- (-476.031) [-479.495] (-485.442) (-478.880) * (-479.001) (-481.200) (-478.514) [-478.646] -- 0:00:31
509500 -- [-479.859] (-477.723) (-484.045) (-477.453) * (-479.755) [-479.681] (-476.521) (-476.358) -- 0:00:31
510000 -- [-479.384] (-476.565) (-479.626) (-478.577) * (-475.974) (-477.734) [-476.181] (-478.622) -- 0:00:31
Average standard deviation of split frequencies: 0.010893
510500 -- [-478.520] (-479.438) (-476.619) (-483.802) * (-478.601) [-476.224] (-477.952) (-479.685) -- 0:00:31
511000 -- (-479.703) (-475.759) (-477.478) [-481.556] * (-480.211) (-479.028) [-479.055] (-479.397) -- 0:00:31
511500 -- (-480.288) (-478.752) [-480.384] (-479.358) * [-478.656] (-476.740) (-482.011) (-477.649) -- 0:00:31
512000 -- (-479.182) (-478.510) [-479.400] (-475.701) * [-476.758] (-476.171) (-483.073) (-477.499) -- 0:00:31
512500 -- (-477.223) (-478.246) [-480.565] (-477.886) * (-476.710) (-479.411) (-479.443) [-476.724] -- 0:00:31
513000 -- (-475.744) (-478.483) [-479.136] (-478.072) * [-479.290] (-476.208) (-479.848) (-479.035) -- 0:00:31
513500 -- (-476.854) (-477.571) [-482.254] (-479.346) * (-476.325) [-475.971] (-476.853) (-478.221) -- 0:00:31
514000 -- (-478.942) (-478.140) (-480.370) [-475.443] * (-478.594) [-475.385] (-479.032) (-480.172) -- 0:00:31
514500 -- [-478.837] (-481.648) (-479.325) (-483.598) * (-479.773) (-477.342) [-475.811] (-475.366) -- 0:00:31
515000 -- [-476.834] (-478.949) (-479.533) (-482.943) * (-477.685) [-478.228] (-478.421) (-480.616) -- 0:00:31
Average standard deviation of split frequencies: 0.011267
515500 -- (-477.498) (-481.936) [-478.458] (-480.991) * (-483.393) (-480.209) (-479.905) [-479.715] -- 0:00:31
516000 -- (-477.320) (-481.403) [-484.261] (-479.063) * [-477.532] (-478.984) (-478.043) (-475.301) -- 0:00:30
516500 -- (-476.569) [-478.729] (-479.398) (-482.234) * (-475.855) (-478.563) [-478.007] (-477.075) -- 0:00:30
517000 -- (-478.475) (-480.482) [-478.495] (-477.917) * (-476.573) (-478.828) (-476.358) [-479.438] -- 0:00:30
517500 -- (-477.804) [-480.908] (-483.181) (-476.382) * (-479.548) (-478.706) [-475.661] (-477.476) -- 0:00:30
518000 -- (-476.482) [-476.874] (-480.580) (-482.476) * (-478.032) (-477.126) [-480.660] (-479.263) -- 0:00:30
518500 -- (-476.599) (-479.543) (-479.953) [-476.419] * (-478.070) [-477.908] (-478.468) (-480.828) -- 0:00:30
519000 -- (-482.000) [-477.515] (-476.615) (-479.006) * (-480.427) (-479.144) (-480.052) [-475.504] -- 0:00:30
519500 -- (-479.735) (-479.119) [-476.237] (-480.593) * (-480.870) [-476.690] (-478.521) (-476.579) -- 0:00:30
520000 -- (-475.234) [-482.243] (-478.837) (-477.748) * (-477.307) [-478.295] (-477.117) (-476.269) -- 0:00:30
Average standard deviation of split frequencies: 0.010623
520500 -- (-479.177) (-482.557) (-477.039) [-476.492] * (-479.294) [-480.255] (-480.113) (-478.961) -- 0:00:30
521000 -- [-478.931] (-477.526) (-476.501) (-475.817) * [-478.097] (-480.444) (-478.055) (-475.875) -- 0:00:30
521500 -- (-480.799) [-476.937] (-483.020) (-481.283) * [-479.440] (-482.658) (-480.355) (-478.025) -- 0:00:30
522000 -- (-476.892) [-482.897] (-480.891) (-478.023) * (-476.762) [-476.944] (-482.310) (-478.779) -- 0:00:31
522500 -- (-478.758) (-479.543) [-480.878] (-478.791) * (-476.822) [-480.571] (-478.904) (-477.941) -- 0:00:31
523000 -- (-476.216) [-475.208] (-478.722) (-477.254) * [-477.148] (-481.604) (-478.774) (-478.352) -- 0:00:31
523500 -- (-480.045) (-478.793) [-477.392] (-475.893) * (-482.238) (-478.680) [-481.025] (-482.881) -- 0:00:30
524000 -- (-483.511) (-482.222) [-477.620] (-484.037) * (-481.661) [-478.984] (-477.598) (-480.395) -- 0:00:30
524500 -- (-478.074) (-477.807) [-481.236] (-480.478) * (-479.770) [-478.375] (-479.863) (-479.182) -- 0:00:30
525000 -- (-480.685) [-476.473] (-479.268) (-478.982) * [-477.119] (-478.137) (-481.253) (-479.856) -- 0:00:30
Average standard deviation of split frequencies: 0.010586
525500 -- [-482.049] (-476.936) (-483.159) (-477.559) * (-481.202) (-480.415) (-480.227) [-477.758] -- 0:00:30
526000 -- [-479.914] (-475.192) (-485.245) (-477.320) * (-476.944) (-481.869) (-475.756) [-477.945] -- 0:00:30
526500 -- (-479.006) (-478.454) [-480.207] (-479.791) * (-476.086) (-478.108) [-476.865] (-480.506) -- 0:00:30
527000 -- (-480.005) (-478.293) (-477.641) [-479.305] * [-477.571] (-478.227) (-477.790) (-478.949) -- 0:00:30
527500 -- (-481.023) (-476.568) [-479.283] (-480.044) * (-479.557) (-477.321) [-477.140] (-480.453) -- 0:00:30
528000 -- (-480.098) (-477.401) (-477.745) [-475.587] * [-479.278] (-479.578) (-476.716) (-480.922) -- 0:00:30
528500 -- (-481.625) (-479.906) [-478.984] (-475.725) * [-478.904] (-478.926) (-478.666) (-476.892) -- 0:00:30
529000 -- (-477.855) [-480.674] (-480.293) (-476.354) * [-477.862] (-479.348) (-476.891) (-479.687) -- 0:00:30
529500 -- (-483.018) (-480.222) (-482.726) [-474.826] * (-477.612) (-480.058) [-477.610] (-480.238) -- 0:00:30
530000 -- (-478.313) (-477.887) [-479.833] (-477.689) * (-476.763) (-478.211) [-477.301] (-479.856) -- 0:00:30
Average standard deviation of split frequencies: 0.010660
530500 -- [-479.301] (-487.959) (-480.824) (-479.854) * (-477.421) (-482.162) (-478.748) [-478.461] -- 0:00:30
531000 -- (-481.158) (-485.082) (-480.268) [-476.141] * [-479.320] (-480.220) (-479.341) (-481.170) -- 0:00:30
531500 -- [-479.648] (-479.001) (-478.992) (-477.791) * [-478.555] (-479.118) (-477.811) (-479.123) -- 0:00:29
532000 -- (-477.760) (-478.618) [-478.835] (-479.989) * (-478.540) [-477.106] (-477.407) (-478.652) -- 0:00:29
532500 -- (-479.750) [-476.830] (-475.910) (-475.495) * (-479.274) [-478.694] (-481.429) (-480.130) -- 0:00:29
533000 -- [-481.365] (-478.841) (-476.411) (-476.145) * [-478.384] (-480.417) (-478.184) (-479.339) -- 0:00:29
533500 -- (-476.892) (-480.542) (-476.089) [-478.192] * [-478.075] (-479.492) (-482.088) (-480.464) -- 0:00:29
534000 -- (-479.808) (-479.365) [-477.187] (-481.588) * (-479.272) (-479.461) [-477.218] (-480.199) -- 0:00:29
534500 -- (-480.096) [-479.795] (-479.800) (-478.067) * (-479.414) (-478.293) (-483.692) [-477.485] -- 0:00:29
535000 -- (-480.152) [-476.920] (-479.542) (-479.921) * (-476.737) (-477.048) (-481.573) [-476.822] -- 0:00:29
Average standard deviation of split frequencies: 0.010939
535500 -- (-484.295) (-475.347) (-480.994) [-475.710] * (-478.167) (-482.546) (-478.905) [-479.604] -- 0:00:29
536000 -- (-479.302) [-476.087] (-481.428) (-480.301) * [-477.595] (-476.091) (-485.526) (-479.392) -- 0:00:29
536500 -- (-481.110) [-476.184] (-479.676) (-476.978) * [-483.217] (-477.948) (-482.302) (-479.136) -- 0:00:29
537000 -- (-480.511) (-477.028) (-479.186) [-485.509] * [-483.257] (-486.303) (-479.771) (-482.055) -- 0:00:29
537500 -- [-479.419] (-481.932) (-478.105) (-479.915) * (-478.482) (-475.282) (-479.521) [-477.029] -- 0:00:29
538000 -- (-481.390) [-477.195] (-479.847) (-478.025) * (-478.266) [-477.142] (-479.839) (-478.458) -- 0:00:30
538500 -- (-484.346) [-477.110] (-477.295) (-476.290) * [-477.267] (-478.382) (-481.297) (-479.411) -- 0:00:29
539000 -- (-477.174) (-475.432) [-477.839] (-481.321) * (-479.030) [-478.527] (-480.454) (-481.419) -- 0:00:29
539500 -- (-479.243) [-476.211] (-476.268) (-483.923) * [-477.733] (-479.887) (-477.561) (-479.075) -- 0:00:29
540000 -- (-479.179) (-479.316) [-480.018] (-477.107) * (-480.271) (-479.251) (-478.550) [-479.852] -- 0:00:29
Average standard deviation of split frequencies: 0.010299
540500 -- (-480.752) (-478.671) (-478.920) [-477.700] * (-476.622) (-477.786) (-478.775) [-479.925] -- 0:00:29
541000 -- [-477.931] (-478.382) (-479.836) (-480.497) * [-478.302] (-478.260) (-479.663) (-478.439) -- 0:00:29
541500 -- (-478.204) (-476.786) (-480.012) [-476.817] * [-477.134] (-477.523) (-479.490) (-480.743) -- 0:00:29
542000 -- [-477.281] (-477.129) (-480.149) (-482.647) * [-476.781] (-479.332) (-478.191) (-480.009) -- 0:00:29
542500 -- (-478.380) (-477.363) [-478.638] (-479.507) * (-480.555) (-477.871) (-477.898) [-479.969] -- 0:00:29
543000 -- (-478.729) [-478.650] (-477.787) (-482.210) * (-479.831) (-477.392) (-475.764) [-478.710] -- 0:00:29
543500 -- (-478.171) [-476.621] (-480.333) (-477.590) * (-480.102) (-476.397) [-477.051] (-479.233) -- 0:00:29
544000 -- (-477.158) (-476.737) [-479.348] (-478.755) * (-478.480) [-477.901] (-477.082) (-477.491) -- 0:00:29
544500 -- (-479.457) (-477.607) (-480.652) [-478.763] * (-478.064) [-475.694] (-482.387) (-481.831) -- 0:00:29
545000 -- (-479.437) (-478.809) (-478.530) [-477.968] * (-478.515) (-475.955) [-478.638] (-478.873) -- 0:00:29
Average standard deviation of split frequencies: 0.010868
545500 -- (-477.182) (-481.753) (-478.723) [-479.679] * (-476.137) [-478.307] (-479.475) (-478.917) -- 0:00:29
546000 -- (-477.461) (-480.147) (-479.682) [-477.455] * (-479.757) (-479.440) (-478.136) [-478.780] -- 0:00:29
546500 -- (-482.640) [-478.784] (-480.348) (-477.308) * (-476.698) (-477.290) (-479.468) [-479.147] -- 0:00:29
547000 -- (-480.725) (-477.319) [-477.413] (-478.797) * [-477.412] (-478.051) (-481.415) (-478.145) -- 0:00:28
547500 -- [-476.783] (-482.478) (-478.662) (-481.122) * (-477.964) [-479.630] (-480.431) (-474.750) -- 0:00:28
548000 -- [-479.294] (-478.534) (-482.665) (-481.648) * (-481.891) (-479.362) (-479.687) [-476.646] -- 0:00:28
548500 -- (-479.062) (-480.291) (-480.959) [-479.036] * (-482.244) [-478.897] (-477.379) (-478.191) -- 0:00:28
549000 -- (-478.661) (-479.674) (-480.299) [-480.681] * [-480.979] (-479.261) (-478.912) (-478.439) -- 0:00:28
549500 -- (-484.121) [-475.489] (-478.818) (-480.658) * (-480.472) (-478.339) (-478.028) [-478.843] -- 0:00:28
550000 -- (-479.626) (-482.192) (-479.367) [-478.282] * (-476.614) (-479.321) [-478.838] (-477.042) -- 0:00:28
Average standard deviation of split frequencies: 0.011243
550500 -- (-478.331) [-477.817] (-478.148) (-479.393) * (-477.182) [-481.905] (-482.389) (-477.509) -- 0:00:28
551000 -- (-479.590) (-478.143) (-476.990) [-481.582] * (-478.436) [-475.999] (-479.615) (-478.325) -- 0:00:28
551500 -- (-477.504) (-478.257) (-477.661) [-479.576] * (-478.942) (-476.779) (-479.770) [-477.377] -- 0:00:28
552000 -- (-478.151) [-476.586] (-479.937) (-480.365) * (-479.120) [-478.919] (-478.988) (-478.660) -- 0:00:28
552500 -- [-479.267] (-477.225) (-479.646) (-479.074) * [-477.746] (-478.298) (-480.788) (-479.033) -- 0:00:28
553000 -- [-477.700] (-477.168) (-482.071) (-480.200) * (-479.269) (-478.099) (-477.837) [-479.387] -- 0:00:28
553500 -- [-478.619] (-478.318) (-478.053) (-475.405) * (-476.090) [-480.314] (-478.252) (-479.259) -- 0:00:28
554000 -- (-476.956) (-480.877) (-477.744) [-477.710] * [-476.919] (-478.601) (-479.141) (-479.859) -- 0:00:28
554500 -- (-477.662) [-479.251] (-479.598) (-478.350) * (-478.447) [-478.788] (-481.439) (-481.701) -- 0:00:28
555000 -- (-477.554) (-477.584) [-476.425] (-478.865) * (-481.498) (-481.507) (-480.929) [-478.093] -- 0:00:28
Average standard deviation of split frequencies: 0.010909
555500 -- [-477.536] (-477.960) (-476.856) (-478.449) * [-481.427] (-478.783) (-478.379) (-479.930) -- 0:00:28
556000 -- (-479.572) (-478.587) [-477.512] (-482.076) * [-479.740] (-480.148) (-477.941) (-482.538) -- 0:00:28
556500 -- (-478.423) (-481.338) [-479.540] (-479.499) * (-477.771) (-479.781) (-477.233) [-476.182] -- 0:00:28
557000 -- (-482.054) (-475.586) (-481.765) [-479.485] * [-475.318] (-479.595) (-478.759) (-477.813) -- 0:00:28
557500 -- (-480.891) [-477.998] (-480.647) (-477.418) * (-481.276) (-479.228) [-478.611] (-481.581) -- 0:00:28
558000 -- (-479.092) (-478.071) (-480.093) [-478.592] * [-477.468] (-479.192) (-479.150) (-480.278) -- 0:00:28
558500 -- (-484.933) (-476.935) (-478.970) [-477.571] * (-480.819) (-477.729) [-479.056] (-479.147) -- 0:00:28
559000 -- (-478.645) (-477.459) [-477.134] (-480.875) * (-481.668) (-481.483) (-480.478) [-476.361] -- 0:00:28
559500 -- (-477.923) [-477.898] (-478.511) (-479.938) * (-480.282) (-478.524) [-479.357] (-477.396) -- 0:00:28
560000 -- (-477.806) [-477.953] (-475.787) (-480.001) * (-482.092) [-476.946] (-478.141) (-480.704) -- 0:00:28
Average standard deviation of split frequencies: 0.011211
560500 -- (-479.738) [-477.928] (-477.288) (-476.125) * (-479.124) [-480.055] (-478.347) (-477.864) -- 0:00:28
561000 -- (-479.085) (-476.123) [-480.485] (-480.764) * (-478.759) (-481.639) [-479.038] (-476.992) -- 0:00:28
561500 -- (-478.616) [-477.919] (-480.610) (-478.726) * [-476.436] (-479.298) (-480.571) (-480.342) -- 0:00:28
562000 -- [-481.477] (-478.425) (-480.362) (-481.019) * (-479.001) [-478.458] (-477.565) (-477.864) -- 0:00:28
562500 -- (-481.134) [-479.618] (-480.214) (-477.481) * (-477.581) (-477.864) (-481.127) [-478.394] -- 0:00:28
563000 -- (-479.587) [-479.316] (-478.435) (-477.181) * [-476.920] (-480.548) (-482.302) (-480.018) -- 0:00:27
563500 -- [-479.347] (-478.860) (-476.427) (-482.170) * (-478.694) (-478.077) (-479.517) [-480.936] -- 0:00:27
564000 -- [-476.932] (-478.136) (-478.584) (-479.031) * (-480.597) [-485.456] (-480.250) (-479.744) -- 0:00:27
564500 -- (-477.987) (-482.083) [-478.389] (-479.434) * (-475.670) (-481.685) (-481.455) [-479.446] -- 0:00:27
565000 -- [-476.495] (-476.492) (-475.720) (-476.672) * (-478.976) [-478.179] (-484.622) (-478.343) -- 0:00:27
Average standard deviation of split frequencies: 0.011272
565500 -- (-479.654) [-479.453] (-476.970) (-478.850) * (-477.085) (-478.396) (-481.537) [-476.782] -- 0:00:27
566000 -- (-477.705) (-479.909) [-477.169] (-479.939) * (-477.112) (-477.948) [-478.876] (-479.777) -- 0:00:27
566500 -- [-478.550] (-477.545) (-478.290) (-480.285) * (-480.580) (-484.157) [-476.167] (-479.548) -- 0:00:27
567000 -- (-477.591) (-478.208) [-480.578] (-478.843) * (-478.087) (-478.645) [-481.590] (-478.242) -- 0:00:27
567500 -- (-479.161) [-475.329] (-478.444) (-476.426) * (-477.294) (-478.383) (-479.211) [-479.131] -- 0:00:27
568000 -- [-477.215] (-476.148) (-477.732) (-478.643) * [-475.851] (-480.736) (-482.213) (-475.955) -- 0:00:27
568500 -- (-479.895) (-476.801) [-476.170] (-477.077) * (-477.175) (-481.188) [-478.647] (-478.171) -- 0:00:27
569000 -- [-477.384] (-477.883) (-478.034) (-477.931) * (-482.539) (-479.572) (-477.315) [-479.824] -- 0:00:27
569500 -- (-480.284) (-479.865) [-478.116] (-479.058) * (-482.912) [-479.234] (-480.899) (-480.434) -- 0:00:27
570000 -- (-483.383) (-481.905) (-477.015) [-475.589] * (-479.270) [-478.847] (-484.168) (-478.004) -- 0:00:27
Average standard deviation of split frequencies: 0.010849
570500 -- (-480.497) [-476.227] (-477.982) (-476.352) * (-477.559) [-480.594] (-479.326) (-479.392) -- 0:00:27
571000 -- (-480.592) (-475.524) (-478.336) [-476.469] * [-479.198] (-479.301) (-478.883) (-479.576) -- 0:00:27
571500 -- (-476.494) [-476.923] (-480.428) (-478.367) * (-481.019) (-478.239) (-478.625) [-477.956] -- 0:00:27
572000 -- (-476.940) [-476.291] (-476.330) (-475.370) * [-477.664] (-480.972) (-481.504) (-478.169) -- 0:00:27
572500 -- (-477.868) (-479.779) (-481.602) [-478.704] * (-476.438) [-480.722] (-480.655) (-478.770) -- 0:00:27
573000 -- (-478.893) (-478.011) [-481.978] (-477.687) * (-477.493) (-478.795) [-478.694] (-481.442) -- 0:00:27
573500 -- [-479.923] (-479.275) (-480.730) (-477.662) * (-478.073) (-477.648) [-479.840] (-480.816) -- 0:00:27
574000 -- (-480.246) [-478.816] (-476.565) (-476.534) * (-478.025) (-477.644) [-480.762] (-478.182) -- 0:00:27
574500 -- (-475.920) [-478.244] (-478.097) (-478.157) * [-476.461] (-476.680) (-480.355) (-477.084) -- 0:00:27
575000 -- (-476.249) [-475.906] (-477.161) (-476.533) * (-477.630) (-480.852) [-481.115] (-480.931) -- 0:00:27
Average standard deviation of split frequencies: 0.010203
575500 -- [-479.959] (-483.581) (-480.433) (-477.895) * (-476.177) (-480.177) [-481.572] (-478.868) -- 0:00:27
576000 -- (-477.602) (-478.197) [-477.108] (-477.674) * (-478.293) [-479.289] (-479.474) (-482.658) -- 0:00:27
576500 -- (-480.076) (-480.490) (-476.647) [-476.594] * (-477.307) (-477.022) (-481.152) [-477.948] -- 0:00:27
577000 -- (-476.409) (-480.094) (-479.508) [-477.212] * [-476.994] (-479.852) (-484.319) (-478.287) -- 0:00:27
577500 -- (-482.860) (-481.944) [-477.277] (-476.595) * (-481.617) (-479.981) (-481.269) [-478.960] -- 0:00:27
578000 -- (-477.648) (-477.554) [-481.578] (-477.884) * [-479.436] (-482.381) (-479.825) (-479.153) -- 0:00:27
578500 -- (-481.428) [-477.574] (-478.790) (-476.839) * (-478.919) (-478.268) [-478.575] (-478.071) -- 0:00:26
579000 -- (-478.620) (-478.387) [-478.035] (-477.470) * (-483.031) [-478.614] (-482.297) (-479.371) -- 0:00:26
579500 -- (-478.906) (-479.430) (-478.429) [-475.175] * (-478.421) [-477.678] (-481.041) (-479.600) -- 0:00:26
580000 -- [-479.586] (-482.631) (-476.344) (-478.650) * (-478.403) (-482.883) (-483.603) [-478.244] -- 0:00:26
Average standard deviation of split frequencies: 0.009796
580500 -- (-476.883) (-479.680) (-478.516) [-475.426] * [-476.940] (-476.887) (-480.047) (-477.684) -- 0:00:26
581000 -- (-478.715) [-478.055] (-478.219) (-477.350) * (-478.565) (-477.376) [-479.525] (-480.650) -- 0:00:26
581500 -- (-477.176) (-481.906) (-477.513) [-477.932] * [-475.605] (-478.776) (-478.340) (-477.685) -- 0:00:26
582000 -- [-479.536] (-476.483) (-479.753) (-477.242) * (-475.592) (-478.382) (-479.910) [-477.374] -- 0:00:26
582500 -- [-475.012] (-477.629) (-480.269) (-481.164) * (-476.978) (-478.722) (-478.954) [-477.064] -- 0:00:26
583000 -- (-478.596) [-477.480] (-479.385) (-476.509) * (-481.587) [-478.441] (-480.276) (-478.802) -- 0:00:26
583500 -- [-478.563] (-478.886) (-477.579) (-477.240) * (-477.161) [-476.240] (-479.582) (-479.349) -- 0:00:26
584000 -- [-476.842] (-480.786) (-478.947) (-477.640) * (-477.330) [-476.036] (-477.576) (-475.394) -- 0:00:26
584500 -- (-478.927) (-476.815) (-479.386) [-477.152] * (-476.353) (-480.453) [-479.592] (-482.004) -- 0:00:26
585000 -- [-477.665] (-479.931) (-481.667) (-478.756) * (-477.784) (-478.396) [-477.695] (-479.396) -- 0:00:26
Average standard deviation of split frequencies: 0.009546
585500 -- [-475.873] (-476.590) (-480.059) (-479.369) * (-479.531) (-480.384) (-479.560) [-479.691] -- 0:00:26
586000 -- [-476.904] (-477.525) (-479.214) (-476.623) * [-476.068] (-484.141) (-478.773) (-479.316) -- 0:00:26
586500 -- [-477.711] (-477.119) (-482.201) (-476.423) * (-476.610) [-482.796] (-477.081) (-475.942) -- 0:00:26
587000 -- (-476.575) [-479.963] (-481.722) (-478.817) * (-482.024) (-482.999) [-477.937] (-480.632) -- 0:00:26
587500 -- (-477.199) [-480.872] (-479.519) (-477.950) * [-476.320] (-480.575) (-480.562) (-475.957) -- 0:00:26
588000 -- (-478.233) (-481.447) (-480.716) [-475.956] * [-474.594] (-481.167) (-478.820) (-477.684) -- 0:00:26
588500 -- [-477.824] (-479.640) (-483.306) (-479.398) * [-476.525] (-481.345) (-479.170) (-477.169) -- 0:00:26
589000 -- (-477.262) (-478.829) (-480.308) [-478.541] * (-478.450) (-478.653) (-480.644) [-476.430] -- 0:00:26
589500 -- [-476.254] (-477.996) (-481.444) (-477.071) * (-482.365) [-479.238] (-480.201) (-477.926) -- 0:00:26
590000 -- [-479.453] (-481.135) (-481.176) (-480.337) * (-476.893) (-480.786) (-479.198) [-476.040] -- 0:00:26
Average standard deviation of split frequencies: 0.009258
590500 -- (-482.491) (-479.874) [-478.050] (-480.741) * [-476.891] (-482.115) (-477.019) (-483.120) -- 0:00:26
591000 -- (-479.763) (-479.265) [-477.298] (-479.170) * (-487.265) (-479.852) [-475.147] (-478.600) -- 0:00:26
591500 -- (-478.752) (-481.350) [-475.327] (-476.406) * (-478.737) (-483.031) [-478.936] (-478.219) -- 0:00:26
592000 -- (-481.029) (-476.973) (-479.704) [-478.720] * (-479.045) [-479.051] (-484.026) (-477.604) -- 0:00:26
592500 -- (-478.618) (-476.255) [-477.437] (-482.516) * (-479.381) (-476.371) (-478.048) [-478.385] -- 0:00:26
593000 -- (-478.257) (-483.131) (-478.648) [-476.672] * (-477.004) (-480.018) [-477.256] (-479.531) -- 0:00:26
593500 -- (-476.723) (-480.638) [-477.958] (-478.853) * (-482.648) (-481.414) [-477.666] (-477.376) -- 0:00:26
594000 -- [-480.183] (-479.684) (-480.729) (-478.979) * (-478.217) (-476.121) [-479.679] (-479.628) -- 0:00:25
594500 -- (-479.379) (-478.161) [-480.789] (-477.204) * [-476.160] (-477.496) (-479.484) (-477.931) -- 0:00:25
595000 -- (-477.328) (-479.137) (-478.845) [-479.827] * (-476.222) (-476.812) (-478.257) [-476.974] -- 0:00:25
Average standard deviation of split frequencies: 0.009491
595500 -- (-476.169) (-476.315) (-479.539) [-476.359] * [-478.176] (-477.179) (-479.180) (-478.157) -- 0:00:25
596000 -- (-474.931) (-476.404) [-477.769] (-475.577) * [-476.810] (-477.127) (-477.396) (-478.518) -- 0:00:25
596500 -- [-476.644] (-480.020) (-479.020) (-476.574) * [-476.285] (-477.435) (-476.633) (-476.867) -- 0:00:25
597000 -- (-478.894) (-477.637) (-478.703) [-477.301] * (-478.088) (-478.934) (-477.378) [-477.398] -- 0:00:25
597500 -- (-480.829) [-479.683] (-479.835) (-480.350) * (-478.305) (-478.791) [-478.794] (-484.092) -- 0:00:25
598000 -- [-478.791] (-477.113) (-482.011) (-478.550) * (-484.510) [-478.575] (-478.072) (-479.868) -- 0:00:25
598500 -- (-476.106) (-479.722) [-478.933] (-477.652) * (-477.834) (-476.523) [-476.588] (-479.635) -- 0:00:25
599000 -- [-476.962] (-482.496) (-479.195) (-478.625) * (-477.789) (-478.673) [-479.550] (-477.683) -- 0:00:25
599500 -- (-478.788) (-475.522) [-478.366] (-477.989) * (-481.633) (-479.708) (-481.160) [-479.246] -- 0:00:25
600000 -- [-478.877] (-475.516) (-478.674) (-484.383) * (-480.002) (-475.450) (-478.961) [-475.659] -- 0:00:25
Average standard deviation of split frequencies: 0.009261
600500 -- (-478.282) (-477.776) [-477.851] (-480.009) * (-480.061) (-475.869) (-477.452) [-480.605] -- 0:00:25
601000 -- (-479.418) [-476.301] (-478.653) (-479.315) * (-479.430) (-478.355) (-479.160) [-477.056] -- 0:00:25
601500 -- (-477.161) [-475.915] (-479.807) (-476.427) * (-481.857) (-476.372) (-479.189) [-476.985] -- 0:00:25
602000 -- (-479.784) (-476.247) (-478.694) [-477.065] * (-479.536) (-477.577) [-478.071] (-479.720) -- 0:00:25
602500 -- (-482.274) (-477.156) (-477.756) [-477.590] * (-480.777) [-475.618] (-480.056) (-477.028) -- 0:00:25
603000 -- (-476.931) (-476.644) (-480.404) [-477.971] * (-480.932) [-475.335] (-479.246) (-478.447) -- 0:00:25
603500 -- (-477.803) (-477.300) (-480.071) [-479.846] * (-479.052) (-477.398) (-478.108) [-478.216] -- 0:00:25
604000 -- (-477.032) [-477.569] (-476.685) (-478.031) * [-478.105] (-480.573) (-480.664) (-479.313) -- 0:00:25
604500 -- (-479.251) (-479.683) [-477.906] (-477.348) * [-477.969] (-478.579) (-479.309) (-481.057) -- 0:00:25
605000 -- (-476.055) [-478.704] (-477.657) (-480.811) * (-477.912) [-476.350] (-480.653) (-479.089) -- 0:00:25
Average standard deviation of split frequencies: 0.009387
605500 -- (-478.120) (-478.276) [-484.486] (-478.670) * (-478.903) [-476.683] (-482.161) (-477.245) -- 0:00:25
606000 -- [-478.815] (-488.909) (-479.698) (-478.334) * (-477.870) [-476.616] (-478.240) (-478.961) -- 0:00:25
606500 -- (-475.975) (-480.046) (-476.955) [-478.616] * [-476.352] (-478.775) (-480.127) (-479.111) -- 0:00:25
607000 -- [-478.288] (-477.894) (-478.328) (-478.871) * (-477.526) (-477.847) (-479.694) [-480.068] -- 0:00:25
607500 -- (-478.810) (-480.495) [-476.987] (-477.128) * (-476.227) [-476.759] (-480.313) (-479.334) -- 0:00:25
608000 -- (-477.838) (-477.495) (-478.474) [-479.434] * (-476.613) (-476.435) (-478.669) [-477.507] -- 0:00:25
608500 -- (-478.192) (-478.572) [-479.291] (-478.665) * [-481.141] (-477.875) (-478.761) (-476.314) -- 0:00:25
609000 -- (-480.723) (-477.440) (-479.520) [-477.560] * (-479.757) [-476.104] (-479.244) (-477.168) -- 0:00:25
609500 -- (-479.742) (-476.743) [-481.785] (-476.481) * (-486.887) (-477.207) [-477.502] (-477.836) -- 0:00:24
610000 -- (-477.789) (-477.483) (-482.411) [-478.218] * (-479.806) [-477.198] (-484.715) (-477.953) -- 0:00:24
Average standard deviation of split frequencies: 0.009727
610500 -- [-476.688] (-478.595) (-478.509) (-479.772) * (-475.901) (-478.891) (-477.592) [-478.218] -- 0:00:24
611000 -- (-478.213) [-478.840] (-478.342) (-475.965) * (-482.364) (-477.777) (-478.933) [-478.543] -- 0:00:24
611500 -- (-476.587) (-479.160) [-477.912] (-480.978) * (-479.646) (-475.770) [-479.422] (-478.745) -- 0:00:24
612000 -- (-479.053) (-481.624) (-477.314) [-478.572] * [-477.674] (-476.082) (-477.515) (-481.048) -- 0:00:24
612500 -- (-477.136) [-478.919] (-479.240) (-481.844) * (-476.920) [-475.467] (-477.287) (-479.352) -- 0:00:24
613000 -- (-476.254) (-478.213) [-480.163] (-480.578) * (-477.626) (-480.251) (-477.570) [-477.911] -- 0:00:24
613500 -- (-478.279) [-478.353] (-479.183) (-480.346) * (-479.766) (-478.885) (-478.993) [-479.387] -- 0:00:24
614000 -- (-476.113) [-476.611] (-479.866) (-481.997) * (-478.966) (-474.979) [-478.383] (-475.370) -- 0:00:24
614500 -- (-477.571) [-477.645] (-480.905) (-480.444) * (-477.509) (-477.940) (-479.840) [-476.995] -- 0:00:24
615000 -- (-485.397) (-480.554) (-478.115) [-479.069] * [-478.776] (-481.797) (-479.321) (-479.515) -- 0:00:24
Average standard deviation of split frequencies: 0.009795
615500 -- [-478.696] (-478.005) (-482.671) (-481.585) * (-480.059) (-482.747) [-479.253] (-478.573) -- 0:00:24
616000 -- (-481.293) [-475.804] (-484.642) (-479.520) * (-478.445) (-480.890) (-477.313) [-480.141] -- 0:00:24
616500 -- (-478.491) [-478.049] (-480.191) (-477.012) * (-479.624) (-481.332) [-476.810] (-478.321) -- 0:00:24
617000 -- (-480.446) (-476.808) (-479.594) [-477.050] * [-479.034] (-478.338) (-478.243) (-476.632) -- 0:00:24
617500 -- (-480.246) [-476.444] (-477.496) (-476.809) * (-480.349) (-477.331) (-479.323) [-477.376] -- 0:00:24
618000 -- (-478.058) [-482.480] (-477.718) (-480.720) * (-477.500) (-478.396) [-476.850] (-480.447) -- 0:00:24
618500 -- [-476.585] (-479.798) (-477.637) (-478.302) * (-480.398) (-478.614) (-478.855) [-480.265] -- 0:00:24
619000 -- [-480.721] (-476.503) (-477.612) (-478.142) * (-479.294) (-481.086) [-476.374] (-486.856) -- 0:00:24
619500 -- (-480.421) (-479.212) [-479.273] (-479.251) * (-476.920) (-478.866) (-477.251) [-480.502] -- 0:00:24
620000 -- (-477.546) (-478.345) [-476.293] (-476.020) * (-479.277) (-479.547) [-478.028] (-479.961) -- 0:00:24
Average standard deviation of split frequencies: 0.010228
620500 -- (-476.310) (-478.519) [-478.092] (-476.754) * [-479.902] (-483.404) (-475.835) (-477.899) -- 0:00:24
621000 -- (-479.111) [-479.567] (-477.088) (-475.935) * (-482.047) (-483.111) (-476.802) [-480.018] -- 0:00:24
621500 -- (-476.560) (-477.462) (-479.040) [-478.795] * [-477.774] (-479.485) (-476.446) (-478.576) -- 0:00:24
622000 -- (-476.601) (-476.525) [-477.214] (-477.731) * (-480.370) (-480.204) (-475.896) [-477.808] -- 0:00:24
622500 -- (-478.809) [-482.851] (-477.584) (-480.467) * (-476.490) (-479.160) [-476.666] (-476.890) -- 0:00:24
623000 -- (-479.560) (-477.709) (-477.720) [-477.908] * (-476.613) (-478.272) [-477.700] (-479.397) -- 0:00:24
623500 -- [-480.892] (-477.853) (-480.392) (-478.759) * (-478.064) (-478.007) (-475.883) [-482.695] -- 0:00:24
624000 -- (-482.828) (-476.109) [-477.071] (-477.372) * [-480.458] (-480.631) (-475.727) (-479.821) -- 0:00:24
624500 -- (-477.933) (-479.461) [-475.247] (-478.381) * (-482.201) (-476.712) [-476.210] (-479.658) -- 0:00:24
625000 -- (-476.713) [-478.948] (-477.702) (-477.847) * (-478.737) (-478.403) [-477.805] (-478.449) -- 0:00:24
Average standard deviation of split frequencies: 0.009890
625500 -- (-481.643) (-478.541) (-476.692) [-476.924] * [-477.750] (-478.584) (-474.825) (-480.853) -- 0:00:23
626000 -- (-477.623) [-475.235] (-481.147) (-477.284) * [-478.320] (-479.189) (-480.889) (-481.557) -- 0:00:23
626500 -- (-480.864) (-477.221) [-479.725] (-477.667) * (-479.289) [-477.955] (-475.838) (-481.068) -- 0:00:23
627000 -- [-476.367] (-481.066) (-478.702) (-478.759) * (-479.135) [-476.163] (-476.622) (-480.886) -- 0:00:23
627500 -- [-476.920] (-478.236) (-478.708) (-476.687) * (-478.268) (-478.948) [-475.345] (-477.976) -- 0:00:23
628000 -- (-476.930) (-476.680) (-478.300) [-478.405] * [-477.080] (-478.678) (-478.598) (-477.510) -- 0:00:23
628500 -- (-476.455) [-477.712] (-475.259) (-481.929) * (-480.286) (-478.051) (-480.212) [-479.831] -- 0:00:23
629000 -- (-477.087) (-477.556) [-478.019] (-481.005) * (-476.116) (-480.091) (-481.242) [-475.742] -- 0:00:23
629500 -- (-481.491) (-477.819) [-480.485] (-477.229) * (-480.421) (-478.414) (-476.815) [-478.852] -- 0:00:23
630000 -- (-484.095) (-477.126) (-477.760) [-477.431] * (-480.138) (-478.545) [-475.280] (-479.848) -- 0:00:23
Average standard deviation of split frequencies: 0.010315
630500 -- (-476.341) [-477.877] (-476.661) (-486.489) * (-478.784) (-480.282) [-478.745] (-479.248) -- 0:00:23
631000 -- (-478.539) (-478.271) (-479.898) [-478.713] * [-478.689] (-482.698) (-478.475) (-478.285) -- 0:00:23
631500 -- (-478.887) [-476.902] (-482.733) (-476.786) * (-480.632) [-476.480] (-478.637) (-477.932) -- 0:00:23
632000 -- (-479.213) [-478.692] (-477.081) (-476.830) * (-481.180) (-476.517) (-479.480) [-478.169] -- 0:00:23
632500 -- (-479.293) (-478.393) [-477.541] (-479.165) * (-478.219) [-477.207] (-477.879) (-479.063) -- 0:00:23
633000 -- (-478.362) (-479.444) [-477.828] (-480.851) * (-477.401) [-478.064] (-476.532) (-479.128) -- 0:00:23
633500 -- (-477.583) [-477.960] (-478.808) (-478.211) * (-476.913) (-481.114) (-478.653) [-479.824] -- 0:00:23
634000 -- (-477.504) (-478.372) [-478.002] (-479.190) * [-480.673] (-478.219) (-481.856) (-480.143) -- 0:00:23
634500 -- (-479.908) (-478.255) [-476.175] (-477.512) * [-485.945] (-478.550) (-486.461) (-475.856) -- 0:00:23
635000 -- (-478.863) [-479.208] (-479.789) (-479.218) * (-480.010) [-478.332] (-478.287) (-477.768) -- 0:00:23
Average standard deviation of split frequencies: 0.010031
635500 -- (-480.431) (-482.267) (-481.286) [-479.449] * (-478.031) (-477.909) [-479.871] (-477.977) -- 0:00:23
636000 -- (-478.402) (-478.687) (-479.244) [-477.693] * (-477.481) [-478.559] (-482.576) (-475.088) -- 0:00:23
636500 -- (-477.810) (-476.279) [-479.498] (-477.331) * (-480.468) (-478.433) (-478.610) [-477.442] -- 0:00:23
637000 -- (-478.449) (-475.767) (-478.932) [-477.100] * (-479.501) (-479.312) (-479.569) [-478.145] -- 0:00:23
637500 -- (-476.263) (-476.217) (-477.793) [-476.875] * [-479.059] (-483.120) (-480.647) (-478.674) -- 0:00:23
638000 -- [-479.106] (-477.645) (-480.220) (-480.222) * (-477.081) (-482.124) (-480.828) [-478.282] -- 0:00:23
638500 -- (-478.011) (-479.150) [-477.702] (-479.965) * (-480.384) (-475.608) [-478.779] (-482.165) -- 0:00:23
639000 -- (-477.952) (-480.168) [-479.034] (-483.428) * [-478.276] (-479.517) (-478.511) (-479.819) -- 0:00:23
639500 -- (-478.331) (-477.668) [-474.698] (-479.801) * (-477.644) (-480.707) (-479.264) [-477.069] -- 0:00:23
640000 -- [-476.229] (-477.154) (-485.140) (-483.605) * (-483.042) [-477.770] (-481.244) (-476.244) -- 0:00:23
Average standard deviation of split frequencies: 0.009369
640500 -- (-477.860) (-478.033) [-477.449] (-477.363) * (-484.577) [-476.418] (-478.842) (-477.935) -- 0:00:23
641000 -- (-477.194) (-479.152) [-477.551] (-478.153) * (-482.729) [-477.598] (-480.011) (-477.216) -- 0:00:22
641500 -- (-479.584) (-477.576) [-479.760] (-479.984) * [-480.857] (-482.818) (-480.788) (-478.084) -- 0:00:22
642000 -- [-478.452] (-480.684) (-480.558) (-478.541) * [-481.613] (-480.639) (-480.190) (-479.118) -- 0:00:22
642500 -- (-477.679) (-479.699) (-480.756) [-478.024] * (-480.279) (-478.177) (-479.228) [-478.073] -- 0:00:22
643000 -- (-479.145) (-480.655) (-478.929) [-477.298] * (-480.384) [-476.051] (-478.057) (-480.051) -- 0:00:22
643500 -- (-478.027) (-477.550) [-477.916] (-477.150) * (-480.580) [-477.295] (-478.395) (-480.964) -- 0:00:22
644000 -- [-481.536] (-479.356) (-481.675) (-478.415) * (-481.883) (-475.541) (-476.158) [-479.463] -- 0:00:22
644500 -- (-477.951) [-477.532] (-476.946) (-478.412) * (-478.635) (-484.297) [-477.048] (-480.937) -- 0:00:22
645000 -- (-480.183) (-482.363) (-475.221) [-480.010] * (-476.522) (-485.345) (-482.657) [-481.119] -- 0:00:22
Average standard deviation of split frequencies: 0.009389
645500 -- [-478.761] (-481.297) (-479.655) (-479.500) * (-477.802) (-482.337) (-481.795) [-477.347] -- 0:00:22
646000 -- (-477.179) (-476.784) (-479.628) [-476.481] * (-478.615) [-479.237] (-481.648) (-478.041) -- 0:00:22
646500 -- (-474.334) [-479.513] (-478.125) (-481.703) * [-478.373] (-482.891) (-479.333) (-478.834) -- 0:00:22
647000 -- (-476.599) [-476.020] (-482.683) (-478.967) * (-476.524) [-477.292] (-480.820) (-480.555) -- 0:00:22
647500 -- [-478.520] (-477.460) (-482.012) (-477.872) * (-477.140) (-477.887) (-479.870) [-477.644] -- 0:00:22
648000 -- (-476.946) [-477.054] (-477.113) (-479.495) * (-481.112) (-479.908) [-479.229] (-481.200) -- 0:00:22
648500 -- [-476.547] (-476.647) (-479.348) (-479.829) * (-480.342) (-478.515) [-478.719] (-480.211) -- 0:00:22
649000 -- (-477.118) (-476.535) [-479.839] (-482.065) * (-479.247) (-478.513) [-480.177] (-477.644) -- 0:00:22
649500 -- (-481.719) [-477.259] (-478.879) (-479.153) * (-477.146) [-476.209] (-479.962) (-478.266) -- 0:00:22
650000 -- (-481.792) [-476.576] (-477.937) (-481.212) * (-478.874) (-477.298) (-478.324) [-481.006] -- 0:00:22
Average standard deviation of split frequencies: 0.008163
650500 -- (-477.803) (-479.179) [-478.454] (-482.562) * (-480.064) (-479.642) [-478.432] (-476.712) -- 0:00:22
651000 -- [-475.446] (-476.216) (-479.268) (-480.049) * (-480.162) (-479.139) (-479.249) [-478.470] -- 0:00:22
651500 -- (-476.626) (-478.321) [-480.061] (-476.492) * (-478.372) (-477.915) (-477.033) [-479.923] -- 0:00:22
652000 -- (-479.027) (-477.970) [-478.988] (-478.608) * (-481.641) (-484.376) (-476.230) [-477.044] -- 0:00:22
652500 -- (-478.929) (-485.142) [-481.693] (-477.196) * (-481.844) (-480.445) (-479.648) [-479.073] -- 0:00:22
653000 -- (-480.384) (-477.076) (-477.925) [-476.898] * (-476.326) (-479.957) [-479.768] (-476.100) -- 0:00:22
653500 -- (-477.358) (-477.887) [-481.260] (-478.912) * (-478.841) [-477.819] (-478.391) (-475.709) -- 0:00:22
654000 -- [-477.899] (-477.027) (-478.086) (-479.407) * (-477.861) [-476.370] (-477.320) (-479.576) -- 0:00:22
654500 -- (-476.097) (-478.550) (-477.795) [-479.398] * [-475.969] (-478.789) (-477.780) (-478.675) -- 0:00:22
655000 -- (-477.757) (-478.181) (-478.827) [-476.472] * (-479.403) [-476.296] (-482.825) (-479.045) -- 0:00:22
Average standard deviation of split frequencies: 0.008432
655500 -- (-483.594) [-474.727] (-480.716) (-477.223) * (-478.275) [-476.088] (-479.577) (-478.951) -- 0:00:22
656000 -- (-480.699) [-476.239] (-478.006) (-476.493) * [-478.375] (-477.920) (-480.530) (-475.928) -- 0:00:22
656500 -- (-479.441) (-478.225) [-480.103] (-477.354) * (-479.817) (-480.592) [-478.022] (-478.118) -- 0:00:21
657000 -- [-478.868] (-479.909) (-479.915) (-476.154) * (-480.947) (-479.472) [-477.514] (-483.196) -- 0:00:21
657500 -- (-482.613) [-476.944] (-479.133) (-476.219) * (-479.982) (-477.140) (-481.186) [-476.767] -- 0:00:21
658000 -- (-480.139) (-479.270) (-477.408) [-476.659] * (-477.215) [-477.763] (-481.930) (-478.476) -- 0:00:21
658500 -- (-479.200) (-485.685) (-480.778) [-476.161] * (-484.385) (-477.202) (-476.486) [-477.732] -- 0:00:21
659000 -- [-476.839] (-480.976) (-478.209) (-476.818) * (-482.780) (-480.439) (-481.942) [-478.482] -- 0:00:21
659500 -- (-476.825) [-479.799] (-475.801) (-478.121) * [-479.456] (-479.323) (-480.960) (-481.764) -- 0:00:21
660000 -- (-481.777) (-475.617) [-476.917] (-478.624) * (-481.462) [-481.947] (-478.237) (-483.966) -- 0:00:21
Average standard deviation of split frequencies: 0.008562
660500 -- (-484.383) [-475.891] (-478.440) (-477.066) * (-481.041) (-477.999) (-477.569) [-479.167] -- 0:00:21
661000 -- (-485.396) [-477.972] (-480.607) (-475.819) * (-477.108) [-477.038] (-480.598) (-478.320) -- 0:00:21
661500 -- (-478.043) [-478.634] (-479.021) (-479.367) * (-479.143) [-478.236] (-482.183) (-482.803) -- 0:00:21
662000 -- (-478.369) (-476.072) [-478.936] (-477.803) * (-476.580) (-479.732) [-478.006] (-482.624) -- 0:00:21
662500 -- (-481.488) [-478.519] (-477.477) (-478.895) * [-479.202] (-486.304) (-480.164) (-477.322) -- 0:00:21
663000 -- (-477.809) [-481.041] (-478.098) (-475.757) * [-478.958] (-478.133) (-479.466) (-482.236) -- 0:00:21
663500 -- [-477.556] (-478.090) (-483.170) (-476.959) * (-478.318) (-480.207) [-480.042] (-478.463) -- 0:00:21
664000 -- (-477.138) (-477.951) [-484.706] (-478.408) * (-478.428) (-478.770) [-478.572] (-476.242) -- 0:00:21
664500 -- (-479.401) (-476.015) [-481.919] (-478.717) * [-477.406] (-484.292) (-476.282) (-478.704) -- 0:00:21
665000 -- (-479.067) (-482.269) [-477.652] (-477.823) * (-476.693) (-476.236) [-477.994] (-480.059) -- 0:00:21
Average standard deviation of split frequencies: 0.008635
665500 -- (-479.643) [-478.643] (-477.747) (-489.098) * (-478.012) [-479.459] (-478.649) (-480.378) -- 0:00:21
666000 -- (-478.818) (-479.757) [-479.071] (-477.224) * [-478.166] (-478.706) (-478.531) (-480.134) -- 0:00:21
666500 -- (-483.992) [-476.745] (-478.885) (-478.268) * (-476.100) [-479.510] (-479.557) (-478.246) -- 0:00:21
667000 -- (-476.346) (-477.970) [-480.173] (-476.154) * (-479.483) [-477.942] (-478.845) (-478.795) -- 0:00:21
667500 -- (-478.528) (-474.649) [-475.240] (-479.738) * (-477.990) [-476.365] (-479.442) (-482.643) -- 0:00:21
668000 -- (-475.912) (-478.661) [-481.716] (-483.107) * [-478.710] (-480.016) (-480.826) (-477.638) -- 0:00:21
668500 -- (-478.848) (-476.718) (-480.091) [-478.910] * (-480.322) (-478.395) (-476.330) [-477.233] -- 0:00:21
669000 -- (-477.100) (-477.188) [-479.242] (-476.874) * (-478.406) [-477.028] (-479.435) (-476.341) -- 0:00:21
669500 -- [-475.821] (-478.772) (-481.651) (-483.118) * (-477.776) (-479.324) (-481.220) [-476.478] -- 0:00:21
670000 -- (-478.002) (-477.060) [-477.758] (-480.797) * [-478.874] (-477.829) (-477.159) (-481.923) -- 0:00:21
Average standard deviation of split frequencies: 0.008482
670500 -- (-476.743) (-482.572) [-477.677] (-480.246) * (-479.994) [-478.124] (-478.140) (-479.901) -- 0:00:21
671000 -- [-477.638] (-476.073) (-478.376) (-475.640) * (-476.028) [-478.641] (-477.237) (-477.388) -- 0:00:21
671500 -- (-476.774) [-480.492] (-476.191) (-478.807) * (-478.319) (-480.396) [-479.138] (-478.208) -- 0:00:21
672000 -- [-477.066] (-481.961) (-478.190) (-483.531) * [-480.359] (-484.688) (-481.075) (-478.521) -- 0:00:20
672500 -- [-480.438] (-477.135) (-479.349) (-480.909) * (-479.186) (-479.192) [-480.039] (-479.069) -- 0:00:20
673000 -- (-478.871) [-477.665] (-479.952) (-480.931) * (-478.732) (-479.994) [-477.921] (-479.776) -- 0:00:20
673500 -- [-479.639] (-478.219) (-479.120) (-478.923) * [-479.405] (-481.725) (-478.906) (-477.746) -- 0:00:20
674000 -- [-477.349] (-477.699) (-478.317) (-480.108) * (-480.327) [-479.338] (-479.178) (-477.576) -- 0:00:20
674500 -- [-476.692] (-476.691) (-479.309) (-480.599) * (-477.666) (-479.224) [-478.823] (-477.508) -- 0:00:20
675000 -- [-478.891] (-478.673) (-478.059) (-482.131) * (-477.730) [-476.815] (-478.663) (-476.527) -- 0:00:20
Average standard deviation of split frequencies: 0.009019
675500 -- (-477.075) (-476.068) [-477.348] (-485.328) * (-479.982) [-478.597] (-477.074) (-476.588) -- 0:00:20
676000 -- [-477.663] (-479.246) (-480.178) (-477.747) * (-483.747) (-480.366) [-476.698] (-478.124) -- 0:00:20
676500 -- (-477.359) (-478.320) (-481.503) [-481.174] * (-482.187) (-478.410) [-481.488] (-477.206) -- 0:00:20
677000 -- (-480.432) (-482.281) (-476.725) [-478.500] * [-477.521] (-480.778) (-480.219) (-476.124) -- 0:00:20
677500 -- (-476.499) [-477.554] (-479.052) (-479.441) * (-476.980) (-479.993) [-478.398] (-478.656) -- 0:00:20
678000 -- (-478.721) [-476.103] (-481.214) (-479.761) * (-478.716) (-482.502) [-476.998] (-477.176) -- 0:00:20
678500 -- (-477.971) (-484.410) [-476.626] (-483.557) * (-477.026) (-477.128) [-476.035] (-479.122) -- 0:00:20
679000 -- [-478.480] (-480.162) (-477.048) (-479.544) * [-475.760] (-475.693) (-479.436) (-478.074) -- 0:00:20
679500 -- (-479.053) (-480.257) (-477.068) [-481.526] * [-476.837] (-478.531) (-483.367) (-476.888) -- 0:00:20
680000 -- (-483.945) (-478.126) [-476.790] (-482.240) * (-478.056) (-477.711) [-476.682] (-475.173) -- 0:00:20
Average standard deviation of split frequencies: 0.008634
680500 -- (-478.263) (-480.415) [-479.425] (-479.482) * [-481.566] (-477.540) (-478.312) (-478.972) -- 0:00:20
681000 -- (-479.636) (-478.533) [-478.258] (-478.493) * (-483.117) (-482.449) (-478.482) [-476.832] -- 0:00:20
681500 -- (-478.901) (-476.518) (-478.765) [-481.231] * (-479.189) (-478.214) (-477.283) [-476.950] -- 0:00:20
682000 -- [-481.353] (-477.028) (-476.444) (-476.665) * [-481.595] (-477.092) (-477.628) (-483.486) -- 0:00:20
682500 -- (-477.358) (-477.845) [-475.593] (-486.773) * (-480.020) (-481.146) [-476.652] (-475.211) -- 0:00:20
683000 -- [-480.636] (-478.577) (-478.832) (-478.085) * [-479.477] (-477.227) (-478.201) (-478.368) -- 0:00:20
683500 -- [-479.838] (-482.022) (-476.593) (-476.053) * (-481.034) [-475.965] (-480.543) (-475.635) -- 0:00:20
684000 -- (-479.601) (-482.123) [-476.952] (-478.340) * (-481.826) (-478.144) [-479.158] (-476.734) -- 0:00:20
684500 -- (-480.744) [-480.165] (-479.109) (-479.725) * (-476.139) [-477.875] (-479.481) (-478.667) -- 