--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 29 16:52:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/59/CG13024-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2261.27 -2277.12
2 -2260.41 -2280.46
--------------------------------------
TOTAL -2260.75 -2279.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.841505 0.009048 0.660054 1.032162 0.836592 1241.14 1303.64 1.002
r(A<->C){all} 0.084631 0.000482 0.045773 0.131166 0.082463 830.31 984.92 1.002
r(A<->G){all} 0.196191 0.001352 0.130806 0.271519 0.194246 749.50 846.99 1.000
r(A<->T){all} 0.097399 0.000851 0.042826 0.153747 0.095438 880.82 964.53 1.000
r(C<->G){all} 0.082316 0.000351 0.047246 0.118439 0.080934 1023.84 1092.23 1.000
r(C<->T){all} 0.478794 0.002611 0.382009 0.582681 0.478413 624.22 773.61 1.001
r(G<->T){all} 0.060669 0.000499 0.018914 0.104192 0.059019 839.61 904.19 1.001
pi(A){all} 0.248869 0.000222 0.221265 0.279009 0.248833 767.94 841.68 1.000
pi(C){all} 0.312882 0.000240 0.280364 0.341419 0.313027 1063.88 1109.26 1.000
pi(G){all} 0.264497 0.000228 0.236056 0.294190 0.264093 1075.30 1125.39 1.000
pi(T){all} 0.173752 0.000152 0.149313 0.197112 0.173952 1253.27 1272.81 1.000
alpha{1,2} 0.108433 0.000455 0.066212 0.148127 0.107744 1048.59 1160.22 1.001
alpha{3} 2.684284 0.818886 1.121466 4.430236 2.533277 1139.69 1298.12 1.000
pinvar{all} 0.471626 0.002580 0.367389 0.564782 0.474267 1362.89 1431.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2068.545247
Model 2: PositiveSelection -2068.545254
Model 0: one-ratio -2100.921239
Model 3: discrete -2064.380859
Model 7: beta -2068.902002
Model 8: beta&w>1 -2064.620651
Model 0 vs 1 64.75198399999954
Model 2 vs 1 1.4000000192027073E-5
Model 8 vs 7 8.562701999999263
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.579 1.267
57 I 0.998** 1.993
158 A 0.975* 1.954
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.505 1.233 +- 0.802
57 I 0.978* 2.390 +- 1.270
158 A 0.909 2.234 +- 1.258
>C1
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNTSSIHNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLAIGSGKDA
VIAIEGQQPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKR
GLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C2
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSGSINNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLSLGSGKDA
VIAIEGQQPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKR
GLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C3
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSINNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLALGSGKDA
VIAIEGQQPADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKR
GLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C4
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSINNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASGKDA
VIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKP
KRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooo
>C5
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNINNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPSNPSTSNYNANLTLASGKDA
VIAIEGQQPGDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKR
GLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooo
>C6
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSHMNNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAA
SGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLTLATSGN
KDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPP
KKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSo
>C7
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSSHITNNNSNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTR
SAASGSLLLTAANLERFAEIHKKQERHNKMLMPGHPTSSNYNANLTLASG
KDAVIAIEGQPPAEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKK
PKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo
>C8
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNANNNNNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTR
SAASGSLLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASG
KDAVIAIEGQQPNEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKK
PKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSooo
>C9
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPGHPSSSNYNANLTL
ATGQDAVITIDGQQPSEVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGP
PKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKS
>C10
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNTNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNNSTRSAAS
GSLLLTAANLERFAEIHKKQERHNKMLMPSNPSSSNYNANLTLASGKDAV
IAIEGQPEDVDPNLQYVKTKDLDTVSIASSMHFTMVNGEGGPPKKPKRGL
CDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMPKSoooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=260
C1 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C2 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C3 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C4 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C5 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C6 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C7 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C8 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C9 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
C10 MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
**************************************************
C1 PSNTSSIH---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C2 PSNSGSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C3 PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C4 PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C5 PSNSSNIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C6 PSNSSHMN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C7 PSNSSSSHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C8 PSNSSNANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C9 PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
C10 PSNSSNTN---NNN----TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
***:. : **. ********************************
C1 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
C2 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLS
C3 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
C4 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
C5 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLT
C6 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLT
C7 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLT
C8 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
C9 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLT
C10 STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
************************************ .:*::*******:
C1 IGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
C2 LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
C3 LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
C4 LASG--KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVN
C5 LASG--KDAVIAIEGQQP--GDVDPNLQYVKTKDLDTVSIASSMHFTMVN
C6 LATSGNKDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVN
C7 LASG--KDAVIAIEGQPP--AEVDPNLQYVKTKDLDTVSIASSMHFTMVN
C8 LASG--KDAVIAIEGQQP--NEVDPNLQYVKTKDLDTVSIASSMHFTMVN
C9 LATG--QDAVITIDGQQP--SEVDPNLQYVKTKDLDTVSIASSMHFTMVN
C10 LASG--KDAVIAIEGQ-P--EDVDPNLQYVKTKDLDTVSIASSMHFTMVN
:.:. :****:*:** ::***************************
C1 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C2 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C3 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C4 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C5 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C6 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C7 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C8 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C9 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
C10 GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
**************************************************
C1 KSoooooo--
C2 KSoooooo--
C3 KSoooooo--
C4 KSoooo----
C5 KSoooooo--
C6 KSo-------
C7 KSooo-----
C8 KSooo-----
C9 KS--------
C10 KSoooooooo
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 247 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [25400]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [25400]--->[24835]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/59/CG13024-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.567 Mb, Max= 31.230 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNTSSIH---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
IGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C2
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSGSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLS
LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C3
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C4
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
LASG--KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooo----
>C5
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLT
LASG--KDAVIAIEGQQP--GDVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C6
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSHMN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLT
LATSGNKDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSo-------
>C7
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSSHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLT
LASG--KDAVIAIEGQPP--AEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSooo-----
>C8
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
LASG--KDAVIAIEGQQP--NEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSooo-----
>C9
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLT
LATG--QDAVITIDGQQP--SEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS--------
>C10
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNTN---NNN----TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
LASG--KDAVIAIEGQ-P--EDVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooooo
FORMAT of file /tmp/tmp786384143709578802aln Not Supported[FATAL:T-COFFEE]
>C1
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNTSSIH---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
IGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C2
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSGSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLS
LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C3
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C4
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
LASG--KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooo----
>C5
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLT
LASG--KDAVIAIEGQQP--GDVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooo--
>C6
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSHMN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLT
LATSGNKDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSo-------
>C7
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSSHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLT
LASG--KDAVIAIEGQPP--AEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSooo-----
>C8
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
LASG--KDAVIAIEGQQP--NEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSooo-----
>C9
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLT
LATG--QDAVITIDGQQP--SEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS--------
>C10
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNTN---NNN----TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
LASG--KDAVIAIEGQ-P--EDVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KSoooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:260 S:97 BS:260
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 97.98 C1 C2 97.98
TOP 1 0 97.98 C2 C1 97.98
BOT 0 2 98.79 C1 C3 98.79
TOP 2 0 98.79 C3 C1 98.79
BOT 0 3 97.55 C1 C4 97.55
TOP 3 0 97.55 C4 C1 97.55
BOT 0 4 96.76 C1 C5 96.76
TOP 4 0 96.76 C5 C1 96.76
BOT 0 5 95.04 C1 C6 95.04
TOP 5 0 95.04 C6 C1 95.04
BOT 0 6 95.49 C1 C7 95.49
TOP 6 0 95.49 C7 C1 95.49
BOT 0 7 96.31 C1 C8 96.31
TOP 7 0 96.31 C8 C1 96.31
BOT 0 8 93.36 C1 C9 93.36
TOP 8 0 93.36 C9 C1 93.36
BOT 0 9 96.73 C1 C10 96.73
TOP 9 0 96.73 C10 C1 96.73
BOT 1 2 99.19 C2 C3 99.19
TOP 2 1 99.19 C3 C2 99.19
BOT 1 3 98.37 C2 C4 98.37
TOP 3 1 98.37 C4 C2 98.37
BOT 1 4 97.57 C2 C5 97.57
TOP 4 1 97.57 C5 C2 97.57
BOT 1 5 95.87 C2 C6 95.87
TOP 5 1 95.87 C6 C2 95.87
BOT 1 6 95.49 C2 C7 95.49
TOP 6 1 95.49 C7 C2 95.49
BOT 1 7 97.13 C2 C8 97.13
TOP 7 1 97.13 C8 C2 97.13
BOT 1 8 94.19 C2 C9 94.19
TOP 8 1 94.19 C9 C2 94.19
BOT 1 9 97.55 C2 C10 97.55
TOP 9 1 97.55 C10 C2 97.55
BOT 2 3 98.78 C3 C4 98.78
TOP 3 2 98.78 C4 C3 98.78
BOT 2 4 97.98 C3 C5 97.98
TOP 4 2 97.98 C5 C3 97.98
BOT 2 5 96.28 C3 C6 96.28
TOP 5 2 96.28 C6 C3 96.28
BOT 2 6 95.90 C3 C7 95.90
TOP 6 2 95.90 C7 C3 95.90
BOT 2 7 97.54 C3 C8 97.54
TOP 7 2 97.54 C8 C3 97.54
BOT 2 8 94.61 C3 C9 94.61
TOP 8 2 94.61 C9 C3 94.61
BOT 2 9 97.96 C3 C10 97.96
TOP 9 2 97.96 C10 C3 97.96
BOT 3 4 98.37 C4 C5 98.37
TOP 4 3 98.37 C5 C4 98.37
BOT 3 5 96.72 C4 C6 96.72
TOP 5 3 96.72 C6 C4 96.72
BOT 3 6 96.31 C4 C7 96.31
TOP 6 3 96.31 C7 C4 96.31
BOT 3 7 97.95 C4 C8 97.95
TOP 7 3 97.95 C8 C4 97.95
BOT 3 8 95.02 C4 C9 95.02
TOP 8 3 95.02 C9 C4 95.02
BOT 3 9 98.35 C4 C10 98.35
TOP 9 3 98.35 C10 C4 98.35
BOT 4 5 96.28 C5 C6 96.28
TOP 5 4 96.28 C6 C5 96.28
BOT 4 6 95.49 C5 C7 95.49
TOP 6 4 95.49 C7 C5 95.49
BOT 4 7 98.36 C5 C8 98.36
TOP 7 4 98.36 C8 C5 98.36
BOT 4 8 95.44 C5 C9 95.44
TOP 8 4 95.44 C9 C5 95.44
BOT 4 9 98.78 C5 C10 98.78
TOP 9 4 98.78 C10 C5 98.78
BOT 5 6 95.04 C6 C7 95.04
TOP 6 5 95.04 C7 C6 95.04
BOT 5 7 97.11 C6 C8 97.11
TOP 7 5 97.11 C8 C6 97.11
BOT 5 8 95.02 C6 C9 95.02
TOP 8 5 95.02 C9 C6 95.02
BOT 5 9 96.67 C6 C10 96.67
TOP 9 5 96.67 C10 C6 96.67
BOT 6 7 95.55 C7 C8 95.55
TOP 7 6 95.55 C8 C7 95.55
BOT 6 8 95.08 C7 C9 95.08
TOP 8 6 95.08 C9 C7 95.08
BOT 6 9 96.28 C7 C10 96.28
TOP 9 6 96.28 C10 C7 96.28
BOT 7 8 95.90 C8 C9 95.90
TOP 8 7 95.90 C9 C8 95.90
BOT 7 9 98.76 C8 C10 98.76
TOP 9 7 98.76 C10 C8 98.76
BOT 8 9 95.82 C9 C10 95.82
TOP 9 8 95.82 C10 C9 95.82
AVG 0 C1 * 96.45
AVG 1 C2 * 97.04
AVG 2 C3 * 97.45
AVG 3 C4 * 97.49
AVG 4 C5 * 97.22
AVG 5 C6 * 96.00
AVG 6 C7 * 95.63
AVG 7 C8 * 97.18
AVG 8 C9 * 94.94
AVG 9 C10 * 97.43
TOT TOT * 96.68
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
C2 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
C3 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
C4 ATGGATGCGCCCAAGCAGATGCAGGACTACTGGCACATTCCCCGCGCCTC
C5 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
C6 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCACGCGCCTC
C7 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCACGCGCCTC
C8 ATGGATGCGCCCAAGCAGATGCAGGACTACTGGCACATTCCCCGCGCCTC
C9 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
C10 ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
***************************** ***********.********
C1 GCTGGCATCCTCCTCGAGCTCGGCCATTAGTTCGGCCAGCTCGTCCAAGT
C2 GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
C3 GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
C4 GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
C5 GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
C6 GCTGGCCTCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT
C7 GCTGGCCTCCTCGTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCGAAGT
C8 TCTGGCCTCATCCTCAAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT
C9 GCTGGCCTCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT
C10 GCTGGCCTCTTCCTCGAGCTCGGCCATCAGTTCGGCGAGCTCCTCCAAGT
*****.** ** **.*********** ******** ***** ** ****
C1 CCTCGAACAAATCGCACTCCAATCCACCTACCCTAAACCAACGCAGTTCG
C2 CCTCGAACAAATCGCACTCGAATCCGCCTACCCTAAACCAGCGCAGTTCG
C3 CCTCGAACAAATCGCACTCGAATCCGCCTACCCTAAACCAGCGCAGTTCG
C4 CCTCCAACAAATCGCATTCGAATCCGCCTACCCTGAACCAGCGCAGTTCG
C5 CCTCAAACAAATCGCATTCGAATCCGCCCACACTGAACCAGCGCAGTTCG
C6 CCTCGAACAAATCGCACTCGAATCCACCCACCCTCAACCAGCGCAGTTCG
C7 CCTCGAACAAATCGCACTCGAATCCGCCCACCCTTAACCAGCGCAGTTCG
C8 CCTCGAACAAATCGCACTCGAATCCGCCCACCCTCAACCAGCGGAGTTCG
C9 CCTCAAACAAGTCGCACTCGAATCCGCCCACCCTCAACCAGCGCAGTTCC
C10 CCTCGAACAAATCACACTCGAATCCGCCCACCCTGAACCAACGTAGTTCG
**** *****.**.** ** *****.** **.** *****.** *****
C1 CCCAGTAACACTAGCAGCATTCAC---------AATAACAATAAT-----
C2 CCCAGTAACAGTGGCAGCATTAAC---------AATAACAATAAT-----
C3 CCCAGTAACAGTAGCAGCATTAAC---------AATAACAATAAT-----
C4 CCCAGTAACAGTAGCAGCATTAAC---------AATAACAACAAT-----
C5 CCCAGTAACAGTAGCAACATTAAC---------AATAACAATAAT-----
C6 CCCAGCAACAGTAGCCATATGAAT---------AACAACAATAAT-----
C7 CCCAGCAACAGTAGCAGCAGCCATATTACCAACAATAATAGCAAT-----
C8 CCCAGCAACAGCAGCAATGCAAATAATAATAATAATAATAATAAT-----
C9 CCAAGCAACAGTAGCAATGTTAATAATGTTAACAACAACAGCAACAACAA
C10 CCCAGCAACAGTAGCAATACTAAC---------AACAATAAT--------
**.** **** .**.. . .* ** ** *.
C1 ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCCGCTGTTCTGGCGG
C2 ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCGG
C3 ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCGG
C4 ----ACAAGTGCTGCTGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCTG
C5 ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCTG
C6 ----ACAAGTGCTGCTGTTACGGCGGCGGCGGCGGCTGCGGTTCTGGCGG
C7 ----ACCAGTGCTGCTGTTACGGCGGCGGCAGCGGCGGCGGTTCTGGCGG
C8 ----ACAAGTGCTGCTGTTACGGCGGCGGCTGCGGCAGCGGTACTGGCTG
C9 TAATACAAGTGCTGCTGTGACAGCGGCGGCAGCGGCAGCGGTACTAGCAG
C10 ----ACAAGTGCCGCAGTGACGGCCGCAGCAGCGGCAGCAGTACTGGCGG
**.***** **:** ** ** **.** ***** ** **:**.** *
C1 CTGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC
C2 CAGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC
C3 CAGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC
C4 CTGCCAAGAGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGTAACAAC
C5 CTGCCAAGAGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGTAACAAC
C6 CCGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGCAACAAC
C7 CCGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGCAACAAC
C8 CTGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGTAACAAC
C9 CTGCCAAGCGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGCAACAAC
C10 CCGCCAAGCGGGGATCGAGAAGTTCGCAGGGCTCCAGCGACAGCAACAAC
* ******.**********.** ** ***************** ******
C1 AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
C2 AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
C3 AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
C4 AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
C5 AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
C6 AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTAACGGCAGCGAATCT
C7 AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTGACGGCAGCGAATCT
C8 AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
C9 AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTGACGGCAGCGAATCT
C10 AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
*****.*************************** *.**************
C1 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGACACAACAAGATGC
C2 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
C3 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
C4 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
C5 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
C6 GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
C7 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC
C8 GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
C9 GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC
C10 GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC
********* ************************** *************
C1 TGATGCCC---AGTAATCCCTCCTCGTCAAACTATAATGCCAACCTGGCC
C2 TGATGCCC---AGCAATCCCTCCTCGTCCAACTATAATGCCAACCTGTCC
C3 TGATGCCC---AGCAATCCCTCCTCGTCAAACTATAATGCTAACCTGGCC
C4 TGATGCCC---AGCAATCCCTCCTCCTCAAACTACAACGCCAACCTGACC
C5 TGATGCCC---AGCAATCCCTCCACTTCAAACTACAACGCCAACCTGACT
C6 TGATGCCGCCCAGCAATCCCTCGTCGTCCAACTACAATGCCAACCTGACG
C7 TGATGCCC---GGCCATCCCACGTCGTCCAACTACAATGCCAACCTGACG
C8 TGATGCCC---AGTAATCCTTCGTCGTCCAACTACAATGCCAATCTGACG
C9 TGATGCCC---GGCCATCCATCTTCGTCCAACTACAATGCCAACCTAACG
C10 TGATGCCC---AGCAATCCCTCGTCGTCCAACTACAATGCCAACCTAACG
******* .* .**** :* :* **.***** ** ** ** **. *
C1 ATCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA
C2 CTCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA
C3 CTCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA
C4 CTCGCTAGCGGC------AAGGATGCAGTTATCGCCATCGAGGGTCAGCA
C5 CTCGCCAGTGGC------AAGGATGCGGTTATTGCCATCGAGGGTCAGCA
C6 CTGGCAACGAGCGGCAACAAGGATGCGGTAATCGCCATCGAGGGCCAGCA
C7 CTGGCCAGCGGC------AAGGATGCGGTCATCGCCATCGAGGGCCAGCC
C8 CTAGCCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGCCAACA
C9 CTCGCCACTGGC------CAGGATGCGGTGATCACCATCGATGGCCAGCA
C10 CTCGCCAGCGGC------AAGGATGCGGTGATCGCCATCGAGGGCCAG--
.* * * .** .*******.** ** .******* ** **.
C1 GCCA------GCCGACGTCGATCCCAACTTGCAGTATGTGAAAACCAAAG
C2 GCCG------GCCGACGTCGATCCCAATTTGCAGTATGTGAAAACCAAAG
C3 GCCG------GCCGACGTCGATCCCAATTTGCAGTATGTGAAAACCAAAG
C4 GTCGTCAGCGGCCGACGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG
C5 GCCG------GGTGACGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG
C6 GCAGCCGGCGGCCGAGATGGATCCCAATTTGCAGTATGTGAAAACCAAAG
C7 GCCG------GCCGAGGTGGATCCCAATTTGCAGTACGTGAAAACCAAAG
C8 GCCG------AACGAAGTGGATCCCAATTTGCAGTACGTGAAAACCAAAG
C9 GCCA------TCGGAAGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG
C10 -CCG------GAAGATGTTGATCCCAATTTGCAGTATGTGAAAACCAAAG
.. ** .* ******** ******** *************
C1 ACCTGGATACCGTATCCATCGCTAGCTCTATGCACTTCACGATGGTCAAT
C2 ACCTGGATACCGTATCCATCGCTAGCTCCATGCACTTCACGATGGTCAAT
C3 ACCTGGATACCGTATCCATCGCTAGCTCCATGCACTTCACGATGGTCAAT
C4 ACCTGGATACCGTATCCATTGCTAGCTCCATGCACTTCACGATGGTCAAT
C5 ACCTGGATACCGTATCCATTGCTAGCTCCATGCATTTTACGATGGTCAAT
C6 ACCTGGACACCGTGTCCATCGCTAGCTCCATGCACTTTACGATGGTCAAC
C7 ACCTGGACACCGTGTCCATCGCCAGCTCCATGCACTTTACGATGGTCAAC
C8 ACCTGGACACCGTATCCATTGCGAGCTCTATGCACTTCACGATGGTCAAT
C9 ACCTGGACACCGTATCCATTGCCAGCTCGATGCACTTTACGATGGTCAAC
C10 ACCTGGACACCGTATCCATCGCCAGCTCCATGCACTTCACGATGGTCAAT
******* *****.***** ** ***** ***** ** ***********
C1 GGAGAGGGTGGTCCACCGAAGAAACCGAAGCGCGGTCTATGCGATCGGGG
C2 GGAGAGGGTGGTCCGCCAAAGAAACCGAAGCGTGGTCTATGCGATCGCGG
C3 GGAGAGGGTGGTCCGCCAAAGAAACCGAAGCGTGGTCTATGCGATCGCGG
C4 GGAGAGGGTGGTCCGCCGAAGAAGCCGAAGCGCGGTCTCTGCGATCGGGG
C5 GGAGAGGGTGGTCCGCCGAAGAAACCGAAGCGTGGTCTCTGCGATCGGGG
C6 GGAGAGGGCGGTCCGCCCAAGAAACCGAAGCGCGGCCTCTGCGATCGGGG
C7 GGCGAGGGTGGTCCGCCCAAGAAGCCCAAGCGCGGCCTCTGCGATCGGGG
C8 GGAGAAGGTGGTCCCCCGAAGAAACCGAAGCGTGGTCTCTGCGATCGTGG
C9 GGCGAGGGTGGTCCGCCCAAGAAGCCCAAGCGCGGTCTCTGCGATCGAGG
C10 GGGGAGGGTGGTCCGCCCAAGAAACCGAAGCGCGGTCTCTGCGATCGGGG
** **.** ***** ** *****.** ***** ** **.******** **
C1 GCGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC
C2 ACGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC
C3 ACGCCAGGTCACCGTGTTGATTGTCAGCATGAGTACCATCTTCATGCTGC
C4 ACGCCAGGTCACCGTATTGATAGTCAGCATGAGTACCATCTTCATGCTGC
C5 ACGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC
C6 ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTTATGCTGC
C7 ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTCATGCTGC
C8 ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTTATGCTGC
C9 ACGCCAGGTCACCGTGTTGATTGTGAGCATGAGTACCATCTTCATGCTCC
C10 ACGCCAGGTCACCGTGTTGATTGTGAGCATGAGCACCATCTTTATGCTGC
.**************.*****:** ******** ******** ***** *
C1 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC
C2 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC
C3 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
C4 TCATCATGGGCATGGTCTATGCGCTAGAGATGCGCGCCCGCGACATGCCC
C5 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
C6 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
C7 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
C8 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
C9 TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
C10 TCATTATGGGAATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC
**** *****.**************.************** *********
C1 AAGAGC------------------------
C2 AAGAGC------------------------
C3 AAGAGC------------------------
C4 AAGAGC------------------------
C5 AAGAGC------------------------
C6 AAGAGC------------------------
C7 AAGAGC------------------------
C8 AAGAGC------------------------
C9 AAGAGC------------------------
C10 AAGAGC------------------------
******
>C1
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
GCTGGCATCCTCCTCGAGCTCGGCCATTAGTTCGGCCAGCTCGTCCAAGT
CCTCGAACAAATCGCACTCCAATCCACCTACCCTAAACCAACGCAGTTCG
CCCAGTAACACTAGCAGCATTCAC---------AATAACAATAAT-----
----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCCGCTGTTCTGGCGG
CTGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC
AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGACACAACAAGATGC
TGATGCCC---AGTAATCCCTCCTCGTCAAACTATAATGCCAACCTGGCC
ATCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA
GCCA------GCCGACGTCGATCCCAACTTGCAGTATGTGAAAACCAAAG
ACCTGGATACCGTATCCATCGCTAGCTCTATGCACTTCACGATGGTCAAT
GGAGAGGGTGGTCCACCGAAGAAACCGAAGCGCGGTCTATGCGATCGGGG
GCGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC
AAGAGC------------------------
>C2
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
CCTCGAACAAATCGCACTCGAATCCGCCTACCCTAAACCAGCGCAGTTCG
CCCAGTAACAGTGGCAGCATTAAC---------AATAACAATAAT-----
----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCGG
CAGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC
AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
TGATGCCC---AGCAATCCCTCCTCGTCCAACTATAATGCCAACCTGTCC
CTCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA
GCCG------GCCGACGTCGATCCCAATTTGCAGTATGTGAAAACCAAAG
ACCTGGATACCGTATCCATCGCTAGCTCCATGCACTTCACGATGGTCAAT
GGAGAGGGTGGTCCGCCAAAGAAACCGAAGCGTGGTCTATGCGATCGCGG
ACGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC
AAGAGC------------------------
>C3
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
CCTCGAACAAATCGCACTCGAATCCGCCTACCCTAAACCAGCGCAGTTCG
CCCAGTAACAGTAGCAGCATTAAC---------AATAACAATAAT-----
----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCGG
CAGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC
AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
TGATGCCC---AGCAATCCCTCCTCGTCAAACTATAATGCTAACCTGGCC
CTCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA
GCCG------GCCGACGTCGATCCCAATTTGCAGTATGTGAAAACCAAAG
ACCTGGATACCGTATCCATCGCTAGCTCCATGCACTTCACGATGGTCAAT
GGAGAGGGTGGTCCGCCAAAGAAACCGAAGCGTGGTCTATGCGATCGCGG
ACGCCAGGTCACCGTGTTGATTGTCAGCATGAGTACCATCTTCATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C4
ATGGATGCGCCCAAGCAGATGCAGGACTACTGGCACATTCCCCGCGCCTC
GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
CCTCCAACAAATCGCATTCGAATCCGCCTACCCTGAACCAGCGCAGTTCG
CCCAGTAACAGTAGCAGCATTAAC---------AATAACAACAAT-----
----ACAAGTGCTGCTGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCTG
CTGCCAAGAGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGTAACAAC
AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
TGATGCCC---AGCAATCCCTCCTCCTCAAACTACAACGCCAACCTGACC
CTCGCTAGCGGC------AAGGATGCAGTTATCGCCATCGAGGGTCAGCA
GTCGTCAGCGGCCGACGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG
ACCTGGATACCGTATCCATTGCTAGCTCCATGCACTTCACGATGGTCAAT
GGAGAGGGTGGTCCGCCGAAGAAGCCGAAGCGCGGTCTCTGCGATCGGGG
ACGCCAGGTCACCGTATTGATAGTCAGCATGAGTACCATCTTCATGCTGC
TCATCATGGGCATGGTCTATGCGCTAGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C5
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT
CCTCAAACAAATCGCATTCGAATCCGCCCACACTGAACCAGCGCAGTTCG
CCCAGTAACAGTAGCAACATTAAC---------AATAACAATAAT-----
----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCTG
CTGCCAAGAGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGTAACAAC
AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
TGATGCCC---AGCAATCCCTCCACTTCAAACTACAACGCCAACCTGACT
CTCGCCAGTGGC------AAGGATGCGGTTATTGCCATCGAGGGTCAGCA
GCCG------GGTGACGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG
ACCTGGATACCGTATCCATTGCTAGCTCCATGCATTTTACGATGGTCAAT
GGAGAGGGTGGTCCGCCGAAGAAACCGAAGCGTGGTCTCTGCGATCGGGG
ACGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C6
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCACGCGCCTC
GCTGGCCTCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT
CCTCGAACAAATCGCACTCGAATCCACCCACCCTCAACCAGCGCAGTTCG
CCCAGCAACAGTAGCCATATGAAT---------AACAACAATAAT-----
----ACAAGTGCTGCTGTTACGGCGGCGGCGGCGGCTGCGGTTCTGGCGG
CCGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGCAACAAC
AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTAACGGCAGCGAATCT
GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
TGATGCCGCCCAGCAATCCCTCGTCGTCCAACTACAATGCCAACCTGACG
CTGGCAACGAGCGGCAACAAGGATGCGGTAATCGCCATCGAGGGCCAGCA
GCAGCCGGCGGCCGAGATGGATCCCAATTTGCAGTATGTGAAAACCAAAG
ACCTGGACACCGTGTCCATCGCTAGCTCCATGCACTTTACGATGGTCAAC
GGAGAGGGCGGTCCGCCCAAGAAACCGAAGCGCGGCCTCTGCGATCGGGG
ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTTATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C7
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCACGCGCCTC
GCTGGCCTCCTCGTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCGAAGT
CCTCGAACAAATCGCACTCGAATCCGCCCACCCTTAACCAGCGCAGTTCG
CCCAGCAACAGTAGCAGCAGCCATATTACCAACAATAATAGCAAT-----
----ACCAGTGCTGCTGTTACGGCGGCGGCAGCGGCGGCGGTTCTGGCGG
CCGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGCAACAAC
AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC
TGATGCCC---GGCCATCCCACGTCGTCCAACTACAATGCCAACCTGACG
CTGGCCAGCGGC------AAGGATGCGGTCATCGCCATCGAGGGCCAGCC
GCCG------GCCGAGGTGGATCCCAATTTGCAGTACGTGAAAACCAAAG
ACCTGGACACCGTGTCCATCGCCAGCTCCATGCACTTTACGATGGTCAAC
GGCGAGGGTGGTCCGCCCAAGAAGCCCAAGCGCGGCCTCTGCGATCGGGG
ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTCATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C8
ATGGATGCGCCCAAGCAGATGCAGGACTACTGGCACATTCCCCGCGCCTC
TCTGGCCTCATCCTCAAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT
CCTCGAACAAATCGCACTCGAATCCGCCCACCCTCAACCAGCGGAGTTCG
CCCAGCAACAGCAGCAATGCAAATAATAATAATAATAATAATAAT-----
----ACAAGTGCTGCTGTTACGGCGGCGGCTGCGGCAGCGGTACTGGCTG
CTGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGTAACAAC
AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC
TGATGCCC---AGTAATCCTTCGTCGTCCAACTACAATGCCAATCTGACG
CTAGCCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGCCAACA
GCCG------AACGAAGTGGATCCCAATTTGCAGTACGTGAAAACCAAAG
ACCTGGACACCGTATCCATTGCGAGCTCTATGCACTTCACGATGGTCAAT
GGAGAAGGTGGTCCCCCGAAGAAACCGAAGCGTGGTCTCTGCGATCGTGG
ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTTATGCTGC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C9
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
GCTGGCCTCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT
CCTCAAACAAGTCGCACTCGAATCCGCCCACCCTCAACCAGCGCAGTTCC
CCAAGCAACAGTAGCAATGTTAATAATGTTAACAACAACAGCAACAACAA
TAATACAAGTGCTGCTGTGACAGCGGCGGCAGCGGCAGCGGTACTAGCAG
CTGCCAAGCGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGCAACAAC
AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTGACGGCAGCGAATCT
GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC
TGATGCCC---GGCCATCCATCTTCGTCCAACTACAATGCCAACCTAACG
CTCGCCACTGGC------CAGGATGCGGTGATCACCATCGATGGCCAGCA
GCCA------TCGGAAGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG
ACCTGGACACCGTATCCATTGCCAGCTCGATGCACTTTACGATGGTCAAC
GGCGAGGGTGGTCCGCCCAAGAAGCCCAAGCGCGGTCTCTGCGATCGAGG
ACGCCAGGTCACCGTGTTGATTGTGAGCATGAGTACCATCTTCATGCTCC
TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC
AAGAGC------------------------
>C10
ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC
GCTGGCCTCTTCCTCGAGCTCGGCCATCAGTTCGGCGAGCTCCTCCAAGT
CCTCGAACAAATCACACTCGAATCCGCCCACCCTGAACCAACGTAGTTCG
CCCAGCAACAGTAGCAATACTAAC---------AACAATAAT--------
----ACAAGTGCCGCAGTGACGGCCGCAGCAGCGGCAGCAGTACTGGCGG
CCGCCAAGCGGGGATCGAGAAGTTCGCAGGGCTCCAGCGACAGCAACAAC
AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT
GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC
TGATGCCC---AGCAATCCCTCGTCGTCCAACTACAATGCCAACCTAACG
CTCGCCAGCGGC------AAGGATGCGGTGATCGCCATCGAGGGCCAG--
-CCG------GAAGATGTTGATCCCAATTTGCAGTATGTGAAAACCAAAG
ACCTGGACACCGTATCCATCGCCAGCTCCATGCACTTCACGATGGTCAAT
GGGGAGGGTGGTCCGCCCAAGAAACCGAAGCGCGGTCTCTGCGATCGGGG
ACGCCAGGTCACCGTGTTGATTGTGAGCATGAGCACCATCTTTATGCTGC
TCATTATGGGAATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC
AAGAGC------------------------
>C1
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNTSSIHoooNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLA
IGSGooKDAVIAIEGQQPooADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C2
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSGSINoooNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLS
LGSGooKDAVIAIEGQQPooADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C3
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSINoooNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLA
LGSGooKDAVIAIEGQQPooADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C4
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSINoooNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLT
LASGooKDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C5
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNINoooNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSTSNYNANLT
LASGooKDAVIAIEGQQPooGDVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C6
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSHMNoooNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLT
LATSGNKDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C7
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSSSHITNNNSNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoGHPTSSNYNANLT
LASGooKDAVIAIEGQPPooAEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C8
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNANNNNNNNNoooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLT
LASGooKDAVIAIEGQQPooNEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C9
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoGHPSSSNYNANLT
LATGooQDAVITIDGQQPooSEVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
>C10
MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
PSNSSNTNoooNNNooooTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPoSNPSSSNYNANLT
LASGooKDAVIAIEGQoPooEDVDPNLQYVKTKDLDTVSIASSMHFTMVN
GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
KS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 780 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480437510
Setting output file names to "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 386907165
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4572354064
Seed = 1946747022
Swapseed = 1480437510
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 32 unique site patterns
Division 2 has 23 unique site patterns
Division 3 has 117 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3184.831961 -- -24.412588
Chain 2 -- -3181.645077 -- -24.412588
Chain 3 -- -3268.032586 -- -24.412588
Chain 4 -- -3314.580653 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3232.025449 -- -24.412588
Chain 2 -- -3184.183570 -- -24.412588
Chain 3 -- -3267.672121 -- -24.412588
Chain 4 -- -3232.208463 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3184.832] (-3181.645) (-3268.033) (-3314.581) * [-3232.025] (-3184.184) (-3267.672) (-3232.208)
500 -- (-2395.446) (-2399.890) (-2418.685) [-2393.187] * (-2457.552) (-2409.891) (-2449.698) [-2394.401] -- 0:00:00
1000 -- (-2377.491) (-2372.122) (-2372.505) [-2326.037] * (-2367.361) [-2346.514] (-2403.559) (-2371.271) -- 0:00:00
1500 -- (-2342.622) (-2339.221) (-2332.155) [-2300.081] * (-2338.003) [-2323.937] (-2349.697) (-2335.869) -- 0:11:05
2000 -- (-2321.740) (-2316.100) (-2277.878) [-2284.103] * (-2290.984) [-2274.316] (-2344.892) (-2320.028) -- 0:08:19
2500 -- (-2313.978) (-2281.577) [-2275.097] (-2287.022) * [-2281.600] (-2281.443) (-2300.558) (-2288.949) -- 0:06:39
3000 -- (-2274.290) (-2263.575) (-2267.908) [-2264.354] * (-2265.410) (-2282.333) [-2276.750] (-2287.500) -- 0:05:32
3500 -- [-2265.456] (-2263.960) (-2268.312) (-2276.878) * (-2262.765) [-2267.100] (-2277.428) (-2278.338) -- 0:09:29
4000 -- [-2269.991] (-2268.617) (-2269.099) (-2275.835) * (-2270.569) [-2268.790] (-2281.837) (-2274.093) -- 0:08:18
4500 -- (-2266.990) (-2271.446) [-2271.690] (-2273.505) * (-2268.756) [-2261.474] (-2266.742) (-2275.862) -- 0:07:22
5000 -- [-2268.996] (-2282.093) (-2274.519) (-2268.274) * (-2276.028) (-2277.351) (-2270.167) [-2268.717] -- 0:06:38
Average standard deviation of split frequencies: 0.041903
5500 -- (-2270.832) [-2266.887] (-2274.166) (-2274.205) * (-2269.552) [-2266.965] (-2271.176) (-2271.902) -- 0:06:01
6000 -- (-2265.113) [-2261.429] (-2265.887) (-2275.763) * [-2266.572] (-2263.840) (-2269.163) (-2266.155) -- 0:08:17
6500 -- (-2265.645) (-2271.709) [-2272.480] (-2276.387) * (-2267.459) [-2270.670] (-2265.984) (-2268.144) -- 0:07:38
7000 -- (-2268.514) (-2263.319) [-2276.325] (-2296.338) * [-2263.590] (-2269.521) (-2275.744) (-2274.877) -- 0:07:05
7500 -- [-2263.304] (-2274.133) (-2268.276) (-2285.843) * [-2267.101] (-2270.815) (-2281.289) (-2271.070) -- 0:06:37
8000 -- [-2270.227] (-2269.073) (-2279.203) (-2272.278) * (-2270.549) (-2280.582) [-2273.740] (-2276.267) -- 0:08:16
8500 -- (-2272.507) [-2264.911] (-2265.178) (-2278.611) * [-2262.361] (-2276.407) (-2271.726) (-2270.599) -- 0:07:46
9000 -- [-2262.854] (-2266.961) (-2265.613) (-2270.642) * (-2266.723) [-2265.935] (-2270.165) (-2274.082) -- 0:07:20
9500 -- (-2266.441) (-2268.031) [-2262.429] (-2269.906) * [-2264.593] (-2267.475) (-2272.995) (-2281.343) -- 0:06:57
10000 -- (-2262.683) (-2268.415) [-2267.236] (-2266.133) * (-2276.831) (-2269.850) [-2273.304] (-2283.782) -- 0:06:36
Average standard deviation of split frequencies: 0.040177
10500 -- (-2269.866) (-2274.874) (-2263.215) [-2262.728] * (-2276.076) (-2276.752) (-2274.110) [-2268.937] -- 0:07:51
11000 -- [-2267.857] (-2278.537) (-2268.714) (-2263.041) * (-2271.207) (-2273.995) [-2262.698] (-2272.175) -- 0:07:29
11500 -- (-2268.229) (-2273.504) (-2264.431) [-2262.950] * (-2268.840) (-2268.383) [-2269.423] (-2266.712) -- 0:07:09
12000 -- (-2279.561) [-2261.810] (-2281.841) (-2269.331) * (-2270.955) (-2267.764) [-2267.978] (-2271.230) -- 0:06:51
12500 -- (-2277.328) (-2261.826) (-2281.720) [-2261.112] * (-2273.892) (-2268.775) (-2278.864) [-2266.077] -- 0:07:54
13000 -- [-2264.459] (-2263.538) (-2277.826) (-2270.451) * (-2268.180) (-2277.123) (-2270.033) [-2263.718] -- 0:07:35
13500 -- [-2261.548] (-2271.808) (-2271.754) (-2263.205) * (-2269.781) (-2267.394) [-2270.987] (-2260.829) -- 0:07:18
14000 -- [-2262.020] (-2267.349) (-2264.015) (-2268.012) * (-2265.031) (-2264.752) [-2266.000] (-2267.498) -- 0:07:02
14500 -- (-2265.291) [-2271.688] (-2275.504) (-2270.765) * (-2270.506) (-2266.468) [-2262.891] (-2270.266) -- 0:06:47
15000 -- [-2263.679] (-2259.749) (-2269.722) (-2275.275) * (-2261.517) [-2272.581] (-2268.691) (-2260.978) -- 0:07:39
Average standard deviation of split frequencies: 0.036828
15500 -- [-2267.820] (-2265.344) (-2267.254) (-2266.488) * (-2276.997) (-2267.819) (-2264.586) [-2268.588] -- 0:07:24
16000 -- (-2265.078) (-2270.986) (-2266.620) [-2266.192] * [-2264.988] (-2274.232) (-2275.936) (-2270.950) -- 0:07:10
16500 -- (-2268.795) (-2271.478) [-2271.765] (-2263.759) * (-2265.990) (-2271.542) (-2265.849) [-2268.979] -- 0:06:57
17000 -- (-2270.363) (-2275.949) (-2263.151) [-2270.034] * (-2268.452) (-2260.488) (-2270.700) [-2267.044] -- 0:07:42
17500 -- [-2266.737] (-2278.566) (-2268.387) (-2268.018) * [-2278.191] (-2277.563) (-2267.775) (-2267.343) -- 0:07:29
18000 -- (-2264.217) [-2267.679] (-2276.614) (-2263.709) * (-2270.964) (-2272.464) [-2263.942] (-2266.271) -- 0:07:16
18500 -- (-2270.498) [-2264.523] (-2283.082) (-2264.727) * [-2271.070] (-2260.678) (-2276.360) (-2265.203) -- 0:07:04
19000 -- (-2277.779) [-2281.435] (-2266.647) (-2270.423) * (-2268.689) (-2276.271) [-2264.619] (-2289.212) -- 0:06:53
19500 -- (-2270.681) (-2281.653) [-2272.274] (-2269.104) * [-2258.779] (-2266.719) (-2270.550) (-2277.087) -- 0:07:32
20000 -- (-2277.417) [-2270.252] (-2272.639) (-2273.371) * [-2271.232] (-2264.221) (-2274.153) (-2270.584) -- 0:07:21
Average standard deviation of split frequencies: 0.031104
20500 -- (-2269.519) (-2270.240) (-2272.991) [-2262.382] * (-2263.765) [-2262.197] (-2261.424) (-2267.447) -- 0:07:10
21000 -- (-2272.574) (-2272.662) [-2269.989] (-2260.935) * (-2270.652) (-2269.742) (-2273.704) [-2264.316] -- 0:06:59
21500 -- [-2263.275] (-2276.550) (-2267.684) (-2268.558) * (-2273.263) (-2268.703) [-2270.254] (-2264.300) -- 0:07:35
22000 -- (-2264.211) [-2269.530] (-2271.713) (-2262.940) * (-2268.919) (-2283.209) [-2274.177] (-2266.683) -- 0:07:24
22500 -- (-2275.563) [-2265.644] (-2263.065) (-2266.504) * (-2269.517) (-2269.461) (-2270.172) [-2265.676] -- 0:07:14
23000 -- (-2273.780) (-2273.955) (-2270.199) [-2270.889] * (-2265.995) [-2264.080] (-2269.744) (-2269.835) -- 0:07:04
23500 -- (-2267.549) (-2277.171) [-2262.721] (-2275.743) * [-2265.144] (-2264.246) (-2262.016) (-2264.353) -- 0:07:37
24000 -- (-2273.327) (-2268.508) [-2268.656] (-2265.906) * (-2267.291) [-2262.269] (-2271.674) (-2269.240) -- 0:07:27
24500 -- (-2261.655) [-2264.656] (-2267.259) (-2262.967) * [-2277.583] (-2271.508) (-2274.057) (-2259.410) -- 0:07:17
25000 -- [-2264.935] (-2272.318) (-2269.599) (-2264.497) * (-2270.454) [-2264.656] (-2278.183) (-2274.251) -- 0:07:09
Average standard deviation of split frequencies: 0.054393
25500 -- (-2263.890) (-2273.164) (-2268.181) [-2263.219] * (-2270.874) (-2269.328) [-2267.417] (-2270.957) -- 0:07:00
26000 -- (-2268.945) (-2280.969) (-2265.656) [-2274.298] * [-2263.087] (-2263.948) (-2275.154) (-2269.887) -- 0:07:29
26500 -- [-2266.390] (-2268.914) (-2266.742) (-2272.566) * [-2265.088] (-2268.344) (-2264.693) (-2267.026) -- 0:07:20
27000 -- [-2267.261] (-2274.156) (-2267.094) (-2270.925) * [-2260.131] (-2278.460) (-2268.402) (-2270.199) -- 0:07:12
27500 -- (-2261.952) [-2269.139] (-2266.965) (-2265.018) * (-2272.577) (-2268.017) (-2262.935) [-2266.053] -- 0:07:04
28000 -- (-2264.895) [-2266.426] (-2266.608) (-2266.556) * (-2281.185) [-2260.274] (-2267.913) (-2279.814) -- 0:07:31
28500 -- [-2265.565] (-2263.459) (-2279.932) (-2262.662) * (-2265.561) (-2266.191) [-2259.752] (-2277.009) -- 0:07:23
29000 -- (-2276.191) (-2280.344) [-2265.049] (-2264.701) * [-2279.322] (-2266.873) (-2276.252) (-2273.732) -- 0:07:15
29500 -- (-2262.486) (-2267.854) (-2268.391) [-2263.870] * (-2262.336) (-2269.622) (-2271.394) [-2262.412] -- 0:07:07
30000 -- (-2271.648) (-2260.164) [-2263.119] (-2274.658) * (-2269.128) (-2267.627) [-2260.731] (-2260.970) -- 0:07:32
Average standard deviation of split frequencies: 0.043751
30500 -- [-2264.861] (-2266.390) (-2263.114) (-2267.326) * (-2265.907) (-2264.512) (-2269.792) [-2265.858] -- 0:07:25
31000 -- (-2271.331) (-2272.717) [-2270.900] (-2268.574) * [-2268.606] (-2265.798) (-2263.953) (-2267.567) -- 0:07:17
31500 -- (-2266.494) (-2264.797) (-2263.391) [-2269.493] * [-2267.837] (-2265.396) (-2272.500) (-2266.364) -- 0:07:10
32000 -- (-2272.934) (-2272.859) (-2269.861) [-2271.527] * (-2272.766) (-2267.023) (-2271.264) [-2269.790] -- 0:07:03
32500 -- [-2263.291] (-2271.874) (-2277.507) (-2264.590) * (-2273.581) (-2272.366) (-2264.875) [-2260.443] -- 0:07:26
33000 -- (-2264.887) (-2272.442) (-2279.088) [-2275.043] * (-2261.621) (-2269.049) (-2271.478) [-2267.103] -- 0:07:19
33500 -- (-2270.921) (-2274.848) [-2266.304] (-2263.711) * (-2269.064) (-2265.461) [-2269.201] (-2268.364) -- 0:07:12
34000 -- (-2277.821) (-2269.805) [-2260.633] (-2268.934) * (-2269.499) (-2262.848) (-2267.287) [-2271.620] -- 0:07:06
34500 -- (-2270.402) [-2263.231] (-2268.703) (-2265.702) * (-2272.489) (-2267.738) (-2264.966) [-2271.112] -- 0:07:27
35000 -- (-2270.618) (-2264.180) [-2271.416] (-2266.013) * (-2274.145) (-2278.761) [-2266.067] (-2272.075) -- 0:07:21
Average standard deviation of split frequencies: 0.049105
35500 -- [-2271.811] (-2271.359) (-2266.739) (-2274.270) * (-2278.795) (-2276.270) (-2278.649) [-2263.757] -- 0:07:14
36000 -- (-2265.400) [-2275.031] (-2266.018) (-2280.769) * (-2271.469) (-2268.480) [-2275.447] (-2276.460) -- 0:07:08
36500 -- (-2268.465) (-2270.093) [-2269.694] (-2276.960) * (-2268.001) [-2264.098] (-2277.755) (-2270.568) -- 0:07:02
37000 -- [-2263.299] (-2273.779) (-2267.190) (-2268.834) * (-2261.908) (-2261.741) [-2266.511] (-2265.353) -- 0:07:22
37500 -- [-2262.563] (-2282.439) (-2275.014) (-2276.690) * (-2268.535) (-2263.666) (-2270.550) [-2259.482] -- 0:07:16
38000 -- (-2266.898) [-2272.346] (-2272.169) (-2271.492) * [-2265.681] (-2270.820) (-2265.058) (-2270.718) -- 0:07:10
38500 -- (-2269.468) (-2265.063) (-2275.919) [-2273.095] * [-2269.117] (-2271.478) (-2263.158) (-2267.427) -- 0:07:04
39000 -- [-2271.617] (-2268.964) (-2281.054) (-2264.233) * (-2269.874) (-2271.758) (-2267.351) [-2266.620] -- 0:07:23
39500 -- (-2278.851) (-2263.574) (-2272.408) [-2266.169] * [-2270.819] (-2271.478) (-2286.066) (-2278.114) -- 0:07:17
40000 -- (-2262.846) (-2265.577) (-2273.516) [-2259.946] * (-2269.122) (-2260.011) [-2262.763] (-2279.441) -- 0:07:12
Average standard deviation of split frequencies: 0.049266
40500 -- (-2271.257) (-2265.474) (-2266.488) [-2263.896] * [-2264.985] (-2266.931) (-2261.547) (-2276.709) -- 0:07:06
41000 -- [-2268.840] (-2269.618) (-2268.670) (-2268.920) * [-2262.257] (-2268.179) (-2267.308) (-2271.239) -- 0:07:24
41500 -- (-2277.966) [-2267.707] (-2266.967) (-2273.698) * [-2268.948] (-2278.071) (-2271.446) (-2266.289) -- 0:07:18
42000 -- (-2279.467) [-2269.494] (-2270.006) (-2281.000) * (-2269.972) (-2285.492) (-2275.172) [-2272.437] -- 0:07:13
42500 -- (-2277.391) (-2263.137) (-2262.790) [-2268.701] * [-2267.785] (-2273.530) (-2257.387) (-2264.846) -- 0:07:08
43000 -- (-2275.466) [-2262.653] (-2265.941) (-2262.296) * [-2272.101] (-2268.306) (-2286.078) (-2266.657) -- 0:07:02
43500 -- (-2267.476) [-2260.271] (-2262.002) (-2271.343) * (-2262.900) (-2273.305) [-2269.181] (-2265.762) -- 0:07:19
44000 -- (-2283.329) (-2263.280) (-2274.984) [-2263.624] * (-2268.610) (-2272.108) [-2271.224] (-2276.551) -- 0:07:14
44500 -- (-2271.785) [-2266.423] (-2266.295) (-2259.952) * (-2271.926) (-2273.077) [-2273.440] (-2261.373) -- 0:07:09
45000 -- (-2265.623) (-2272.148) [-2265.851] (-2267.322) * (-2270.795) (-2267.142) [-2260.462] (-2264.806) -- 0:07:04
Average standard deviation of split frequencies: 0.052816
45500 -- (-2269.612) (-2269.129) [-2261.015] (-2259.563) * (-2275.911) [-2263.979] (-2268.940) (-2270.527) -- 0:07:20
46000 -- (-2272.634) [-2273.363] (-2265.906) (-2275.773) * (-2273.623) (-2267.850) (-2268.299) [-2270.016] -- 0:07:15
46500 -- [-2265.887] (-2275.312) (-2263.841) (-2279.071) * (-2266.464) [-2273.696] (-2268.514) (-2275.240) -- 0:07:10
47000 -- (-2275.892) (-2268.086) [-2269.272] (-2265.119) * (-2267.356) (-2269.206) (-2264.057) [-2266.565] -- 0:07:05
47500 -- (-2262.659) (-2279.412) (-2267.472) [-2267.736] * (-2269.207) (-2266.568) [-2267.211] (-2266.791) -- 0:07:01
48000 -- (-2270.122) (-2277.757) (-2265.161) [-2262.621] * (-2277.446) (-2276.861) (-2265.136) [-2267.825] -- 0:07:16
48500 -- (-2267.683) (-2273.074) [-2267.372] (-2257.062) * [-2271.594] (-2272.445) (-2266.330) (-2262.315) -- 0:07:11
49000 -- [-2265.465] (-2266.014) (-2267.234) (-2266.415) * (-2272.394) (-2277.273) (-2272.542) [-2268.585] -- 0:07:06
49500 -- [-2264.161] (-2276.238) (-2270.344) (-2268.457) * (-2264.542) (-2275.994) [-2268.172] (-2281.056) -- 0:07:02
50000 -- (-2262.895) (-2269.212) (-2266.166) [-2266.122] * (-2269.774) (-2274.308) [-2263.568] (-2266.494) -- 0:07:17
Average standard deviation of split frequencies: 0.053677
50500 -- [-2267.405] (-2265.123) (-2267.835) (-2265.866) * (-2269.440) (-2278.378) (-2267.280) [-2265.300] -- 0:07:12
51000 -- (-2271.771) (-2276.138) [-2267.098] (-2272.059) * (-2274.132) [-2263.277] (-2265.237) (-2266.998) -- 0:07:07
51500 -- [-2265.948] (-2267.808) (-2265.270) (-2276.362) * [-2265.590] (-2273.724) (-2273.422) (-2262.403) -- 0:07:03
52000 -- (-2268.032) (-2262.789) [-2265.450] (-2275.469) * (-2268.894) [-2263.831] (-2263.051) (-2267.570) -- 0:07:17
52500 -- (-2264.495) [-2264.269] (-2268.789) (-2276.246) * (-2270.289) (-2266.150) [-2264.582] (-2272.703) -- 0:07:13
53000 -- [-2260.703] (-2276.989) (-2273.172) (-2273.553) * [-2276.181] (-2273.812) (-2266.784) (-2263.701) -- 0:07:08
53500 -- [-2266.105] (-2266.954) (-2272.916) (-2273.578) * (-2275.056) (-2267.852) [-2269.844] (-2266.194) -- 0:07:04
54000 -- (-2276.480) [-2269.158] (-2274.197) (-2277.834) * [-2263.084] (-2273.998) (-2272.686) (-2266.706) -- 0:07:00
54500 -- (-2272.895) [-2274.913] (-2269.593) (-2278.897) * [-2265.663] (-2267.603) (-2270.762) (-2275.375) -- 0:07:13
55000 -- [-2269.276] (-2276.184) (-2267.882) (-2273.704) * (-2272.770) (-2274.384) [-2274.140] (-2262.250) -- 0:07:09
Average standard deviation of split frequencies: 0.047917
55500 -- (-2262.572) (-2277.724) [-2267.570] (-2274.579) * (-2273.880) (-2277.876) [-2269.247] (-2264.097) -- 0:07:05
56000 -- (-2279.158) [-2265.035] (-2270.750) (-2270.655) * (-2271.505) (-2269.953) (-2266.786) [-2265.764] -- 0:07:01
56500 -- (-2274.814) (-2272.630) [-2270.511] (-2265.824) * [-2265.280] (-2272.175) (-2270.478) (-2269.176) -- 0:07:14
57000 -- (-2265.851) (-2262.014) (-2278.259) [-2262.891] * (-2268.113) (-2273.001) (-2266.731) [-2261.481] -- 0:07:10
57500 -- (-2268.467) (-2269.513) (-2271.739) [-2264.910] * (-2271.493) (-2260.567) [-2264.317] (-2264.230) -- 0:07:06
58000 -- (-2268.257) (-2281.601) (-2267.818) [-2265.677] * (-2265.526) (-2268.805) (-2265.390) [-2269.969] -- 0:07:02
58500 -- [-2267.480] (-2267.529) (-2274.342) (-2265.754) * (-2272.041) (-2270.320) (-2265.068) [-2267.286] -- 0:06:58
59000 -- [-2260.298] (-2267.765) (-2273.989) (-2264.698) * [-2263.942] (-2265.933) (-2274.327) (-2273.028) -- 0:07:10
59500 -- (-2261.752) [-2265.815] (-2263.314) (-2264.475) * (-2266.463) (-2266.458) (-2266.234) [-2262.352] -- 0:07:06
60000 -- (-2269.562) [-2264.462] (-2276.168) (-2267.606) * (-2266.080) (-2266.527) [-2264.639] (-2266.803) -- 0:07:03
Average standard deviation of split frequencies: 0.045327
60500 -- (-2266.697) (-2267.020) [-2270.618] (-2262.723) * (-2279.882) [-2261.427] (-2264.917) (-2271.359) -- 0:06:59
61000 -- (-2268.130) (-2280.316) (-2268.159) [-2269.251] * [-2262.349] (-2266.286) (-2263.103) (-2279.201) -- 0:07:11
61500 -- [-2266.203] (-2282.739) (-2265.357) (-2270.582) * [-2262.779] (-2271.985) (-2275.089) (-2268.002) -- 0:07:07
62000 -- (-2268.950) (-2265.818) (-2275.042) [-2263.837] * (-2263.143) (-2273.471) [-2266.622] (-2270.842) -- 0:07:03
62500 -- (-2270.556) (-2279.516) (-2270.436) [-2270.043] * [-2267.188] (-2261.307) (-2262.901) (-2278.512) -- 0:07:00
63000 -- [-2259.464] (-2268.337) (-2264.250) (-2271.282) * (-2266.501) (-2264.319) (-2273.034) [-2278.213] -- 0:06:56
63500 -- (-2267.360) (-2269.937) [-2261.643] (-2269.451) * (-2279.317) [-2267.123] (-2274.464) (-2263.278) -- 0:07:07
64000 -- (-2270.639) (-2269.211) (-2259.456) [-2264.872] * (-2285.730) (-2267.557) (-2264.953) [-2263.690] -- 0:07:04
64500 -- (-2265.277) (-2278.327) (-2266.337) [-2261.726] * (-2291.397) [-2260.890] (-2265.841) (-2269.698) -- 0:07:00
65000 -- (-2266.454) [-2267.109] (-2272.946) (-2268.756) * (-2274.546) (-2266.197) (-2264.098) [-2268.407] -- 0:06:57
Average standard deviation of split frequencies: 0.038689
65500 -- (-2280.983) [-2264.729] (-2269.280) (-2265.427) * (-2268.415) (-2270.821) [-2266.201] (-2271.726) -- 0:07:08
66000 -- (-2282.470) (-2262.809) (-2278.306) [-2265.728] * (-2264.774) [-2272.085] (-2267.527) (-2268.000) -- 0:07:04
66500 -- (-2286.973) (-2266.976) (-2273.633) [-2264.047] * [-2261.588] (-2281.176) (-2271.873) (-2265.692) -- 0:07:01
67000 -- (-2282.133) (-2263.177) (-2274.021) [-2266.756] * (-2266.505) [-2272.480] (-2279.570) (-2264.556) -- 0:06:57
67500 -- (-2277.201) [-2266.669] (-2270.110) (-2267.460) * [-2263.708] (-2263.966) (-2276.343) (-2269.500) -- 0:07:08
68000 -- (-2266.026) [-2263.709] (-2277.500) (-2269.631) * (-2267.292) [-2262.065] (-2270.235) (-2280.104) -- 0:07:04
68500 -- [-2262.527] (-2260.386) (-2272.544) (-2263.460) * (-2262.865) [-2262.643] (-2270.204) (-2265.530) -- 0:07:01
69000 -- (-2262.164) (-2260.285) [-2266.089] (-2262.089) * [-2258.507] (-2266.673) (-2261.320) (-2265.060) -- 0:06:58
69500 -- [-2268.314] (-2260.620) (-2269.423) (-2264.854) * (-2271.531) (-2269.713) [-2257.871] (-2271.776) -- 0:06:55
70000 -- (-2270.444) (-2272.771) (-2272.600) [-2264.829] * (-2272.147) (-2268.803) (-2268.119) [-2263.778] -- 0:07:05
Average standard deviation of split frequencies: 0.028907
70500 -- [-2268.264] (-2274.149) (-2270.545) (-2269.285) * (-2270.494) (-2271.639) (-2271.077) [-2261.424] -- 0:07:01
71000 -- [-2273.199] (-2277.493) (-2280.732) (-2276.555) * (-2264.904) (-2273.264) [-2262.151] (-2280.841) -- 0:06:58
71500 -- (-2278.196) (-2271.405) (-2279.984) [-2268.492] * [-2272.477] (-2270.583) (-2269.478) (-2272.945) -- 0:06:55
72000 -- (-2276.755) [-2268.137] (-2273.305) (-2269.372) * [-2271.235] (-2268.242) (-2267.874) (-2270.769) -- 0:07:05
72500 -- (-2268.466) (-2269.239) [-2276.681] (-2267.995) * (-2265.879) [-2265.084] (-2263.765) (-2261.667) -- 0:07:02
73000 -- [-2259.095] (-2270.759) (-2280.558) (-2266.385) * (-2274.881) (-2269.300) [-2266.970] (-2271.861) -- 0:06:59
73500 -- [-2270.913] (-2267.618) (-2278.457) (-2265.471) * (-2272.162) [-2272.047] (-2279.580) (-2262.176) -- 0:06:55
74000 -- (-2270.905) (-2266.009) (-2268.535) [-2259.358] * [-2269.712] (-2262.120) (-2276.597) (-2269.943) -- 0:06:52
74500 -- [-2268.985] (-2267.719) (-2260.612) (-2264.139) * (-2272.577) (-2270.685) [-2267.626] (-2263.945) -- 0:07:02
75000 -- [-2266.594] (-2270.875) (-2269.614) (-2269.227) * [-2261.980] (-2266.415) (-2263.702) (-2270.410) -- 0:06:59
Average standard deviation of split frequencies: 0.028151
75500 -- [-2267.504] (-2269.229) (-2276.079) (-2268.678) * (-2274.364) (-2273.197) (-2265.530) [-2268.147] -- 0:06:56
76000 -- (-2263.659) (-2267.376) [-2267.088] (-2271.364) * (-2264.120) (-2270.075) (-2269.507) [-2267.150] -- 0:06:53
76500 -- [-2268.360] (-2265.033) (-2269.803) (-2268.613) * (-2268.216) [-2267.167] (-2272.886) (-2268.301) -- 0:07:02
77000 -- (-2273.552) [-2262.682] (-2270.016) (-2272.621) * (-2267.471) (-2270.067) (-2270.592) [-2259.087] -- 0:06:59
77500 -- [-2259.974] (-2272.479) (-2263.360) (-2268.727) * [-2272.873] (-2264.633) (-2267.231) (-2267.164) -- 0:06:56
78000 -- [-2265.013] (-2281.179) (-2266.830) (-2271.981) * (-2274.866) [-2264.427] (-2268.274) (-2268.493) -- 0:06:53
78500 -- [-2264.019] (-2264.475) (-2277.808) (-2262.932) * (-2278.863) (-2273.087) [-2260.418] (-2282.442) -- 0:06:50
79000 -- (-2260.257) (-2264.725) [-2270.769] (-2260.441) * (-2269.435) [-2270.165] (-2270.945) (-2270.488) -- 0:06:59
79500 -- (-2264.681) [-2262.181] (-2273.097) (-2263.783) * (-2269.896) (-2275.403) [-2270.143] (-2270.366) -- 0:06:56
80000 -- (-2261.685) [-2262.634] (-2276.954) (-2260.593) * (-2271.484) (-2266.002) (-2264.674) [-2273.358] -- 0:06:54
Average standard deviation of split frequencies: 0.030118
80500 -- [-2273.331] (-2269.544) (-2273.670) (-2270.893) * (-2274.001) (-2266.353) [-2268.099] (-2271.018) -- 0:06:51
81000 -- [-2269.030] (-2277.084) (-2274.166) (-2270.892) * (-2282.927) (-2270.077) (-2268.957) [-2271.447] -- 0:06:59
81500 -- (-2274.289) [-2270.424] (-2270.554) (-2263.445) * (-2271.831) (-2260.444) [-2263.156] (-2266.773) -- 0:06:56
82000 -- (-2271.346) (-2267.230) (-2268.492) [-2270.849] * (-2268.846) (-2269.733) [-2264.843] (-2269.928) -- 0:06:54
82500 -- (-2269.784) (-2279.464) (-2263.543) [-2261.308] * (-2274.865) (-2271.985) [-2264.227] (-2265.860) -- 0:06:51
83000 -- (-2281.601) [-2277.723] (-2267.947) (-2262.410) * (-2267.421) (-2262.077) (-2268.758) [-2268.337] -- 0:06:59
83500 -- [-2264.344] (-2269.382) (-2276.247) (-2272.070) * (-2268.318) [-2267.736] (-2268.525) (-2265.479) -- 0:06:57
84000 -- (-2270.096) (-2268.816) [-2270.800] (-2269.605) * (-2265.598) [-2271.288] (-2261.991) (-2278.834) -- 0:06:54
84500 -- (-2262.000) [-2273.552] (-2271.025) (-2268.768) * (-2264.911) (-2268.817) (-2273.103) [-2269.303] -- 0:06:51
85000 -- (-2271.133) (-2272.551) (-2286.477) [-2269.496] * (-2267.022) [-2272.799] (-2276.600) (-2267.958) -- 0:06:49
Average standard deviation of split frequencies: 0.024877
85500 -- (-2280.065) (-2273.466) (-2274.547) [-2269.295] * (-2271.194) [-2264.182] (-2274.965) (-2269.237) -- 0:06:57
86000 -- (-2277.663) (-2264.007) [-2265.618] (-2272.106) * (-2261.239) (-2267.055) (-2267.527) [-2264.261] -- 0:06:54
86500 -- [-2270.888] (-2269.565) (-2274.242) (-2268.905) * [-2261.884] (-2260.568) (-2272.692) (-2272.547) -- 0:06:51
87000 -- (-2263.463) (-2264.789) [-2267.260] (-2267.468) * (-2266.574) (-2265.943) (-2267.875) [-2268.755] -- 0:06:49
87500 -- (-2264.709) [-2259.420] (-2271.644) (-2275.881) * (-2263.793) (-2282.156) [-2267.775] (-2267.430) -- 0:06:57
88000 -- (-2269.708) (-2270.493) (-2276.290) [-2262.617] * (-2260.908) [-2269.356] (-2265.475) (-2263.310) -- 0:06:54
88500 -- (-2274.988) (-2276.541) (-2276.781) [-2269.897] * (-2276.592) (-2267.412) (-2271.666) [-2265.403] -- 0:06:51
89000 -- (-2268.694) (-2275.265) [-2263.703] (-2271.029) * [-2261.251] (-2273.515) (-2262.885) (-2262.818) -- 0:06:49
89500 -- (-2274.358) (-2268.564) (-2259.554) [-2268.706] * (-2265.510) [-2275.261] (-2268.357) (-2264.750) -- 0:06:46
90000 -- (-2277.402) (-2262.590) (-2266.217) [-2263.160] * (-2263.294) (-2282.209) [-2263.760] (-2267.652) -- 0:06:54
Average standard deviation of split frequencies: 0.019497
90500 -- (-2273.193) (-2268.379) [-2264.093] (-2269.071) * (-2260.474) (-2264.881) (-2264.819) [-2267.146] -- 0:06:52
91000 -- (-2266.170) (-2265.215) (-2268.786) [-2262.467] * (-2260.385) [-2263.029] (-2260.111) (-2272.877) -- 0:06:49
91500 -- (-2279.149) [-2264.963] (-2270.634) (-2274.998) * [-2270.872] (-2263.040) (-2280.970) (-2268.326) -- 0:06:47
92000 -- (-2278.457) (-2267.276) (-2269.587) [-2267.911] * [-2267.581] (-2258.895) (-2270.802) (-2264.842) -- 0:06:54
92500 -- (-2270.625) [-2267.580] (-2271.056) (-2270.127) * (-2270.105) (-2262.252) [-2264.260] (-2267.911) -- 0:06:52
93000 -- (-2284.569) (-2266.837) (-2268.122) [-2274.138] * (-2272.344) (-2265.090) (-2263.920) [-2267.664] -- 0:06:49
93500 -- (-2277.941) (-2268.584) [-2266.913] (-2270.574) * (-2271.377) (-2266.575) (-2266.011) [-2270.445] -- 0:06:47
94000 -- (-2279.585) (-2274.685) [-2261.786] (-2268.522) * [-2271.799] (-2266.816) (-2274.953) (-2262.022) -- 0:06:44
94500 -- (-2267.687) [-2266.202] (-2264.831) (-2273.492) * [-2258.933] (-2270.829) (-2269.832) (-2273.779) -- 0:06:52
95000 -- (-2260.970) (-2269.637) (-2264.683) [-2266.272] * (-2263.306) (-2262.632) [-2259.264] (-2275.114) -- 0:06:49
Average standard deviation of split frequencies: 0.019642
95500 -- (-2261.047) (-2279.764) [-2269.884] (-2273.013) * (-2269.589) (-2271.241) [-2267.818] (-2265.184) -- 0:06:47
96000 -- [-2262.725] (-2272.352) (-2263.659) (-2261.816) * (-2264.411) (-2260.999) [-2260.723] (-2271.550) -- 0:06:44
96500 -- (-2264.616) [-2266.930] (-2266.996) (-2275.024) * (-2267.592) (-2263.299) (-2261.839) [-2263.223] -- 0:06:51
97000 -- [-2265.827] (-2279.884) (-2268.612) (-2268.822) * [-2265.303] (-2272.044) (-2268.844) (-2268.158) -- 0:06:49
97500 -- [-2264.100] (-2266.860) (-2266.633) (-2276.083) * (-2260.273) (-2273.068) (-2270.568) [-2269.644] -- 0:06:47
98000 -- (-2262.286) (-2263.406) [-2264.006] (-2273.306) * (-2266.908) [-2265.242] (-2260.710) (-2265.665) -- 0:06:44
98500 -- (-2266.160) [-2266.156] (-2268.675) (-2267.829) * (-2267.435) [-2268.513] (-2265.492) (-2271.184) -- 0:06:51
99000 -- (-2273.061) [-2267.883] (-2269.009) (-2262.888) * [-2268.005] (-2267.377) (-2267.441) (-2261.601) -- 0:06:49
99500 -- (-2263.629) (-2270.055) (-2263.434) [-2265.025] * (-2265.554) [-2267.944] (-2266.067) (-2262.868) -- 0:06:47
100000 -- (-2276.171) [-2268.481] (-2269.345) (-2273.648) * (-2263.135) [-2269.412] (-2276.667) (-2261.825) -- 0:06:45
Average standard deviation of split frequencies: 0.015326
100500 -- (-2275.942) (-2263.581) (-2265.017) [-2277.038] * (-2266.422) (-2264.435) (-2273.637) [-2261.603] -- 0:06:42
101000 -- (-2275.178) (-2273.084) (-2264.575) [-2264.590] * [-2262.805] (-2269.452) (-2267.947) (-2270.371) -- 0:06:49
101500 -- (-2268.763) (-2265.933) (-2266.497) [-2264.191] * (-2272.156) [-2261.526] (-2264.200) (-2270.743) -- 0:06:47
102000 -- (-2267.296) [-2266.732] (-2266.584) (-2269.988) * [-2271.858] (-2272.971) (-2277.581) (-2279.889) -- 0:06:44
102500 -- (-2268.397) [-2266.500] (-2261.238) (-2268.222) * (-2273.404) (-2271.319) (-2267.382) [-2275.178] -- 0:06:42
103000 -- (-2265.981) [-2272.926] (-2269.667) (-2267.837) * (-2264.040) [-2261.951] (-2264.747) (-2269.454) -- 0:06:49
103500 -- (-2277.747) (-2266.134) [-2262.263] (-2268.031) * (-2270.927) (-2277.103) (-2266.083) [-2274.395] -- 0:06:47
104000 -- (-2260.614) (-2277.899) (-2274.619) [-2275.338] * [-2266.823] (-2272.865) (-2278.783) (-2268.709) -- 0:06:44
104500 -- (-2267.066) [-2272.174] (-2267.398) (-2263.495) * (-2263.395) [-2268.010] (-2275.773) (-2265.406) -- 0:06:42
105000 -- [-2268.876] (-2264.624) (-2270.002) (-2271.967) * [-2266.778] (-2267.135) (-2270.715) (-2263.416) -- 0:06:40
Average standard deviation of split frequencies: 0.014824
105500 -- (-2275.902) [-2259.193] (-2263.778) (-2270.027) * (-2266.013) (-2267.309) [-2264.516] (-2264.817) -- 0:06:46
106000 -- (-2272.901) [-2265.659] (-2274.485) (-2263.145) * (-2261.700) [-2265.339] (-2269.700) (-2266.806) -- 0:06:44
106500 -- [-2272.668] (-2272.462) (-2273.734) (-2275.713) * (-2264.048) (-2274.726) (-2265.782) [-2259.634] -- 0:06:42
107000 -- (-2267.867) [-2267.533] (-2273.667) (-2262.894) * (-2274.510) (-2264.131) [-2271.905] (-2267.794) -- 0:06:40
107500 -- (-2266.051) (-2265.291) [-2266.166] (-2270.780) * (-2276.108) (-2277.391) [-2268.329] (-2272.250) -- 0:06:46
108000 -- (-2274.801) (-2266.685) [-2262.892] (-2268.632) * [-2262.029] (-2275.712) (-2270.422) (-2279.379) -- 0:06:44
108500 -- (-2262.835) (-2270.923) [-2263.979] (-2265.908) * [-2262.754] (-2277.427) (-2265.742) (-2266.177) -- 0:06:42
109000 -- (-2266.939) (-2267.860) [-2269.376] (-2276.487) * (-2273.736) (-2266.440) (-2270.562) [-2269.824] -- 0:06:40
109500 -- [-2263.370] (-2270.306) (-2265.318) (-2260.714) * [-2267.713] (-2261.408) (-2265.313) (-2278.431) -- 0:06:38
110000 -- [-2269.337] (-2263.382) (-2262.344) (-2272.489) * (-2270.789) (-2270.660) (-2277.228) [-2262.810] -- 0:06:44
Average standard deviation of split frequencies: 0.017749
110500 -- (-2265.543) (-2266.196) (-2263.505) [-2265.411] * [-2265.665] (-2272.041) (-2271.824) (-2264.470) -- 0:06:42
111000 -- (-2273.098) (-2265.096) [-2264.495] (-2270.053) * (-2271.138) (-2275.195) (-2273.438) [-2274.906] -- 0:06:40
111500 -- (-2271.488) [-2259.957] (-2265.249) (-2268.640) * (-2272.278) [-2267.379] (-2282.109) (-2277.217) -- 0:06:38
112000 -- (-2265.704) (-2274.356) (-2280.767) [-2265.411] * (-2271.130) [-2270.736] (-2280.034) (-2269.027) -- 0:06:44
112500 -- (-2269.471) (-2270.639) (-2266.776) [-2270.731] * (-2278.362) (-2269.122) (-2271.836) [-2270.282] -- 0:06:42
113000 -- (-2272.902) (-2273.565) [-2267.936] (-2267.121) * (-2271.357) [-2269.749] (-2269.479) (-2268.566) -- 0:06:40
113500 -- (-2268.790) (-2290.139) (-2271.863) [-2261.442] * (-2267.931) (-2265.793) [-2267.483] (-2264.903) -- 0:06:38
114000 -- (-2272.292) [-2277.939] (-2280.729) (-2272.156) * (-2270.197) (-2277.733) (-2274.658) [-2259.884] -- 0:06:44
114500 -- (-2268.880) (-2269.794) [-2262.336] (-2263.896) * [-2271.102] (-2265.959) (-2291.499) (-2265.299) -- 0:06:42
115000 -- (-2271.085) (-2275.350) (-2277.835) [-2265.911] * [-2264.585] (-2278.941) (-2271.211) (-2267.075) -- 0:06:40
Average standard deviation of split frequencies: 0.019211
115500 -- (-2263.835) [-2267.132] (-2268.729) (-2276.635) * (-2266.591) (-2268.733) (-2267.280) [-2271.501] -- 0:06:38
116000 -- (-2269.502) (-2273.692) (-2272.793) [-2268.280] * (-2269.394) [-2267.643] (-2266.309) (-2264.837) -- 0:06:36
116500 -- (-2267.825) (-2262.948) (-2266.740) [-2261.791] * (-2273.225) (-2266.119) [-2263.588] (-2271.942) -- 0:06:41
117000 -- (-2266.116) (-2269.873) (-2281.200) [-2264.760] * (-2274.244) [-2261.682] (-2268.148) (-2271.272) -- 0:06:39
117500 -- [-2267.655] (-2269.629) (-2265.377) (-2267.853) * (-2271.651) [-2267.765] (-2266.531) (-2266.653) -- 0:06:38
118000 -- (-2277.350) (-2266.030) (-2267.147) [-2269.407] * [-2269.885] (-2265.922) (-2271.455) (-2273.653) -- 0:06:36
118500 -- (-2266.680) (-2265.935) (-2277.692) [-2264.279] * (-2267.226) [-2263.441] (-2261.865) (-2276.098) -- 0:06:41
119000 -- (-2268.806) [-2270.468] (-2265.741) (-2264.968) * (-2269.828) [-2263.517] (-2271.124) (-2271.969) -- 0:06:39
119500 -- (-2265.839) (-2270.661) [-2266.814] (-2260.523) * [-2274.020] (-2271.381) (-2267.256) (-2269.171) -- 0:06:37
120000 -- (-2266.461) (-2271.013) [-2269.089] (-2275.249) * [-2266.739] (-2274.790) (-2264.225) (-2286.050) -- 0:06:36
Average standard deviation of split frequencies: 0.015982
120500 -- [-2266.922] (-2268.918) (-2267.142) (-2273.407) * (-2269.142) [-2262.900] (-2273.243) (-2266.007) -- 0:06:34
121000 -- (-2274.988) (-2270.131) (-2268.690) [-2273.006] * (-2281.130) [-2264.118] (-2264.132) (-2269.886) -- 0:06:39
121500 -- (-2270.153) (-2261.893) (-2265.560) [-2263.348] * (-2278.527) (-2264.558) [-2264.679] (-2277.916) -- 0:06:37
122000 -- (-2273.287) (-2264.834) (-2270.868) [-2259.159] * (-2270.631) (-2265.886) (-2264.453) [-2260.496] -- 0:06:35
122500 -- (-2261.894) (-2267.731) (-2267.297) [-2266.998] * (-2259.926) [-2274.100] (-2261.298) (-2262.655) -- 0:06:33
123000 -- (-2280.110) (-2262.295) (-2265.657) [-2267.105] * (-2262.821) [-2263.799] (-2264.787) (-2266.061) -- 0:06:39
123500 -- (-2270.129) (-2271.319) (-2265.190) [-2273.624] * (-2263.642) [-2261.426] (-2266.056) (-2266.258) -- 0:06:37
124000 -- (-2263.467) (-2280.453) (-2266.124) [-2275.237] * [-2265.624] (-2273.858) (-2269.487) (-2279.598) -- 0:06:35
124500 -- (-2270.347) (-2270.535) [-2266.419] (-2269.540) * (-2276.329) (-2267.878) (-2263.841) [-2269.298] -- 0:06:33
125000 -- (-2272.874) (-2269.634) (-2269.093) [-2265.889] * [-2274.858] (-2262.670) (-2265.682) (-2263.356) -- 0:06:32
Average standard deviation of split frequencies: 0.017148
125500 -- [-2275.728] (-2273.404) (-2262.797) (-2275.872) * (-2267.388) [-2262.522] (-2264.300) (-2264.548) -- 0:06:37
126000 -- (-2267.999) (-2271.807) (-2268.279) [-2261.370] * (-2270.913) [-2268.270] (-2263.190) (-2268.399) -- 0:06:35
126500 -- (-2274.781) (-2272.385) [-2259.049] (-2264.382) * [-2262.153] (-2269.451) (-2272.130) (-2261.108) -- 0:06:33
127000 -- (-2269.680) (-2265.041) (-2264.904) [-2274.355] * (-2263.384) (-2275.445) (-2273.592) [-2263.001] -- 0:06:31
127500 -- [-2269.876] (-2271.488) (-2267.483) (-2271.622) * (-2274.845) (-2279.888) [-2272.917] (-2279.158) -- 0:06:36
128000 -- (-2271.818) (-2263.696) [-2264.931] (-2277.311) * (-2271.714) [-2267.385] (-2274.077) (-2263.984) -- 0:06:35
128500 -- [-2270.292] (-2267.100) (-2274.455) (-2261.532) * (-2279.397) (-2271.259) (-2278.957) [-2266.431] -- 0:06:33
129000 -- [-2263.996] (-2270.728) (-2278.359) (-2264.409) * [-2270.048] (-2270.525) (-2272.944) (-2261.823) -- 0:06:31
129500 -- (-2278.421) (-2265.017) [-2269.892] (-2271.994) * (-2273.334) (-2267.977) (-2266.831) [-2266.070] -- 0:06:36
130000 -- [-2265.700] (-2272.811) (-2277.825) (-2264.763) * [-2263.693] (-2264.077) (-2268.947) (-2265.039) -- 0:06:34
Average standard deviation of split frequencies: 0.015934
130500 -- (-2269.323) (-2259.992) (-2267.159) [-2265.865] * [-2268.019] (-2271.302) (-2265.307) (-2272.804) -- 0:06:33
131000 -- (-2264.283) (-2261.596) (-2275.993) [-2267.823] * (-2269.328) (-2273.386) (-2267.792) [-2263.444] -- 0:06:31
131500 -- [-2272.286] (-2267.635) (-2269.422) (-2267.903) * (-2278.011) (-2271.710) (-2271.242) [-2263.110] -- 0:06:29
132000 -- (-2269.160) (-2273.354) (-2274.951) [-2263.872] * (-2263.674) (-2266.986) [-2262.629] (-2268.512) -- 0:06:34
132500 -- (-2266.826) [-2261.411] (-2264.708) (-2267.990) * (-2277.517) (-2267.052) (-2263.796) [-2270.615] -- 0:06:32
133000 -- (-2271.683) [-2263.193] (-2268.836) (-2273.225) * [-2267.367] (-2268.518) (-2269.892) (-2273.828) -- 0:06:31
133500 -- [-2260.661] (-2264.555) (-2275.697) (-2285.862) * [-2260.394] (-2270.999) (-2267.495) (-2281.380) -- 0:06:29
134000 -- (-2271.496) [-2270.687] (-2263.395) (-2276.537) * [-2266.709] (-2274.791) (-2268.733) (-2271.804) -- 0:06:34
134500 -- (-2269.879) [-2260.926] (-2261.608) (-2268.635) * (-2258.493) [-2268.950] (-2266.139) (-2266.667) -- 0:06:32
135000 -- (-2265.686) (-2261.947) (-2269.259) [-2265.560] * (-2267.883) [-2269.858] (-2263.230) (-2267.258) -- 0:06:30
Average standard deviation of split frequencies: 0.018775
135500 -- (-2267.268) (-2267.163) [-2268.784] (-2266.545) * (-2271.499) (-2275.831) (-2270.870) [-2268.004] -- 0:06:29
136000 -- (-2270.079) (-2261.384) (-2273.873) [-2267.163] * (-2282.984) (-2267.369) [-2262.839] (-2267.399) -- 0:06:27
136500 -- [-2260.259] (-2269.770) (-2266.784) (-2265.729) * (-2273.893) (-2267.267) (-2262.880) [-2263.368] -- 0:06:32
137000 -- (-2264.265) (-2266.470) [-2265.800] (-2264.878) * (-2265.990) [-2266.062] (-2265.583) (-2268.343) -- 0:06:30
137500 -- [-2264.448] (-2269.188) (-2269.193) (-2263.901) * [-2263.765] (-2277.782) (-2266.373) (-2273.354) -- 0:06:28
138000 -- (-2266.555) (-2270.334) [-2259.329] (-2269.729) * (-2268.565) [-2263.366] (-2272.145) (-2259.018) -- 0:06:27
138500 -- (-2264.071) (-2265.941) [-2264.410] (-2265.409) * (-2275.134) (-2277.957) [-2268.062] (-2277.089) -- 0:06:31
139000 -- (-2281.033) (-2272.753) (-2265.379) [-2265.026] * (-2268.359) (-2268.421) [-2270.434] (-2270.479) -- 0:06:30
139500 -- (-2265.261) (-2270.499) [-2264.215] (-2271.609) * (-2272.268) (-2273.638) (-2270.957) [-2265.426] -- 0:06:28
140000 -- (-2267.060) (-2270.069) [-2269.766] (-2276.473) * [-2261.886] (-2274.073) (-2266.595) (-2269.116) -- 0:06:27
Average standard deviation of split frequencies: 0.019269
140500 -- [-2259.693] (-2272.486) (-2265.652) (-2271.067) * (-2280.666) [-2268.813] (-2279.234) (-2268.579) -- 0:06:25
141000 -- (-2266.750) [-2265.220] (-2287.232) (-2268.385) * (-2269.337) (-2265.937) [-2272.677] (-2259.839) -- 0:06:29
141500 -- (-2268.182) (-2272.415) (-2270.918) [-2271.727] * (-2264.058) [-2264.892] (-2273.414) (-2273.037) -- 0:06:28
142000 -- (-2267.325) [-2269.921] (-2267.850) (-2274.269) * (-2259.314) [-2263.895] (-2276.963) (-2271.354) -- 0:06:26
142500 -- (-2269.645) (-2265.468) [-2267.147] (-2266.534) * [-2264.558] (-2267.049) (-2276.108) (-2266.966) -- 0:06:25
143000 -- (-2272.118) (-2262.183) [-2261.217] (-2275.812) * [-2270.672] (-2272.773) (-2283.655) (-2271.302) -- 0:06:29
143500 -- (-2275.566) (-2279.649) (-2267.514) [-2267.697] * [-2263.142] (-2275.274) (-2272.977) (-2263.372) -- 0:06:27
144000 -- (-2264.132) (-2266.645) (-2270.845) [-2267.171] * [-2266.904] (-2266.524) (-2268.575) (-2267.869) -- 0:06:26
144500 -- (-2261.657) (-2272.569) [-2261.555] (-2273.828) * (-2268.630) (-2273.015) [-2268.570] (-2267.568) -- 0:06:24
145000 -- (-2260.462) [-2270.125] (-2265.870) (-2274.366) * (-2267.136) (-2275.983) [-2267.165] (-2273.142) -- 0:06:29
Average standard deviation of split frequencies: 0.024216
145500 -- (-2268.294) (-2279.649) [-2269.958] (-2267.453) * (-2265.349) (-2271.866) [-2268.588] (-2267.977) -- 0:06:27
146000 -- (-2268.704) [-2262.882] (-2260.747) (-2272.308) * (-2267.713) [-2267.029] (-2274.738) (-2267.926) -- 0:06:26
146500 -- (-2263.546) (-2265.363) [-2264.327] (-2263.988) * (-2274.956) (-2271.621) [-2279.330] (-2263.094) -- 0:06:24
147000 -- (-2270.135) [-2259.281] (-2279.102) (-2269.602) * (-2268.658) (-2271.564) (-2275.537) [-2267.646] -- 0:06:22
147500 -- (-2270.284) (-2269.898) [-2262.994] (-2262.286) * (-2269.515) (-2269.485) [-2262.763] (-2264.491) -- 0:06:27
148000 -- (-2262.532) (-2262.665) (-2269.817) [-2257.699] * (-2266.922) (-2262.562) [-2261.837] (-2266.406) -- 0:06:25
148500 -- (-2269.745) [-2269.410] (-2265.502) (-2266.800) * (-2265.686) [-2269.933] (-2269.650) (-2262.429) -- 0:06:24
149000 -- (-2271.021) [-2261.917] (-2267.730) (-2273.707) * [-2265.833] (-2276.031) (-2270.744) (-2265.766) -- 0:06:22
149500 -- (-2270.965) [-2260.092] (-2283.062) (-2275.538) * (-2263.107) (-2270.033) [-2262.692] (-2269.004) -- 0:06:26
150000 -- (-2261.812) (-2264.304) (-2271.434) [-2264.431] * (-2268.811) (-2261.448) [-2260.795] (-2267.253) -- 0:06:25
Average standard deviation of split frequencies: 0.017991
150500 -- (-2263.745) (-2266.407) (-2269.807) [-2265.288] * (-2263.064) [-2265.191] (-2269.705) (-2270.808) -- 0:06:23
151000 -- [-2267.431] (-2269.098) (-2278.101) (-2266.433) * (-2272.550) (-2271.790) [-2266.313] (-2266.752) -- 0:06:22
151500 -- (-2266.014) (-2264.792) [-2265.692] (-2265.277) * (-2272.721) (-2268.822) (-2264.032) [-2271.451] -- 0:06:20
152000 -- (-2273.690) (-2266.117) [-2260.926] (-2272.010) * [-2266.552] (-2269.441) (-2272.012) (-2264.254) -- 0:06:24
152500 -- (-2275.200) [-2266.362] (-2268.855) (-2267.822) * (-2276.678) (-2256.818) (-2274.967) [-2266.133] -- 0:06:23
153000 -- [-2268.466] (-2268.597) (-2269.155) (-2261.152) * (-2267.543) (-2270.868) (-2273.870) [-2266.242] -- 0:06:21
153500 -- (-2278.564) (-2274.658) (-2269.134) [-2263.723] * (-2274.998) (-2263.286) (-2264.219) [-2273.743] -- 0:06:20
154000 -- [-2261.898] (-2268.961) (-2266.660) (-2263.285) * [-2261.151] (-2268.131) (-2273.016) (-2279.748) -- 0:06:24
154500 -- (-2268.547) (-2274.493) [-2266.878] (-2263.398) * (-2270.892) [-2267.017] (-2262.479) (-2281.716) -- 0:06:23
155000 -- [-2265.690] (-2270.293) (-2280.832) (-2272.943) * (-2271.058) (-2273.514) [-2264.061] (-2278.536) -- 0:06:21
Average standard deviation of split frequencies: 0.014605
155500 -- (-2269.562) (-2291.933) (-2275.972) [-2269.376] * (-2266.359) (-2268.770) [-2264.965] (-2270.351) -- 0:06:20
156000 -- (-2267.699) [-2273.834] (-2275.942) (-2272.404) * [-2260.963] (-2267.807) (-2266.508) (-2271.276) -- 0:06:18
156500 -- (-2272.899) (-2274.159) [-2270.391] (-2267.574) * (-2272.800) (-2274.753) [-2261.566] (-2268.350) -- 0:06:22
157000 -- (-2270.026) (-2272.834) [-2262.455] (-2267.947) * (-2279.762) (-2277.988) (-2258.214) [-2264.781] -- 0:06:21
157500 -- (-2261.739) [-2264.267] (-2266.444) (-2271.917) * (-2279.024) (-2271.539) [-2265.768] (-2273.305) -- 0:06:19
158000 -- (-2265.267) (-2266.998) [-2269.068] (-2269.567) * [-2263.366] (-2273.936) (-2275.993) (-2264.325) -- 0:06:18
158500 -- [-2266.586] (-2268.739) (-2271.260) (-2263.395) * [-2266.613] (-2273.787) (-2275.029) (-2261.320) -- 0:06:22
159000 -- (-2270.213) [-2267.776] (-2265.185) (-2263.100) * (-2265.925) [-2264.241] (-2267.656) (-2263.701) -- 0:06:20
159500 -- [-2263.227] (-2285.991) (-2264.706) (-2264.431) * (-2272.399) (-2271.232) [-2267.757] (-2269.444) -- 0:06:19
160000 -- [-2261.976] (-2274.753) (-2266.711) (-2265.289) * (-2264.329) (-2269.320) [-2268.644] (-2269.850) -- 0:06:18
Average standard deviation of split frequencies: 0.012225
160500 -- (-2268.325) (-2263.154) (-2270.268) [-2265.894] * [-2268.920] (-2281.433) (-2270.635) (-2266.299) -- 0:06:21
161000 -- (-2276.709) [-2265.954] (-2283.100) (-2266.860) * (-2267.370) [-2263.414] (-2273.037) (-2271.003) -- 0:06:20
161500 -- (-2267.028) (-2269.032) [-2267.872] (-2269.162) * (-2264.807) [-2274.912] (-2278.734) (-2277.014) -- 0:06:19
162000 -- (-2266.941) [-2267.052] (-2268.903) (-2266.387) * (-2267.235) [-2269.786] (-2269.681) (-2269.373) -- 0:06:17
162500 -- (-2264.120) (-2267.196) (-2264.155) [-2263.477] * (-2268.356) [-2260.442] (-2267.293) (-2271.169) -- 0:06:16
163000 -- [-2261.057] (-2273.013) (-2272.960) (-2263.537) * [-2263.770] (-2275.543) (-2271.110) (-2270.389) -- 0:06:19
163500 -- (-2262.962) (-2260.579) (-2269.469) [-2261.066] * (-2270.806) (-2270.953) (-2264.951) [-2269.844] -- 0:06:18
164000 -- (-2274.890) (-2274.708) [-2267.830] (-2266.359) * (-2270.931) (-2269.722) (-2270.774) [-2265.827] -- 0:06:17
164500 -- (-2271.924) (-2279.442) (-2268.246) [-2260.462] * (-2274.517) (-2269.106) (-2268.686) [-2265.790] -- 0:06:15
165000 -- [-2269.774] (-2275.252) (-2265.043) (-2271.253) * [-2266.316] (-2268.484) (-2269.756) (-2262.590) -- 0:06:19
Average standard deviation of split frequencies: 0.009939
165500 -- (-2262.748) (-2272.384) (-2265.067) [-2269.698] * (-2269.606) (-2274.296) [-2260.962] (-2273.967) -- 0:06:18
166000 -- (-2273.918) (-2277.619) [-2265.286] (-2264.390) * [-2265.056] (-2266.674) (-2270.606) (-2264.204) -- 0:06:16
166500 -- (-2268.853) (-2260.058) (-2268.479) [-2268.885] * (-2262.222) (-2267.739) (-2270.533) [-2268.084] -- 0:06:15
167000 -- (-2261.998) (-2267.557) [-2275.868] (-2271.320) * (-2265.376) (-2279.128) [-2270.296] (-2271.317) -- 0:06:14
167500 -- (-2268.338) (-2266.993) (-2272.238) [-2266.986] * (-2269.222) (-2273.048) (-2272.179) [-2262.256] -- 0:06:17
168000 -- (-2272.264) (-2267.686) [-2278.707] (-2271.063) * [-2264.994] (-2268.272) (-2280.668) (-2283.036) -- 0:06:16
168500 -- (-2271.326) (-2262.530) [-2278.938] (-2266.672) * [-2272.036] (-2268.591) (-2268.697) (-2271.024) -- 0:06:15
169000 -- (-2276.117) [-2260.259] (-2281.844) (-2269.510) * [-2269.958] (-2273.257) (-2271.794) (-2270.728) -- 0:06:13
169500 -- (-2269.712) (-2267.472) (-2260.972) [-2274.833] * (-2268.554) [-2263.748] (-2264.585) (-2272.661) -- 0:06:17
170000 -- (-2288.692) (-2268.783) (-2269.926) [-2263.801] * (-2272.531) (-2264.034) [-2259.376] (-2270.001) -- 0:06:15
Average standard deviation of split frequencies: 0.014271
170500 -- (-2265.138) (-2274.975) [-2266.624] (-2270.549) * (-2266.295) (-2273.251) [-2269.532] (-2269.826) -- 0:06:14
171000 -- (-2268.120) (-2260.547) [-2274.575] (-2272.983) * (-2269.070) [-2259.074] (-2266.710) (-2259.287) -- 0:06:13
171500 -- (-2261.350) (-2268.965) [-2269.716] (-2266.014) * [-2265.816] (-2264.261) (-2267.389) (-2262.016) -- 0:06:16
172000 -- [-2267.098] (-2272.585) (-2273.852) (-2271.418) * [-2264.199] (-2273.744) (-2266.756) (-2267.263) -- 0:06:15
172500 -- (-2272.809) [-2281.603] (-2273.111) (-2274.139) * (-2266.043) (-2267.257) (-2277.211) [-2263.110] -- 0:06:14
173000 -- [-2261.804] (-2266.152) (-2270.767) (-2264.684) * (-2271.527) (-2271.776) (-2275.446) [-2266.902] -- 0:06:12
173500 -- [-2263.588] (-2265.754) (-2282.013) (-2279.052) * (-2267.246) (-2273.435) (-2271.380) [-2264.398] -- 0:06:11
174000 -- (-2267.724) (-2270.561) [-2270.577] (-2268.221) * (-2266.883) [-2270.048] (-2258.387) (-2266.198) -- 0:06:15
174500 -- [-2263.850] (-2272.074) (-2268.904) (-2266.382) * (-2277.778) (-2267.961) [-2268.047] (-2263.716) -- 0:06:13
175000 -- (-2263.567) [-2271.807] (-2271.139) (-2264.187) * (-2278.816) (-2273.657) (-2269.496) [-2267.089] -- 0:06:12
Average standard deviation of split frequencies: 0.013804
175500 -- (-2271.083) (-2269.054) [-2262.105] (-2274.264) * (-2268.317) (-2266.350) [-2273.002] (-2268.546) -- 0:06:11
176000 -- (-2273.029) [-2263.821] (-2266.289) (-2276.023) * (-2270.944) (-2271.387) (-2269.441) [-2265.937] -- 0:06:14
176500 -- (-2270.794) (-2274.409) [-2262.169] (-2259.744) * (-2274.763) (-2269.202) [-2268.248] (-2261.000) -- 0:06:13
177000 -- (-2271.727) (-2269.379) (-2271.211) [-2266.127] * [-2264.764] (-2266.807) (-2266.888) (-2266.070) -- 0:06:11
177500 -- (-2268.322) (-2280.766) (-2269.762) [-2267.613] * [-2261.741] (-2276.203) (-2266.370) (-2264.712) -- 0:06:10
178000 -- (-2274.804) (-2264.499) (-2270.020) [-2263.420] * [-2266.424] (-2270.869) (-2267.251) (-2263.471) -- 0:06:09
178500 -- (-2267.423) (-2267.996) [-2262.976] (-2265.262) * (-2268.506) (-2269.178) (-2270.522) [-2267.546] -- 0:06:12
179000 -- (-2271.443) (-2273.972) [-2263.487] (-2272.017) * (-2267.169) [-2265.068] (-2278.037) (-2269.683) -- 0:06:11
179500 -- [-2266.134] (-2265.536) (-2266.649) (-2267.786) * (-2268.467) (-2266.510) [-2268.971] (-2271.004) -- 0:06:10
180000 -- [-2267.954] (-2269.157) (-2280.996) (-2284.316) * (-2266.274) (-2264.082) [-2264.137] (-2268.829) -- 0:06:09
Average standard deviation of split frequencies: 0.014451
180500 -- (-2277.352) (-2266.553) [-2261.654] (-2260.722) * (-2263.358) (-2263.959) (-2270.749) [-2268.126] -- 0:06:12
181000 -- [-2269.663] (-2278.198) (-2265.005) (-2283.572) * (-2270.345) [-2260.630] (-2274.931) (-2276.903) -- 0:06:11
181500 -- (-2269.603) (-2269.088) (-2271.619) [-2264.217] * [-2265.538] (-2275.819) (-2272.467) (-2269.948) -- 0:06:09
182000 -- [-2266.081] (-2277.967) (-2278.963) (-2264.927) * [-2266.940] (-2263.174) (-2273.658) (-2264.326) -- 0:06:08
182500 -- [-2275.997] (-2263.743) (-2279.228) (-2262.312) * (-2276.764) (-2267.078) (-2270.335) [-2265.566] -- 0:06:11
183000 -- (-2259.565) (-2261.937) (-2273.844) [-2264.577] * (-2273.136) (-2278.170) (-2265.227) [-2262.202] -- 0:06:10
183500 -- [-2261.337] (-2266.076) (-2272.206) (-2273.323) * (-2267.470) [-2268.126] (-2269.322) (-2268.854) -- 0:06:09
184000 -- (-2263.018) (-2267.032) (-2282.035) [-2274.888] * (-2267.568) [-2280.294] (-2270.290) (-2272.539) -- 0:06:08
184500 -- (-2264.040) (-2266.222) [-2262.570] (-2266.046) * (-2267.027) (-2275.365) (-2271.375) [-2267.489] -- 0:06:06
185000 -- (-2266.666) [-2266.552] (-2271.936) (-2264.846) * (-2270.825) [-2270.564] (-2278.871) (-2268.527) -- 0:06:10
Average standard deviation of split frequencies: 0.013257
185500 -- (-2271.693) (-2276.824) [-2266.146] (-2266.141) * [-2260.580] (-2269.814) (-2277.318) (-2271.436) -- 0:06:08
186000 -- (-2274.649) (-2288.295) (-2267.788) [-2274.091] * (-2275.386) (-2277.126) [-2265.492] (-2270.743) -- 0:06:07
186500 -- [-2279.441] (-2265.805) (-2265.904) (-2274.223) * (-2268.925) [-2265.885] (-2265.993) (-2263.990) -- 0:06:06
187000 -- (-2270.300) [-2260.046] (-2263.886) (-2262.732) * (-2274.615) [-2270.464] (-2264.425) (-2271.861) -- 0:06:09
187500 -- (-2278.177) (-2271.558) (-2274.606) [-2262.662] * (-2272.949) [-2262.454] (-2268.845) (-2270.734) -- 0:06:08
188000 -- (-2282.197) (-2266.459) [-2262.669] (-2266.683) * [-2263.151] (-2267.747) (-2264.367) (-2265.864) -- 0:06:07
188500 -- (-2279.429) (-2266.124) [-2265.958] (-2270.393) * (-2269.113) (-2278.196) [-2262.910] (-2268.638) -- 0:06:05
189000 -- [-2269.422] (-2268.503) (-2277.294) (-2262.355) * (-2268.458) (-2265.160) [-2274.884] (-2270.891) -- 0:06:04
189500 -- (-2267.619) (-2271.240) [-2263.501] (-2270.170) * [-2260.733] (-2268.834) (-2266.655) (-2277.227) -- 0:06:07
190000 -- (-2270.834) (-2269.517) (-2262.263) [-2268.878] * [-2267.489] (-2267.169) (-2280.187) (-2276.929) -- 0:06:06
Average standard deviation of split frequencies: 0.014010
190500 -- (-2265.641) [-2261.770] (-2261.150) (-2272.888) * [-2267.259] (-2267.336) (-2269.248) (-2274.879) -- 0:06:05
191000 -- [-2260.470] (-2270.956) (-2263.992) (-2268.025) * (-2265.883) (-2268.672) [-2269.402] (-2284.332) -- 0:06:04
191500 -- (-2275.021) (-2267.680) (-2262.916) [-2262.367] * [-2270.669] (-2274.788) (-2267.173) (-2273.501) -- 0:06:07
192000 -- (-2269.202) [-2263.001] (-2262.553) (-2270.359) * [-2267.153] (-2267.975) (-2271.007) (-2265.677) -- 0:06:06
192500 -- (-2269.073) (-2270.873) (-2263.383) [-2269.384] * (-2265.639) [-2270.326] (-2278.602) (-2265.607) -- 0:06:04
193000 -- (-2272.357) (-2266.057) [-2263.010] (-2262.759) * (-2274.165) (-2277.268) [-2273.714] (-2268.939) -- 0:06:03
193500 -- (-2270.543) (-2261.239) [-2259.735] (-2266.960) * (-2265.718) [-2269.786] (-2272.926) (-2262.321) -- 0:06:02
194000 -- (-2267.233) (-2262.547) [-2260.269] (-2269.540) * [-2264.270] (-2284.324) (-2261.435) (-2274.573) -- 0:06:05
194500 -- (-2269.943) [-2261.897] (-2265.980) (-2274.104) * [-2265.635] (-2274.168) (-2267.886) (-2263.204) -- 0:06:04
195000 -- [-2266.125] (-2279.255) (-2272.420) (-2268.316) * (-2275.829) (-2279.852) (-2265.585) [-2263.022] -- 0:06:03
Average standard deviation of split frequencies: 0.014431
195500 -- (-2274.812) (-2268.707) [-2262.744] (-2272.523) * [-2264.484] (-2278.861) (-2275.061) (-2267.600) -- 0:06:02
196000 -- [-2264.848] (-2279.392) (-2259.150) (-2278.199) * (-2261.994) (-2271.461) (-2267.460) [-2260.748] -- 0:06:05
196500 -- (-2270.549) (-2266.887) [-2262.498] (-2268.079) * [-2265.452] (-2273.250) (-2264.894) (-2266.797) -- 0:06:03
197000 -- (-2263.371) (-2266.549) (-2273.260) [-2266.199] * (-2262.750) (-2266.310) (-2277.895) [-2260.412] -- 0:06:02
197500 -- (-2266.069) [-2267.540] (-2269.743) (-2261.080) * (-2271.262) (-2262.527) (-2268.990) [-2273.478] -- 0:06:01
198000 -- (-2270.142) (-2267.277) (-2267.425) [-2261.228] * (-2270.865) (-2270.500) (-2270.111) [-2269.920] -- 0:06:04
198500 -- (-2271.253) (-2281.116) (-2262.000) [-2268.259] * (-2279.357) (-2270.857) [-2263.901] (-2269.221) -- 0:06:03
199000 -- (-2266.837) (-2270.592) [-2265.455] (-2263.215) * [-2262.644] (-2272.349) (-2260.848) (-2263.046) -- 0:06:02
199500 -- (-2260.027) [-2266.658] (-2277.961) (-2267.295) * (-2270.662) (-2271.330) (-2268.701) [-2263.670] -- 0:06:01
200000 -- (-2267.820) [-2257.703] (-2273.226) (-2275.592) * (-2268.703) (-2279.537) [-2268.075] (-2269.392) -- 0:06:00
Average standard deviation of split frequencies: 0.012529
200500 -- (-2270.738) (-2262.264) [-2264.630] (-2264.458) * [-2268.953] (-2272.236) (-2265.412) (-2270.719) -- 0:06:02
201000 -- (-2273.718) (-2265.208) [-2266.249] (-2265.840) * (-2281.344) [-2271.630] (-2270.892) (-2269.870) -- 0:06:01
201500 -- (-2275.161) [-2266.036] (-2271.157) (-2268.745) * (-2272.780) [-2265.360] (-2264.206) (-2270.641) -- 0:06:00
202000 -- (-2275.851) (-2276.180) (-2267.104) [-2265.826] * (-2265.979) [-2264.956] (-2271.968) (-2267.321) -- 0:05:59
202500 -- [-2262.705] (-2269.679) (-2266.860) (-2284.576) * (-2271.905) (-2276.075) (-2263.301) [-2265.162] -- 0:06:02
203000 -- [-2270.646] (-2274.051) (-2277.025) (-2274.547) * (-2266.493) (-2276.877) [-2269.011] (-2270.783) -- 0:06:01
203500 -- [-2273.679] (-2268.042) (-2267.501) (-2263.048) * (-2262.006) (-2278.867) [-2270.646] (-2270.388) -- 0:06:00
204000 -- (-2268.032) (-2264.749) [-2275.400] (-2272.502) * (-2269.182) [-2270.000] (-2268.307) (-2274.864) -- 0:05:58
204500 -- (-2284.001) (-2278.456) (-2269.339) [-2267.368] * [-2266.245] (-2269.269) (-2263.275) (-2269.084) -- 0:05:57
205000 -- [-2273.917] (-2269.922) (-2274.354) (-2270.241) * (-2275.776) [-2264.750] (-2269.734) (-2268.629) -- 0:06:00
Average standard deviation of split frequencies: 0.012777
205500 -- (-2261.917) [-2261.955] (-2261.736) (-2260.947) * (-2270.295) (-2267.819) (-2269.128) [-2270.176] -- 0:05:59
206000 -- (-2261.565) (-2273.297) [-2268.024] (-2267.148) * [-2268.340] (-2264.785) (-2274.756) (-2269.604) -- 0:05:58
206500 -- (-2268.556) (-2265.936) [-2266.036] (-2265.485) * (-2267.021) (-2279.224) [-2266.746] (-2267.447) -- 0:05:57
207000 -- (-2265.959) (-2274.152) (-2270.813) [-2265.781] * (-2271.012) [-2274.262] (-2264.421) (-2267.146) -- 0:06:00
207500 -- (-2270.999) (-2268.788) (-2267.426) [-2267.432] * [-2267.094] (-2269.852) (-2277.585) (-2269.244) -- 0:05:59
208000 -- (-2264.004) (-2264.506) [-2267.048] (-2269.724) * (-2268.973) [-2268.255] (-2266.367) (-2276.462) -- 0:05:57
208500 -- [-2266.378] (-2272.639) (-2276.802) (-2264.778) * (-2270.220) (-2268.490) (-2268.755) [-2262.765] -- 0:05:56
209000 -- [-2262.274] (-2279.394) (-2270.792) (-2264.314) * (-2258.977) (-2265.550) [-2268.921] (-2267.816) -- 0:05:59
209500 -- (-2267.687) [-2261.033] (-2267.254) (-2269.471) * (-2268.738) (-2269.145) (-2266.261) [-2268.291] -- 0:05:58
210000 -- (-2270.105) [-2262.573] (-2270.672) (-2272.584) * [-2269.516] (-2277.934) (-2261.813) (-2271.906) -- 0:05:57
Average standard deviation of split frequencies: 0.009968
210500 -- (-2266.914) [-2265.825] (-2266.509) (-2270.506) * (-2271.479) (-2265.324) [-2273.305] (-2271.703) -- 0:05:56
211000 -- (-2267.399) (-2266.779) (-2265.378) [-2258.006] * (-2265.427) (-2269.808) (-2272.981) [-2265.050] -- 0:05:55
211500 -- (-2278.004) [-2269.886] (-2271.766) (-2257.142) * (-2270.214) [-2272.881] (-2268.552) (-2263.989) -- 0:05:57
212000 -- (-2264.602) [-2271.771] (-2274.676) (-2267.891) * (-2274.070) (-2270.176) (-2270.384) [-2264.726] -- 0:05:56
212500 -- (-2273.272) (-2274.196) [-2267.741] (-2270.373) * (-2269.200) [-2262.468] (-2273.539) (-2265.912) -- 0:05:55
213000 -- (-2269.684) [-2273.054] (-2268.939) (-2262.492) * [-2266.782] (-2268.720) (-2271.153) (-2274.278) -- 0:05:54
213500 -- (-2270.107) [-2273.248] (-2271.539) (-2265.032) * [-2263.964] (-2268.220) (-2286.157) (-2265.038) -- 0:05:57
214000 -- (-2264.323) [-2266.435] (-2283.557) (-2264.487) * (-2283.805) [-2266.291] (-2261.780) (-2264.179) -- 0:05:56
214500 -- (-2274.308) [-2265.692] (-2265.197) (-2271.010) * [-2260.031] (-2267.907) (-2265.468) (-2265.594) -- 0:05:55
215000 -- (-2282.459) (-2273.709) [-2263.390] (-2268.211) * (-2270.510) (-2266.381) [-2269.023] (-2273.496) -- 0:05:54
Average standard deviation of split frequencies: 0.009523
215500 -- (-2270.633) (-2267.115) [-2260.459] (-2270.616) * (-2272.606) (-2263.317) (-2264.071) [-2269.139] -- 0:05:53
216000 -- (-2272.284) [-2270.709] (-2271.702) (-2264.962) * (-2272.390) [-2265.642] (-2262.571) (-2272.967) -- 0:05:55
216500 -- (-2265.637) [-2265.652] (-2269.418) (-2271.059) * (-2267.671) (-2276.220) [-2264.951] (-2271.915) -- 0:05:54
217000 -- (-2260.165) (-2263.846) (-2273.879) [-2272.550] * [-2264.538] (-2267.168) (-2268.106) (-2269.127) -- 0:05:53
217500 -- (-2270.420) (-2264.444) [-2271.054] (-2268.248) * (-2266.849) (-2276.078) (-2269.122) [-2263.296] -- 0:05:52
218000 -- [-2268.266] (-2265.251) (-2268.467) (-2268.237) * (-2270.429) [-2261.623] (-2269.155) (-2269.179) -- 0:05:55
218500 -- (-2270.207) (-2265.457) (-2269.676) [-2274.958] * (-2263.907) (-2276.535) (-2266.502) [-2276.373] -- 0:05:54
219000 -- [-2268.238] (-2269.423) (-2269.614) (-2274.873) * (-2283.096) [-2264.070] (-2262.853) (-2271.331) -- 0:05:53
219500 -- (-2270.260) (-2268.548) (-2270.748) [-2260.187] * (-2268.587) (-2268.869) (-2263.456) [-2264.235] -- 0:05:52
220000 -- (-2268.621) (-2264.661) (-2268.943) [-2270.406] * [-2262.840] (-2266.598) (-2268.872) (-2267.753) -- 0:05:54
Average standard deviation of split frequencies: 0.009322
220500 -- [-2267.400] (-2275.531) (-2274.048) (-2274.937) * [-2268.374] (-2263.406) (-2270.572) (-2265.786) -- 0:05:53
221000 -- (-2267.315) [-2274.981] (-2270.147) (-2273.743) * (-2273.543) [-2259.814] (-2263.207) (-2268.031) -- 0:05:52
221500 -- (-2262.285) (-2264.563) [-2273.690] (-2269.913) * (-2269.517) [-2259.939] (-2266.279) (-2282.111) -- 0:05:51
222000 -- (-2267.025) [-2263.694] (-2263.879) (-2261.214) * (-2282.492) (-2264.699) (-2266.143) [-2269.112] -- 0:05:50
222500 -- (-2274.440) [-2270.786] (-2273.335) (-2267.464) * (-2280.613) [-2262.580] (-2270.111) (-2272.726) -- 0:05:52
223000 -- (-2271.862) [-2261.655] (-2271.321) (-2274.825) * (-2273.837) (-2267.700) (-2268.703) [-2268.119] -- 0:05:51
223500 -- (-2266.910) (-2270.985) (-2272.139) [-2261.431] * (-2279.382) (-2273.591) [-2264.081] (-2263.874) -- 0:05:50
224000 -- (-2271.029) (-2280.047) [-2271.960] (-2269.014) * (-2266.861) (-2284.457) [-2263.141] (-2260.888) -- 0:05:49
224500 -- (-2276.620) (-2271.487) [-2269.095] (-2267.260) * [-2268.301] (-2274.955) (-2260.082) (-2267.717) -- 0:05:52
225000 -- [-2264.014] (-2268.333) (-2270.377) (-2277.327) * (-2274.961) (-2275.296) (-2263.003) [-2266.679] -- 0:05:51
Average standard deviation of split frequencies: 0.007648
225500 -- [-2270.213] (-2271.166) (-2263.857) (-2262.576) * (-2270.981) (-2285.719) [-2262.694] (-2259.536) -- 0:05:50
226000 -- (-2271.952) (-2266.780) (-2268.063) [-2272.936] * [-2266.552] (-2267.439) (-2274.021) (-2278.469) -- 0:05:49
226500 -- (-2265.367) (-2266.759) [-2266.279] (-2263.569) * (-2269.539) (-2264.338) [-2265.673] (-2261.646) -- 0:05:48
227000 -- (-2263.592) (-2270.288) [-2261.098] (-2274.621) * (-2260.215) (-2274.166) (-2267.402) [-2264.648] -- 0:05:50
227500 -- [-2266.954] (-2277.170) (-2264.096) (-2271.845) * (-2271.749) (-2269.559) (-2269.768) [-2264.349] -- 0:05:49
228000 -- (-2270.987) (-2284.723) [-2266.640] (-2263.151) * (-2266.427) (-2272.155) (-2267.667) [-2264.746] -- 0:05:48
228500 -- (-2271.915) (-2274.432) [-2268.141] (-2269.863) * [-2262.474] (-2267.626) (-2262.191) (-2269.242) -- 0:05:47
229000 -- (-2269.037) (-2262.069) [-2260.049] (-2271.625) * (-2268.850) (-2275.193) [-2274.915] (-2273.695) -- 0:05:50
229500 -- (-2265.976) (-2266.043) (-2271.381) [-2266.668] * (-2271.601) (-2274.364) (-2267.980) [-2276.616] -- 0:05:49
230000 -- (-2284.845) [-2268.620] (-2267.595) (-2263.114) * (-2274.224) (-2267.800) (-2271.924) [-2263.041] -- 0:05:48
Average standard deviation of split frequencies: 0.010961
230500 -- (-2277.286) [-2263.883] (-2274.034) (-2264.677) * (-2268.173) (-2269.326) (-2272.061) [-2264.117] -- 0:05:47
231000 -- (-2266.279) (-2277.912) (-2264.498) [-2261.019] * (-2270.521) [-2278.182] (-2274.019) (-2268.914) -- 0:05:46
231500 -- (-2274.628) (-2274.524) (-2264.135) [-2263.440] * (-2266.480) (-2286.766) [-2263.743] (-2265.237) -- 0:05:48
232000 -- [-2267.976] (-2270.154) (-2266.300) (-2275.297) * [-2272.105] (-2269.603) (-2277.500) (-2271.891) -- 0:05:47
232500 -- [-2267.033] (-2260.998) (-2268.092) (-2286.570) * (-2270.135) (-2271.603) (-2275.827) [-2263.017] -- 0:05:46
233000 -- [-2270.669] (-2263.551) (-2276.136) (-2278.135) * (-2281.475) (-2268.848) (-2267.984) [-2265.123] -- 0:05:45
233500 -- (-2266.546) (-2263.929) [-2277.207] (-2268.322) * (-2274.833) (-2268.743) [-2263.492] (-2261.128) -- 0:05:47
234000 -- (-2264.234) (-2272.377) [-2263.993] (-2265.934) * (-2267.882) (-2270.924) (-2276.733) [-2274.910] -- 0:05:46
234500 -- [-2264.454] (-2264.608) (-2257.566) (-2275.185) * (-2268.644) (-2267.796) [-2269.531] (-2267.247) -- 0:05:46
235000 -- (-2271.473) (-2268.797) (-2268.896) [-2264.111] * (-2283.296) [-2264.135] (-2262.479) (-2273.538) -- 0:05:45
Average standard deviation of split frequencies: 0.011652
235500 -- [-2266.642] (-2272.750) (-2264.023) (-2273.691) * (-2270.151) (-2270.432) [-2267.025] (-2273.078) -- 0:05:47
236000 -- [-2263.022] (-2272.022) (-2265.229) (-2264.302) * [-2267.996] (-2268.878) (-2275.567) (-2272.037) -- 0:05:46
236500 -- (-2276.254) (-2273.759) [-2265.936] (-2265.485) * (-2266.551) (-2263.485) (-2281.597) [-2269.132] -- 0:05:45
237000 -- (-2257.074) (-2274.077) (-2262.678) [-2267.684] * (-2269.528) (-2266.860) [-2265.574] (-2265.899) -- 0:05:44
237500 -- (-2266.616) [-2272.798] (-2275.553) (-2267.237) * (-2267.100) (-2266.835) [-2269.697] (-2263.864) -- 0:05:43
238000 -- [-2269.591] (-2272.579) (-2267.402) (-2279.613) * (-2266.540) (-2275.857) [-2272.166] (-2263.246) -- 0:05:45
238500 -- (-2276.754) (-2282.061) (-2267.962) [-2261.867] * (-2274.290) [-2266.069] (-2269.318) (-2269.850) -- 0:05:44
239000 -- [-2264.883] (-2269.760) (-2269.707) (-2280.232) * (-2267.392) (-2265.301) [-2271.516] (-2279.649) -- 0:05:43
239500 -- (-2279.669) (-2265.069) (-2263.198) [-2263.833] * [-2268.262] (-2273.027) (-2265.600) (-2278.502) -- 0:05:42
240000 -- (-2277.094) (-2265.766) (-2263.200) [-2262.649] * (-2267.025) (-2260.946) [-2279.803] (-2271.467) -- 0:05:45
Average standard deviation of split frequencies: 0.010684
240500 -- (-2267.646) [-2262.924] (-2268.276) (-2275.935) * (-2270.377) (-2270.345) (-2273.119) [-2273.440] -- 0:05:44
241000 -- (-2275.552) (-2271.880) (-2268.779) [-2266.033] * (-2275.607) (-2274.186) (-2273.439) [-2261.110] -- 0:05:43
241500 -- (-2265.791) (-2269.091) (-2270.668) [-2271.384] * (-2266.204) (-2265.523) (-2268.287) [-2261.223] -- 0:05:42
242000 -- (-2264.623) (-2270.144) [-2268.762] (-2276.288) * (-2263.768) [-2268.504] (-2269.940) (-2276.193) -- 0:05:41
242500 -- (-2268.437) (-2276.779) [-2265.643] (-2277.197) * (-2263.420) (-2269.235) (-2265.442) [-2265.547] -- 0:05:43
243000 -- (-2263.065) (-2272.513) [-2260.129] (-2269.300) * (-2260.517) (-2267.389) [-2268.024] (-2264.585) -- 0:05:42
243500 -- [-2265.051] (-2266.844) (-2270.743) (-2268.214) * [-2266.430] (-2270.798) (-2277.181) (-2263.533) -- 0:05:41
244000 -- (-2267.832) (-2270.407) [-2265.444] (-2265.265) * (-2277.712) (-2272.441) (-2278.085) [-2263.159] -- 0:05:40
244500 -- (-2265.740) (-2271.988) (-2266.569) [-2261.567] * (-2274.815) (-2265.501) [-2265.447] (-2266.020) -- 0:05:42
245000 -- (-2269.604) (-2272.537) [-2264.285] (-2261.568) * [-2267.879] (-2272.672) (-2262.290) (-2261.491) -- 0:05:42
Average standard deviation of split frequencies: 0.013095
245500 -- (-2270.513) (-2263.237) [-2265.280] (-2263.876) * [-2260.999] (-2268.073) (-2264.401) (-2269.191) -- 0:05:41
246000 -- [-2275.215] (-2279.697) (-2278.009) (-2275.234) * (-2265.546) [-2270.708] (-2275.814) (-2264.117) -- 0:05:40
246500 -- (-2267.741) (-2275.232) [-2267.068] (-2263.100) * [-2265.791] (-2271.086) (-2264.552) (-2268.697) -- 0:05:42
247000 -- (-2267.987) [-2268.718] (-2265.759) (-2277.935) * (-2265.753) (-2278.491) (-2268.088) [-2269.271] -- 0:05:41
247500 -- (-2267.680) [-2263.921] (-2263.948) (-2275.452) * (-2266.428) (-2270.527) (-2266.443) [-2271.988] -- 0:05:40
248000 -- (-2261.862) [-2265.656] (-2265.963) (-2272.716) * (-2272.410) (-2271.912) (-2267.483) [-2267.338] -- 0:05:39
248500 -- (-2269.502) (-2272.636) [-2264.538] (-2274.656) * (-2263.202) (-2269.993) (-2277.899) [-2267.156] -- 0:05:38
249000 -- [-2264.808] (-2280.143) (-2264.243) (-2269.892) * (-2267.128) (-2272.883) (-2282.099) [-2263.241] -- 0:05:40
249500 -- (-2264.014) (-2264.641) [-2268.282] (-2278.047) * (-2275.622) [-2264.690] (-2270.358) (-2258.700) -- 0:05:39
250000 -- [-2266.052] (-2261.394) (-2268.374) (-2270.473) * (-2269.335) [-2266.866] (-2269.998) (-2275.345) -- 0:05:39
Average standard deviation of split frequencies: 0.012309
250500 -- (-2265.359) [-2265.740] (-2267.849) (-2267.572) * (-2264.141) (-2269.784) [-2273.679] (-2264.990) -- 0:05:38
251000 -- (-2275.447) [-2264.246] (-2268.196) (-2263.669) * (-2266.806) (-2272.442) [-2269.350] (-2267.073) -- 0:05:40
251500 -- (-2265.727) [-2268.842] (-2266.095) (-2269.875) * (-2268.903) (-2270.384) (-2269.120) [-2263.828] -- 0:05:39
252000 -- (-2267.187) (-2273.662) [-2271.812] (-2261.006) * (-2265.631) (-2279.840) (-2283.996) [-2267.810] -- 0:05:38
252500 -- (-2274.942) (-2265.270) (-2264.347) [-2265.021] * [-2268.947] (-2272.953) (-2264.958) (-2262.341) -- 0:05:37
253000 -- (-2269.889) (-2273.996) (-2268.551) [-2269.786] * (-2277.481) (-2269.289) [-2267.917] (-2266.509) -- 0:05:36
253500 -- (-2282.624) [-2273.791] (-2271.164) (-2270.212) * (-2274.213) [-2272.137] (-2270.041) (-2267.966) -- 0:05:38
254000 -- (-2286.136) (-2262.724) [-2263.330] (-2270.037) * (-2276.185) (-2268.483) [-2264.436] (-2270.820) -- 0:05:37
254500 -- (-2273.049) (-2269.806) (-2267.151) [-2269.743] * (-2274.729) [-2275.877] (-2280.766) (-2271.737) -- 0:05:36
255000 -- (-2263.718) (-2271.077) [-2266.552] (-2278.334) * [-2261.855] (-2262.871) (-2267.222) (-2267.483) -- 0:05:35
Average standard deviation of split frequencies: 0.011551
255500 -- (-2262.130) (-2274.143) [-2266.937] (-2280.849) * (-2273.225) [-2264.675] (-2262.991) (-2265.309) -- 0:05:38
256000 -- (-2266.161) [-2262.476] (-2275.168) (-2276.794) * (-2269.065) [-2271.079] (-2271.068) (-2270.837) -- 0:05:37
256500 -- [-2265.424] (-2265.483) (-2274.023) (-2265.113) * (-2266.268) [-2270.374] (-2265.800) (-2278.450) -- 0:05:36
257000 -- (-2267.480) [-2264.160] (-2279.573) (-2262.792) * [-2260.695] (-2264.928) (-2273.077) (-2265.081) -- 0:05:35
257500 -- (-2266.025) (-2268.750) [-2261.719] (-2272.200) * [-2272.376] (-2273.693) (-2271.065) (-2271.765) -- 0:05:37
258000 -- (-2270.140) [-2275.316] (-2267.229) (-2284.269) * (-2262.024) (-2274.338) (-2268.635) [-2265.513] -- 0:05:36
258500 -- [-2272.377] (-2273.385) (-2268.711) (-2272.774) * (-2269.559) (-2270.127) (-2263.031) [-2272.960] -- 0:05:35
259000 -- (-2273.320) [-2267.905] (-2286.219) (-2271.716) * (-2275.503) (-2269.347) (-2274.258) [-2280.303] -- 0:05:34
259500 -- [-2262.636] (-2272.800) (-2277.460) (-2271.617) * (-2268.299) (-2274.680) (-2268.561) [-2270.162] -- 0:05:33
260000 -- (-2264.764) [-2263.389] (-2280.445) (-2267.998) * [-2265.371] (-2270.307) (-2263.601) (-2268.021) -- 0:05:35
Average standard deviation of split frequencies: 0.011673
260500 -- (-2263.536) [-2269.712] (-2265.514) (-2265.631) * (-2266.161) (-2279.259) [-2268.784] (-2277.854) -- 0:05:34
261000 -- [-2266.172] (-2275.527) (-2272.674) (-2271.946) * (-2276.266) (-2268.740) [-2269.126] (-2274.415) -- 0:05:34
261500 -- (-2264.197) (-2274.977) (-2277.740) [-2268.631] * (-2274.232) [-2271.392] (-2269.260) (-2261.966) -- 0:05:33
262000 -- (-2264.153) (-2291.836) (-2277.480) [-2267.502] * (-2263.582) (-2272.118) (-2269.376) [-2268.194] -- 0:05:35
262500 -- (-2268.834) (-2282.435) (-2271.857) [-2268.681] * (-2272.551) (-2264.778) [-2276.627] (-2275.130) -- 0:05:34
263000 -- [-2267.729] (-2278.287) (-2264.960) (-2267.147) * (-2267.831) (-2268.364) (-2267.618) [-2263.458] -- 0:05:33
263500 -- (-2275.296) (-2275.485) [-2272.990] (-2271.150) * (-2272.839) (-2270.762) [-2268.973] (-2269.482) -- 0:05:32
264000 -- [-2271.520] (-2273.005) (-2271.348) (-2270.941) * (-2263.621) (-2276.053) (-2261.411) [-2268.099] -- 0:05:31
264500 -- (-2269.553) (-2260.602) [-2268.055] (-2266.443) * (-2273.057) (-2272.677) (-2265.278) [-2267.671] -- 0:05:33
265000 -- (-2271.714) (-2267.954) (-2267.429) [-2264.813] * (-2283.116) (-2274.340) (-2264.055) [-2263.121] -- 0:05:32
Average standard deviation of split frequencies: 0.013694
265500 -- [-2260.729] (-2273.428) (-2269.219) (-2264.981) * (-2267.149) [-2270.170] (-2259.477) (-2270.528) -- 0:05:31
266000 -- (-2265.203) (-2269.703) (-2272.746) [-2266.607] * (-2263.473) (-2268.772) (-2267.169) [-2267.644] -- 0:05:31
266500 -- [-2261.386] (-2270.638) (-2275.039) (-2279.909) * [-2272.196] (-2278.040) (-2260.367) (-2267.061) -- 0:05:33
267000 -- (-2268.196) (-2271.461) [-2265.650] (-2265.087) * (-2268.511) (-2277.971) [-2258.944] (-2273.058) -- 0:05:32
267500 -- (-2264.926) (-2273.592) [-2264.370] (-2262.991) * (-2259.921) (-2274.746) [-2259.376] (-2267.435) -- 0:05:31
268000 -- [-2270.594] (-2265.528) (-2274.072) (-2266.825) * (-2263.762) [-2264.913] (-2270.765) (-2266.450) -- 0:05:30
268500 -- (-2269.716) (-2268.665) [-2268.101] (-2278.835) * (-2263.345) [-2264.214] (-2264.691) (-2265.196) -- 0:05:32
269000 -- (-2268.052) (-2264.388) [-2264.459] (-2265.506) * (-2269.414) (-2270.511) [-2262.194] (-2279.683) -- 0:05:31
269500 -- (-2268.587) [-2269.209] (-2276.033) (-2273.517) * (-2265.625) (-2268.660) [-2262.653] (-2263.281) -- 0:05:30
270000 -- [-2268.319] (-2269.029) (-2274.702) (-2279.495) * (-2266.419) (-2273.271) (-2266.918) [-2267.325] -- 0:05:29
Average standard deviation of split frequencies: 0.013775
270500 -- (-2270.149) (-2291.030) (-2275.108) [-2271.924] * (-2270.303) (-2272.893) [-2261.874] (-2273.386) -- 0:05:29
271000 -- [-2264.295] (-2280.702) (-2267.613) (-2269.090) * (-2277.985) (-2271.722) (-2270.853) [-2267.209] -- 0:05:30
271500 -- (-2260.958) (-2285.105) (-2263.447) [-2277.345] * (-2266.573) [-2265.825] (-2265.915) (-2268.484) -- 0:05:30
272000 -- (-2261.743) [-2269.501] (-2277.193) (-2271.281) * (-2265.531) [-2266.772] (-2268.627) (-2279.840) -- 0:05:29
272500 -- (-2262.911) [-2271.692] (-2277.148) (-2263.799) * (-2267.594) (-2270.552) [-2267.402] (-2269.212) -- 0:05:28
273000 -- (-2275.561) (-2265.747) [-2274.863] (-2267.976) * [-2274.173] (-2270.726) (-2263.956) (-2273.300) -- 0:05:30
273500 -- (-2268.606) (-2264.539) (-2267.027) [-2259.867] * (-2277.666) (-2264.514) [-2267.641] (-2273.220) -- 0:05:29
274000 -- (-2275.528) (-2273.506) (-2269.623) [-2269.859] * [-2272.225] (-2267.096) (-2268.382) (-2272.593) -- 0:05:28
274500 -- (-2269.251) (-2267.864) (-2267.865) [-2262.602] * (-2262.972) (-2270.087) (-2268.327) [-2260.401] -- 0:05:27
275000 -- (-2278.391) (-2269.188) (-2266.383) [-2267.820] * (-2265.615) (-2263.871) [-2263.931] (-2266.577) -- 0:05:26
Average standard deviation of split frequencies: 0.013509
275500 -- (-2278.761) (-2267.463) [-2270.775] (-2263.786) * (-2268.157) (-2265.425) [-2262.164] (-2268.780) -- 0:05:28
276000 -- (-2271.584) (-2265.491) [-2264.723] (-2273.126) * (-2265.182) [-2273.397] (-2270.950) (-2277.250) -- 0:05:27
276500 -- (-2275.894) (-2261.184) [-2265.429] (-2278.333) * (-2264.468) (-2268.916) [-2263.185] (-2261.672) -- 0:05:27
277000 -- (-2265.338) (-2263.872) [-2275.977] (-2270.662) * (-2272.717) [-2270.147] (-2264.281) (-2269.945) -- 0:05:26
277500 -- (-2268.906) (-2265.467) (-2261.892) [-2272.552] * (-2269.353) [-2272.330] (-2268.819) (-2268.620) -- 0:05:28
278000 -- (-2260.559) (-2270.283) [-2267.931] (-2266.816) * (-2271.131) (-2269.209) [-2261.374] (-2269.306) -- 0:05:27
278500 -- (-2257.818) (-2265.702) [-2271.518] (-2279.428) * (-2270.494) (-2272.334) [-2265.629] (-2263.524) -- 0:05:26
279000 -- (-2267.874) [-2265.701] (-2263.130) (-2279.844) * [-2267.408] (-2272.533) (-2265.512) (-2269.238) -- 0:05:25
279500 -- (-2273.565) (-2262.036) (-2266.530) [-2274.637] * (-2268.650) [-2261.831] (-2266.424) (-2272.538) -- 0:05:24
280000 -- (-2270.322) (-2272.443) [-2265.906] (-2281.752) * [-2262.916] (-2262.514) (-2269.016) (-2262.981) -- 0:05:26
Average standard deviation of split frequencies: 0.014047
280500 -- (-2270.373) (-2276.442) (-2267.984) [-2267.261] * (-2264.646) [-2265.301] (-2269.426) (-2273.022) -- 0:05:25
281000 -- [-2262.137] (-2265.556) (-2264.327) (-2269.374) * [-2262.800] (-2269.474) (-2262.472) (-2266.775) -- 0:05:24
281500 -- (-2274.175) (-2261.376) [-2278.788] (-2271.207) * [-2263.626] (-2262.433) (-2264.665) (-2279.299) -- 0:05:24
282000 -- (-2272.691) [-2263.964] (-2275.102) (-2260.674) * (-2269.369) (-2263.447) [-2269.858] (-2263.294) -- 0:05:25
282500 -- [-2263.535] (-2281.388) (-2272.912) (-2271.859) * (-2265.377) (-2264.230) [-2264.331] (-2266.211) -- 0:05:25
283000 -- (-2271.049) (-2295.630) (-2274.560) [-2267.521] * (-2262.344) [-2262.970] (-2268.576) (-2271.228) -- 0:05:24
283500 -- [-2264.798] (-2276.645) (-2272.295) (-2269.793) * (-2261.515) (-2273.202) (-2259.901) [-2261.559] -- 0:05:23
284000 -- (-2268.272) (-2270.357) [-2265.889] (-2273.570) * [-2265.920] (-2286.102) (-2271.259) (-2272.487) -- 0:05:25
284500 -- [-2274.604] (-2281.861) (-2266.784) (-2262.276) * (-2271.050) [-2272.935] (-2281.848) (-2267.488) -- 0:05:24
285000 -- (-2266.472) (-2266.615) [-2270.788] (-2268.552) * (-2268.652) (-2264.182) (-2265.105) [-2264.800] -- 0:05:23
Average standard deviation of split frequencies: 0.012911
285500 -- (-2275.165) (-2278.379) (-2266.832) [-2271.111] * (-2276.427) (-2276.426) (-2262.273) [-2263.123] -- 0:05:22
286000 -- (-2266.589) (-2272.253) (-2271.807) [-2270.462] * (-2276.504) (-2263.385) [-2266.983] (-2275.110) -- 0:05:22
286500 -- (-2264.125) (-2268.555) (-2265.563) [-2275.118] * [-2265.309] (-2266.266) (-2279.639) (-2270.067) -- 0:05:23
287000 -- (-2265.257) (-2266.533) (-2269.466) [-2260.642] * [-2272.104] (-2263.536) (-2268.623) (-2270.377) -- 0:05:22
287500 -- (-2267.649) (-2272.022) (-2270.920) [-2266.450] * (-2270.109) (-2261.961) (-2273.591) [-2267.884] -- 0:05:22
288000 -- [-2266.969] (-2267.117) (-2265.888) (-2276.100) * (-2273.249) (-2273.512) [-2269.133] (-2265.746) -- 0:05:21
288500 -- (-2272.387) [-2270.535] (-2265.425) (-2281.376) * (-2263.754) (-2271.083) (-2265.597) [-2262.035] -- 0:05:23
289000 -- (-2265.753) (-2273.250) [-2263.844] (-2268.275) * [-2263.793] (-2267.079) (-2268.945) (-2268.949) -- 0:05:22
289500 -- (-2275.723) (-2271.539) (-2270.863) [-2266.555] * (-2271.809) [-2269.930] (-2273.528) (-2263.220) -- 0:05:21
290000 -- [-2266.686] (-2274.785) (-2265.612) (-2263.640) * [-2264.252] (-2265.511) (-2271.880) (-2276.116) -- 0:05:20
Average standard deviation of split frequencies: 0.013785
290500 -- (-2268.450) (-2262.364) (-2267.698) [-2257.282] * (-2265.914) (-2272.600) (-2268.040) [-2270.048] -- 0:05:19
291000 -- [-2263.950] (-2271.048) (-2263.158) (-2270.835) * (-2269.822) [-2263.847] (-2268.668) (-2270.503) -- 0:05:21
291500 -- (-2267.946) (-2265.913) (-2276.422) [-2270.120] * (-2270.698) (-2273.567) (-2271.968) [-2270.339] -- 0:05:20
292000 -- (-2265.728) (-2283.792) (-2270.866) [-2269.117] * (-2264.919) (-2271.496) [-2265.797] (-2267.886) -- 0:05:20
292500 -- [-2267.762] (-2267.099) (-2272.642) (-2268.578) * (-2268.992) (-2273.313) [-2263.264] (-2268.370) -- 0:05:19
293000 -- (-2259.360) (-2269.252) (-2267.384) [-2266.530] * (-2270.541) [-2263.378] (-2270.297) (-2266.765) -- 0:05:20
293500 -- [-2264.425] (-2261.616) (-2272.410) (-2274.390) * (-2267.336) (-2271.636) (-2269.279) [-2260.808] -- 0:05:20
294000 -- (-2260.360) [-2268.496] (-2261.497) (-2273.491) * [-2265.851] (-2267.354) (-2280.864) (-2269.385) -- 0:05:19
294500 -- (-2266.123) (-2273.910) [-2258.436] (-2266.352) * (-2275.593) [-2267.841] (-2276.302) (-2271.821) -- 0:05:18
295000 -- (-2277.056) (-2270.425) (-2263.192) [-2265.976] * (-2271.063) (-2271.368) (-2277.334) [-2270.963] -- 0:05:20
Average standard deviation of split frequencies: 0.014864
295500 -- (-2271.625) (-2279.109) (-2275.077) [-2264.582] * (-2272.013) (-2269.335) [-2263.102] (-2269.546) -- 0:05:19
296000 -- (-2262.359) [-2267.502] (-2269.473) (-2265.352) * (-2262.974) [-2265.129] (-2266.423) (-2268.815) -- 0:05:18
296500 -- (-2269.954) (-2268.188) [-2269.181] (-2263.198) * [-2265.853] (-2268.517) (-2270.081) (-2266.356) -- 0:05:17
297000 -- [-2267.304] (-2272.574) (-2269.470) (-2266.192) * [-2260.337] (-2268.538) (-2264.704) (-2262.927) -- 0:05:17
297500 -- (-2266.396) (-2267.387) (-2272.712) [-2265.434] * (-2265.367) [-2267.189] (-2266.743) (-2269.309) -- 0:05:18
298000 -- (-2265.764) [-2266.090] (-2271.860) (-2272.164) * (-2267.365) [-2268.091] (-2265.947) (-2279.333) -- 0:05:18
298500 -- (-2271.233) (-2271.100) (-2267.859) [-2262.173] * (-2263.580) [-2261.896] (-2264.543) (-2267.579) -- 0:05:17
299000 -- (-2278.528) (-2266.109) [-2275.434] (-2269.919) * [-2261.416] (-2266.609) (-2267.234) (-2276.845) -- 0:05:16
299500 -- (-2266.483) [-2263.735] (-2272.037) (-2278.533) * (-2267.893) [-2266.267] (-2267.565) (-2274.463) -- 0:05:18
300000 -- [-2273.127] (-2269.107) (-2279.683) (-2268.751) * (-2269.480) (-2263.658) [-2269.459] (-2274.019) -- 0:05:17
Average standard deviation of split frequencies: 0.015251
300500 -- (-2269.457) [-2263.269] (-2269.395) (-2270.715) * (-2273.637) (-2259.238) [-2269.267] (-2271.660) -- 0:05:16
301000 -- (-2268.251) [-2263.343] (-2262.734) (-2267.110) * (-2274.088) (-2266.282) (-2264.981) [-2274.036] -- 0:05:15
301500 -- [-2264.761] (-2266.397) (-2266.983) (-2272.500) * (-2264.753) [-2267.767] (-2275.307) (-2266.234) -- 0:05:15
302000 -- (-2264.959) [-2270.126] (-2262.574) (-2264.144) * (-2265.027) (-2273.393) (-2265.839) [-2260.043] -- 0:05:16
302500 -- [-2265.774] (-2269.815) (-2261.158) (-2265.230) * [-2266.494] (-2265.111) (-2266.250) (-2265.776) -- 0:05:15
303000 -- (-2265.426) (-2260.544) (-2274.427) [-2262.013] * (-2264.678) [-2265.016] (-2270.430) (-2259.879) -- 0:05:15
303500 -- (-2269.637) [-2263.623] (-2268.545) (-2267.689) * (-2260.359) [-2268.907] (-2265.581) (-2265.546) -- 0:05:14
304000 -- (-2266.817) (-2263.802) (-2268.979) [-2263.424] * (-2271.781) [-2276.794] (-2269.012) (-2264.404) -- 0:05:15
304500 -- [-2269.038] (-2262.487) (-2264.451) (-2274.128) * (-2266.706) (-2266.700) [-2271.574] (-2267.762) -- 0:05:15
305000 -- (-2262.655) (-2264.123) (-2283.784) [-2264.905] * (-2273.134) (-2265.032) [-2266.777] (-2268.969) -- 0:05:14
Average standard deviation of split frequencies: 0.015405
305500 -- (-2272.005) (-2272.751) [-2272.029] (-2269.055) * (-2272.148) [-2270.650] (-2280.714) (-2275.847) -- 0:05:13
306000 -- (-2271.019) [-2272.290] (-2270.063) (-2278.134) * (-2273.968) (-2268.208) [-2262.313] (-2280.507) -- 0:05:15
306500 -- (-2265.492) (-2271.166) [-2270.170] (-2270.903) * (-2273.096) (-2269.502) [-2264.531] (-2268.264) -- 0:05:14
307000 -- (-2262.900) [-2265.497] (-2262.118) (-2276.249) * (-2271.003) (-2264.574) [-2262.277] (-2263.797) -- 0:05:13
307500 -- (-2264.115) (-2267.863) (-2269.501) [-2260.602] * [-2265.619] (-2264.450) (-2261.637) (-2273.118) -- 0:05:13
308000 -- (-2264.447) (-2262.031) (-2271.211) [-2265.835] * (-2267.688) [-2265.656] (-2267.191) (-2273.738) -- 0:05:12
308500 -- [-2264.864] (-2265.334) (-2268.762) (-2283.754) * (-2265.443) (-2260.876) (-2265.489) [-2267.713] -- 0:05:13
309000 -- [-2262.929] (-2270.333) (-2262.234) (-2268.174) * (-2271.917) (-2270.059) (-2259.959) [-2259.187] -- 0:05:13
309500 -- (-2267.022) (-2262.933) (-2266.021) [-2268.292] * (-2269.092) (-2266.698) [-2268.882] (-2262.998) -- 0:05:12
310000 -- [-2266.354] (-2271.394) (-2269.864) (-2274.148) * (-2270.622) [-2262.910] (-2266.395) (-2268.181) -- 0:05:11
Average standard deviation of split frequencies: 0.015726
310500 -- (-2264.306) (-2265.544) [-2280.740] (-2262.826) * (-2279.873) (-2268.357) [-2269.422] (-2264.183) -- 0:05:13
311000 -- (-2267.360) (-2267.084) (-2271.590) [-2269.527] * (-2266.737) (-2274.025) [-2267.877] (-2265.632) -- 0:05:12
311500 -- (-2276.761) (-2261.252) [-2265.825] (-2270.432) * (-2270.095) (-2271.111) [-2266.806] (-2265.885) -- 0:05:11
312000 -- (-2275.219) [-2267.582] (-2277.811) (-2271.418) * (-2261.876) (-2268.421) [-2273.023] (-2277.198) -- 0:05:10
312500 -- (-2268.781) [-2258.370] (-2268.393) (-2262.341) * (-2261.216) (-2267.508) (-2269.200) [-2263.060] -- 0:05:10
313000 -- (-2263.633) (-2267.761) (-2273.858) [-2265.771] * (-2271.522) (-2269.381) [-2271.672] (-2268.993) -- 0:05:11
313500 -- (-2270.446) [-2269.112] (-2280.352) (-2273.321) * [-2262.582] (-2278.198) (-2264.121) (-2265.748) -- 0:05:10
314000 -- (-2267.126) [-2261.857] (-2269.345) (-2271.452) * (-2265.416) [-2263.023] (-2271.706) (-2264.481) -- 0:05:10
314500 -- (-2271.155) [-2272.151] (-2273.141) (-2273.565) * [-2265.009] (-2274.852) (-2271.688) (-2260.875) -- 0:05:09
315000 -- (-2266.076) (-2267.913) (-2273.840) [-2269.101] * (-2266.486) (-2270.709) (-2264.718) [-2265.242] -- 0:05:10
Average standard deviation of split frequencies: 0.015460
315500 -- (-2260.408) (-2278.310) (-2270.508) [-2270.477] * (-2278.177) (-2260.273) [-2261.705] (-2270.139) -- 0:05:10
316000 -- [-2263.907] (-2272.897) (-2273.675) (-2269.692) * [-2265.466] (-2268.212) (-2260.427) (-2268.218) -- 0:05:09
316500 -- (-2266.920) (-2266.014) (-2266.222) [-2275.637] * (-2275.046) (-2267.906) [-2274.713] (-2270.461) -- 0:05:08
317000 -- (-2269.584) (-2268.830) [-2269.293] (-2274.839) * [-2259.158] (-2269.567) (-2260.970) (-2273.363) -- 0:05:10
317500 -- (-2274.987) (-2267.726) (-2270.711) [-2269.587] * [-2266.865] (-2266.926) (-2274.551) (-2268.895) -- 0:05:09
318000 -- (-2267.865) (-2268.069) [-2265.900] (-2272.790) * (-2269.631) [-2260.004] (-2284.073) (-2271.730) -- 0:05:08
318500 -- (-2264.427) [-2260.306] (-2267.181) (-2269.038) * [-2267.346] (-2268.099) (-2274.851) (-2268.470) -- 0:05:08
319000 -- (-2275.577) (-2268.432) [-2267.272] (-2264.599) * [-2275.693] (-2275.745) (-2269.599) (-2273.373) -- 0:05:07
319500 -- (-2279.329) (-2269.624) [-2276.987] (-2272.207) * (-2265.365) (-2277.683) (-2266.737) [-2266.771] -- 0:05:08
320000 -- (-2280.727) [-2266.413] (-2277.535) (-2285.073) * [-2265.974] (-2283.115) (-2272.919) (-2270.536) -- 0:05:08
Average standard deviation of split frequencies: 0.015636
320500 -- [-2273.522] (-2262.285) (-2267.385) (-2271.046) * (-2261.212) (-2272.252) (-2274.979) [-2269.444] -- 0:05:07
321000 -- (-2260.407) [-2270.437] (-2272.767) (-2264.132) * (-2272.960) [-2262.915] (-2269.501) (-2271.344) -- 0:05:06
321500 -- (-2274.305) (-2269.033) (-2280.215) [-2266.630] * (-2268.759) [-2276.848] (-2268.675) (-2275.528) -- 0:05:08
322000 -- (-2280.169) [-2264.124] (-2283.713) (-2261.258) * [-2275.049] (-2262.321) (-2277.556) (-2277.052) -- 0:05:07
322500 -- (-2269.028) (-2267.367) [-2263.893] (-2271.155) * (-2278.206) [-2264.033] (-2264.605) (-2266.699) -- 0:05:06
323000 -- (-2265.775) (-2264.018) [-2265.661] (-2261.730) * (-2269.069) [-2271.296] (-2276.724) (-2261.280) -- 0:05:06
323500 -- (-2264.161) (-2278.340) [-2260.442] (-2270.737) * (-2268.737) [-2269.162] (-2267.284) (-2260.560) -- 0:05:05
324000 -- (-2268.662) [-2278.110] (-2267.708) (-2279.290) * (-2272.040) (-2265.507) (-2263.147) [-2260.755] -- 0:05:06
324500 -- (-2271.223) (-2271.904) [-2264.604] (-2270.366) * [-2263.137] (-2270.244) (-2270.593) (-2266.811) -- 0:05:06
325000 -- (-2284.044) (-2272.821) [-2260.420] (-2278.069) * (-2271.900) [-2267.224] (-2268.640) (-2269.945) -- 0:05:05
Average standard deviation of split frequencies: 0.014701
325500 -- (-2262.626) [-2262.401] (-2266.189) (-2271.184) * [-2261.582] (-2271.852) (-2273.870) (-2263.516) -- 0:05:04
326000 -- (-2272.699) [-2263.684] (-2271.504) (-2269.256) * (-2263.266) (-2266.464) (-2265.233) [-2266.676] -- 0:05:05
326500 -- [-2262.455] (-2277.065) (-2271.095) (-2262.871) * (-2268.864) [-2268.678] (-2265.966) (-2267.208) -- 0:05:05
327000 -- (-2269.250) [-2276.360] (-2262.547) (-2269.310) * (-2278.865) [-2270.630] (-2267.607) (-2269.537) -- 0:05:04
327500 -- (-2264.753) (-2272.097) [-2260.051] (-2265.619) * (-2263.340) (-2261.727) [-2268.284] (-2269.664) -- 0:05:03
328000 -- (-2269.139) [-2268.960] (-2273.151) (-2273.178) * (-2266.856) (-2266.446) [-2264.474] (-2280.782) -- 0:05:03
328500 -- (-2266.533) (-2263.685) [-2266.002] (-2266.654) * (-2267.241) [-2263.091] (-2278.256) (-2273.366) -- 0:05:04
329000 -- [-2262.368] (-2269.850) (-2271.444) (-2268.254) * (-2271.721) (-2268.470) [-2269.630] (-2268.927) -- 0:05:03
329500 -- [-2266.575] (-2269.617) (-2269.076) (-2268.984) * (-2276.750) [-2269.798] (-2260.454) (-2277.443) -- 0:05:03
330000 -- [-2259.257] (-2265.623) (-2267.768) (-2265.066) * [-2267.742] (-2265.057) (-2266.868) (-2272.841) -- 0:05:02
Average standard deviation of split frequencies: 0.013068
330500 -- [-2267.866] (-2265.614) (-2269.805) (-2266.186) * (-2269.152) (-2266.541) (-2263.179) [-2264.109] -- 0:05:03
331000 -- (-2278.125) (-2271.303) (-2267.421) [-2262.623] * (-2271.654) (-2276.581) (-2265.563) [-2267.957] -- 0:05:03
331500 -- (-2278.519) (-2265.444) [-2257.080] (-2272.892) * (-2275.647) (-2271.565) [-2261.546] (-2271.525) -- 0:05:02
332000 -- (-2271.280) (-2270.335) [-2265.762] (-2287.272) * (-2268.659) (-2278.257) [-2266.885] (-2264.800) -- 0:05:01
332500 -- (-2276.598) (-2275.662) (-2270.386) [-2270.223] * [-2268.179] (-2265.771) (-2276.025) (-2267.458) -- 0:05:03
333000 -- (-2286.033) (-2267.721) [-2269.643] (-2265.068) * (-2268.948) [-2264.488] (-2271.351) (-2264.880) -- 0:05:02
333500 -- [-2267.118] (-2266.350) (-2274.134) (-2261.501) * [-2269.544] (-2275.406) (-2277.791) (-2264.949) -- 0:05:01
334000 -- (-2269.176) (-2268.602) (-2266.265) [-2269.601] * (-2266.155) (-2273.083) (-2266.805) [-2268.815] -- 0:05:01
334500 -- (-2271.786) (-2276.135) [-2259.301] (-2264.978) * (-2267.658) [-2263.251] (-2265.431) (-2268.178) -- 0:05:00
335000 -- (-2268.462) (-2261.138) (-2272.059) [-2264.422] * (-2275.773) (-2264.963) [-2263.031] (-2269.257) -- 0:05:01
Average standard deviation of split frequencies: 0.013265
335500 -- [-2264.158] (-2265.622) (-2265.164) (-2274.507) * (-2268.095) [-2257.938] (-2274.244) (-2269.406) -- 0:05:01
336000 -- (-2275.917) [-2265.496] (-2269.434) (-2272.760) * (-2272.334) [-2263.681] (-2269.415) (-2271.792) -- 0:05:00
336500 -- (-2264.848) [-2268.268] (-2278.797) (-2270.406) * (-2270.997) [-2263.792] (-2272.608) (-2265.897) -- 0:04:59
337000 -- (-2267.091) (-2273.056) [-2282.874] (-2274.703) * (-2282.246) (-2268.480) (-2272.283) [-2268.897] -- 0:05:01
337500 -- (-2268.655) (-2270.686) (-2273.993) [-2269.700] * [-2271.554] (-2268.509) (-2267.292) (-2269.727) -- 0:05:00
338000 -- (-2259.214) (-2272.987) (-2267.626) [-2266.005] * (-2274.464) (-2271.123) [-2268.127] (-2267.040) -- 0:04:59
338500 -- (-2265.038) (-2271.528) [-2266.109] (-2268.574) * (-2268.302) (-2266.764) (-2276.482) [-2262.179] -- 0:04:58
339000 -- (-2264.087) [-2270.844] (-2274.378) (-2274.320) * (-2264.358) (-2268.124) (-2273.600) [-2266.376] -- 0:04:58
339500 -- (-2269.489) [-2268.312] (-2275.698) (-2285.693) * (-2271.485) [-2261.390] (-2265.342) (-2267.027) -- 0:04:59
340000 -- [-2269.257] (-2267.058) (-2271.067) (-2275.170) * (-2267.763) [-2264.608] (-2268.731) (-2264.280) -- 0:04:58
Average standard deviation of split frequencies: 0.013838
340500 -- [-2264.480] (-2265.597) (-2266.980) (-2265.820) * (-2274.509) (-2272.678) (-2263.048) [-2262.754] -- 0:04:58
341000 -- (-2270.536) (-2276.370) [-2276.055] (-2272.513) * (-2269.144) [-2271.955] (-2268.683) (-2264.048) -- 0:04:57
341500 -- (-2266.181) (-2279.215) [-2265.890] (-2271.605) * (-2276.622) (-2266.966) [-2267.565] (-2265.100) -- 0:04:58
342000 -- [-2264.234] (-2273.418) (-2264.573) (-2270.049) * (-2275.003) (-2269.694) [-2264.788] (-2265.471) -- 0:04:58
342500 -- [-2261.417] (-2268.083) (-2263.321) (-2265.972) * (-2265.581) (-2271.024) [-2264.879] (-2266.798) -- 0:04:57
343000 -- (-2259.532) [-2263.859] (-2267.193) (-2270.278) * (-2269.635) (-2264.159) [-2266.455] (-2273.213) -- 0:04:56
343500 -- (-2270.917) (-2268.311) [-2269.147] (-2267.691) * [-2260.488] (-2270.495) (-2266.092) (-2270.289) -- 0:04:58
344000 -- (-2268.804) (-2267.602) (-2265.467) [-2265.577] * [-2262.418] (-2271.465) (-2261.312) (-2271.886) -- 0:04:57
344500 -- [-2268.073] (-2269.673) (-2274.265) (-2275.234) * [-2262.552] (-2263.820) (-2258.615) (-2276.474) -- 0:04:56
345000 -- [-2267.857] (-2270.107) (-2265.140) (-2269.225) * (-2266.791) [-2265.068] (-2269.304) (-2281.859) -- 0:04:56
Average standard deviation of split frequencies: 0.012881
345500 -- (-2264.682) [-2262.801] (-2267.094) (-2265.242) * (-2268.697) (-2274.622) [-2262.598] (-2276.040) -- 0:04:55
346000 -- (-2268.775) (-2269.339) [-2265.740] (-2262.226) * (-2262.666) [-2267.140] (-2265.807) (-2270.410) -- 0:04:56
346500 -- (-2273.715) (-2279.230) (-2272.044) [-2258.406] * [-2263.877] (-2261.223) (-2264.814) (-2267.929) -- 0:04:56
347000 -- (-2263.001) (-2264.347) (-2269.639) [-2267.341] * [-2272.768] (-2267.099) (-2260.323) (-2275.352) -- 0:04:55
347500 -- (-2272.460) [-2266.960] (-2273.238) (-2264.344) * (-2263.793) (-2263.522) (-2273.291) [-2267.563] -- 0:04:54
348000 -- [-2273.289] (-2266.581) (-2282.880) (-2272.179) * (-2264.286) [-2266.911] (-2271.204) (-2269.113) -- 0:04:56
348500 -- [-2272.214] (-2259.359) (-2270.986) (-2273.769) * (-2265.446) (-2274.497) [-2266.508] (-2265.663) -- 0:04:55
349000 -- [-2262.406] (-2274.374) (-2266.332) (-2273.694) * (-2269.974) (-2267.423) (-2269.145) [-2272.238] -- 0:04:54
349500 -- (-2267.519) (-2275.245) [-2267.659] (-2270.981) * (-2267.789) [-2268.470] (-2272.284) (-2271.247) -- 0:04:54
350000 -- [-2268.188] (-2265.303) (-2262.867) (-2284.147) * (-2271.567) (-2267.884) [-2269.855] (-2264.377) -- 0:04:53
Average standard deviation of split frequencies: 0.015032
350500 -- (-2263.884) (-2266.887) [-2267.721] (-2272.322) * (-2264.309) [-2264.258] (-2265.143) (-2263.504) -- 0:04:54
351000 -- (-2263.775) [-2267.653] (-2279.473) (-2272.030) * [-2258.796] (-2278.514) (-2267.804) (-2266.501) -- 0:04:53
351500 -- (-2263.645) [-2267.290] (-2274.901) (-2267.850) * (-2262.249) (-2269.550) [-2268.665] (-2277.638) -- 0:04:53
352000 -- (-2275.843) (-2280.394) [-2271.222] (-2270.563) * (-2267.225) (-2262.540) [-2265.730] (-2266.955) -- 0:04:52
352500 -- [-2264.918] (-2263.848) (-2271.634) (-2271.215) * (-2273.001) (-2271.525) [-2268.934] (-2266.214) -- 0:04:53
353000 -- (-2273.157) (-2270.071) [-2265.128] (-2272.468) * (-2268.046) [-2271.729] (-2270.744) (-2267.674) -- 0:04:53
353500 -- (-2273.529) (-2275.051) [-2265.731] (-2264.754) * [-2261.044] (-2275.475) (-2264.502) (-2264.660) -- 0:04:52
354000 -- (-2274.780) (-2273.962) [-2263.067] (-2261.350) * [-2261.338] (-2262.347) (-2265.136) (-2272.915) -- 0:04:51
354500 -- (-2264.956) (-2269.228) (-2270.072) [-2267.831] * (-2271.592) (-2271.965) [-2269.290] (-2268.404) -- 0:04:51
355000 -- [-2264.249] (-2277.222) (-2265.619) (-2269.283) * (-2268.919) (-2271.758) [-2265.008] (-2263.371) -- 0:04:52
Average standard deviation of split frequencies: 0.013964
355500 -- (-2265.990) (-2267.133) [-2270.414] (-2275.359) * (-2263.629) (-2266.874) [-2269.791] (-2273.949) -- 0:04:51
356000 -- (-2271.409) (-2267.414) (-2269.080) [-2267.253] * (-2271.517) [-2264.832] (-2266.449) (-2279.247) -- 0:04:51
356500 -- (-2276.792) (-2272.305) [-2263.556] (-2278.202) * [-2266.970] (-2264.878) (-2278.875) (-2263.242) -- 0:04:50
357000 -- (-2278.580) (-2281.092) (-2265.623) [-2269.496] * [-2268.277] (-2277.428) (-2278.240) (-2274.348) -- 0:04:51
357500 -- [-2269.761] (-2261.343) (-2271.555) (-2275.309) * (-2269.485) (-2267.300) [-2267.874] (-2270.056) -- 0:04:51
358000 -- (-2269.771) (-2267.513) [-2274.120] (-2276.462) * [-2267.033] (-2272.984) (-2263.183) (-2270.950) -- 0:04:50
358500 -- (-2264.599) [-2273.413] (-2271.132) (-2273.069) * [-2263.316] (-2263.742) (-2276.819) (-2270.029) -- 0:04:49
359000 -- (-2270.297) [-2261.918] (-2268.497) (-2266.257) * (-2262.840) (-2271.785) [-2271.140] (-2277.798) -- 0:04:51
359500 -- (-2268.294) (-2265.770) (-2267.246) [-2260.066] * [-2264.565] (-2274.528) (-2272.554) (-2274.912) -- 0:04:50
360000 -- (-2260.419) (-2264.690) [-2266.351] (-2269.829) * (-2270.701) [-2263.715] (-2270.410) (-2266.945) -- 0:04:49
Average standard deviation of split frequencies: 0.012199
360500 -- (-2265.474) (-2263.910) [-2263.693] (-2271.203) * (-2263.092) [-2263.891] (-2277.173) (-2268.149) -- 0:04:49
361000 -- (-2260.018) [-2276.927] (-2270.364) (-2271.733) * (-2270.764) [-2269.436] (-2268.966) (-2263.028) -- 0:04:48
361500 -- (-2278.076) (-2275.567) [-2267.531] (-2272.476) * (-2275.534) (-2260.139) (-2266.795) [-2276.248] -- 0:04:49
362000 -- (-2269.086) (-2262.156) [-2265.783] (-2269.530) * (-2274.529) (-2270.488) [-2259.897] (-2280.862) -- 0:04:49
362500 -- (-2274.830) [-2265.874] (-2268.944) (-2263.141) * (-2280.483) [-2261.872] (-2277.662) (-2276.013) -- 0:04:48
363000 -- [-2264.011] (-2266.274) (-2284.362) (-2268.226) * (-2270.957) (-2271.652) [-2276.823] (-2277.390) -- 0:04:47
363500 -- [-2264.057] (-2269.912) (-2270.950) (-2261.290) * (-2273.301) (-2270.345) [-2264.699] (-2269.506) -- 0:04:48
364000 -- [-2267.007] (-2278.206) (-2265.492) (-2272.119) * (-2269.894) (-2263.287) [-2266.372] (-2270.448) -- 0:04:48
364500 -- [-2262.822] (-2272.710) (-2266.365) (-2271.250) * (-2264.251) [-2269.721] (-2278.158) (-2274.493) -- 0:04:47
365000 -- [-2266.520] (-2279.675) (-2264.118) (-2267.958) * [-2265.091] (-2268.531) (-2261.978) (-2272.394) -- 0:04:47
Average standard deviation of split frequencies: 0.013524
365500 -- (-2263.952) (-2272.100) [-2265.092] (-2266.350) * [-2271.077] (-2268.795) (-2265.037) (-2269.847) -- 0:04:48
366000 -- [-2264.337] (-2278.028) (-2269.630) (-2276.947) * (-2269.486) (-2269.693) [-2271.090] (-2268.104) -- 0:04:47
366500 -- (-2270.042) (-2277.413) (-2276.233) [-2270.710] * (-2265.728) (-2269.999) (-2275.388) [-2272.344] -- 0:04:46
367000 -- [-2266.263] (-2269.192) (-2273.892) (-2267.476) * (-2268.982) [-2265.742] (-2276.454) (-2281.897) -- 0:04:46
367500 -- [-2261.432] (-2275.634) (-2267.462) (-2272.329) * (-2267.273) (-2268.391) (-2279.519) [-2269.817] -- 0:04:45
368000 -- (-2268.586) (-2262.283) (-2267.548) [-2268.686] * (-2259.918) [-2265.417] (-2271.066) (-2268.791) -- 0:04:46
368500 -- (-2267.223) (-2269.078) (-2268.454) [-2268.599] * [-2265.707] (-2270.073) (-2278.877) (-2271.316) -- 0:04:46
369000 -- (-2281.181) (-2268.474) (-2259.648) [-2267.756] * [-2265.089] (-2267.533) (-2281.089) (-2268.023) -- 0:04:45
369500 -- (-2267.792) (-2275.004) (-2268.268) [-2266.716] * (-2271.937) (-2263.132) (-2279.609) [-2263.305] -- 0:04:44
370000 -- [-2262.899] (-2266.890) (-2271.665) (-2267.243) * (-2270.301) [-2268.891] (-2269.881) (-2277.777) -- 0:04:46
Average standard deviation of split frequencies: 0.014307
370500 -- [-2266.538] (-2264.059) (-2273.969) (-2271.420) * [-2267.286] (-2266.595) (-2268.914) (-2269.286) -- 0:04:45
371000 -- (-2276.336) (-2266.859) (-2269.106) [-2264.733] * [-2276.889] (-2266.885) (-2261.861) (-2270.411) -- 0:04:44
371500 -- (-2283.156) (-2269.123) [-2271.446] (-2265.391) * (-2269.214) [-2269.174] (-2268.932) (-2272.895) -- 0:04:44
372000 -- (-2269.995) (-2276.076) (-2269.581) [-2265.295] * (-2269.835) (-2265.804) (-2269.176) [-2263.500] -- 0:04:43
372500 -- (-2263.734) (-2271.720) (-2264.756) [-2265.155] * (-2280.521) [-2280.259] (-2263.826) (-2279.290) -- 0:04:44
373000 -- (-2265.578) (-2272.307) [-2274.903] (-2271.722) * [-2263.479] (-2272.942) (-2264.400) (-2278.835) -- 0:04:44
373500 -- (-2279.405) (-2263.372) [-2264.717] (-2269.537) * (-2270.363) (-2266.584) (-2259.590) [-2263.095] -- 0:04:43
374000 -- [-2270.886] (-2268.659) (-2271.246) (-2267.313) * (-2268.668) [-2265.597] (-2256.734) (-2267.938) -- 0:04:42
374500 -- (-2263.357) (-2275.274) (-2269.579) [-2276.161] * (-2267.322) [-2269.210] (-2266.999) (-2267.886) -- 0:04:43
375000 -- [-2264.807] (-2267.293) (-2269.729) (-2267.154) * (-2271.360) [-2264.266] (-2269.936) (-2266.609) -- 0:04:43
Average standard deviation of split frequencies: 0.011910
375500 -- [-2265.880] (-2276.437) (-2265.860) (-2266.999) * [-2262.471] (-2265.848) (-2260.106) (-2266.335) -- 0:04:42
376000 -- (-2268.139) [-2264.122] (-2272.762) (-2258.074) * (-2261.168) (-2280.927) (-2262.430) [-2265.345] -- 0:04:42
376500 -- (-2283.541) (-2273.277) [-2266.991] (-2264.106) * [-2262.337] (-2267.003) (-2265.786) (-2271.403) -- 0:04:41
377000 -- (-2279.410) (-2259.632) (-2270.579) [-2262.705] * [-2262.756] (-2267.402) (-2268.047) (-2269.112) -- 0:04:42
377500 -- (-2280.735) (-2267.908) (-2279.428) [-2274.133] * [-2260.465] (-2270.630) (-2269.497) (-2263.706) -- 0:04:41
378000 -- (-2286.416) (-2263.414) (-2271.978) [-2265.184] * [-2274.189] (-2270.736) (-2264.637) (-2266.690) -- 0:04:41
378500 -- (-2279.557) [-2265.224] (-2268.598) (-2263.151) * (-2270.592) [-2263.627] (-2266.630) (-2262.667) -- 0:04:40
379000 -- (-2269.965) (-2263.757) (-2267.778) [-2267.676] * (-2266.503) [-2273.050] (-2270.341) (-2270.824) -- 0:04:41
379500 -- (-2268.948) (-2276.355) (-2276.767) [-2263.532] * [-2261.806] (-2280.360) (-2275.657) (-2269.886) -- 0:04:41
380000 -- [-2272.698] (-2261.494) (-2266.985) (-2269.126) * (-2269.416) [-2264.609] (-2266.224) (-2271.073) -- 0:04:40
Average standard deviation of split frequencies: 0.011258
380500 -- (-2274.327) (-2261.914) (-2274.725) [-2264.234] * (-2273.285) (-2276.943) [-2269.487] (-2270.530) -- 0:04:40
381000 -- [-2266.156] (-2263.607) (-2276.331) (-2269.630) * (-2273.814) (-2264.787) [-2264.505] (-2271.287) -- 0:04:41
381500 -- [-2261.533] (-2271.406) (-2271.076) (-2269.144) * (-2269.806) [-2266.410] (-2263.916) (-2275.123) -- 0:04:40
382000 -- (-2271.320) [-2274.503] (-2271.642) (-2273.293) * (-2269.335) (-2272.454) (-2263.791) [-2270.343] -- 0:04:39
382500 -- (-2277.509) (-2266.110) [-2260.035] (-2282.693) * [-2271.422] (-2279.732) (-2271.170) (-2270.282) -- 0:04:39
383000 -- [-2263.900] (-2266.520) (-2264.554) (-2276.930) * [-2262.294] (-2270.623) (-2266.029) (-2266.790) -- 0:04:38
383500 -- (-2261.673) [-2265.949] (-2271.050) (-2274.541) * [-2262.032] (-2270.979) (-2266.093) (-2266.463) -- 0:04:39
384000 -- (-2275.002) [-2268.336] (-2277.729) (-2273.150) * (-2273.073) [-2270.709] (-2273.793) (-2262.423) -- 0:04:39
384500 -- (-2261.863) (-2267.255) (-2269.825) [-2267.004] * (-2273.786) [-2270.494] (-2268.693) (-2265.546) -- 0:04:38
385000 -- (-2259.882) [-2264.476] (-2265.054) (-2268.680) * (-2277.885) (-2274.567) (-2275.174) [-2264.674] -- 0:04:37
Average standard deviation of split frequencies: 0.008956
385500 -- [-2274.224] (-2277.391) (-2270.623) (-2267.874) * (-2275.205) [-2266.920] (-2273.815) (-2267.357) -- 0:04:38
386000 -- (-2267.219) [-2273.519] (-2266.662) (-2265.799) * (-2268.783) (-2267.775) (-2272.689) [-2265.706] -- 0:04:38
386500 -- (-2268.506) [-2263.945] (-2268.475) (-2271.249) * [-2267.770] (-2265.859) (-2263.396) (-2271.180) -- 0:04:37
387000 -- (-2266.202) [-2260.095] (-2263.303) (-2266.878) * (-2274.359) (-2271.201) (-2263.496) [-2265.639] -- 0:04:37
387500 -- (-2263.447) (-2260.401) (-2278.517) [-2264.494] * (-2259.332) (-2274.163) (-2276.096) [-2270.826] -- 0:04:36
388000 -- (-2258.591) (-2262.571) [-2260.520] (-2266.987) * [-2270.550] (-2265.852) (-2271.298) (-2274.763) -- 0:04:37
388500 -- (-2263.062) (-2272.499) (-2273.920) [-2261.940] * (-2266.673) (-2258.762) (-2277.820) [-2261.746] -- 0:04:37
389000 -- (-2272.211) (-2274.614) (-2265.845) [-2265.610] * (-2263.608) (-2260.570) [-2268.354] (-2264.495) -- 0:04:36
389500 -- (-2265.053) [-2264.971] (-2269.414) (-2268.926) * (-2271.450) [-2274.025] (-2271.374) (-2270.157) -- 0:04:35
390000 -- (-2263.170) [-2263.117] (-2270.676) (-2269.961) * (-2266.883) [-2266.010] (-2269.399) (-2273.819) -- 0:04:36
Average standard deviation of split frequencies: 0.009854
390500 -- (-2266.395) [-2267.461] (-2267.234) (-2269.919) * [-2268.781] (-2271.594) (-2271.373) (-2274.450) -- 0:04:36
391000 -- (-2260.723) (-2262.015) (-2263.822) [-2263.831] * (-2276.039) (-2267.247) [-2263.967] (-2263.144) -- 0:04:35
391500 -- (-2265.201) (-2271.518) (-2266.489) [-2267.746] * (-2276.761) (-2273.294) (-2266.272) [-2265.271] -- 0:04:35
392000 -- (-2265.031) (-2266.934) [-2267.236] (-2273.190) * (-2272.685) [-2263.545] (-2264.229) (-2262.352) -- 0:04:36
392500 -- [-2265.231] (-2264.014) (-2266.233) (-2266.602) * [-2277.824] (-2270.668) (-2268.762) (-2267.902) -- 0:04:35
393000 -- (-2271.934) [-2266.427] (-2272.004) (-2263.723) * (-2270.928) [-2263.304] (-2273.071) (-2275.903) -- 0:04:34
393500 -- (-2270.777) [-2268.779] (-2274.271) (-2268.017) * (-2273.570) [-2266.733] (-2269.226) (-2273.615) -- 0:04:34
394000 -- (-2269.886) (-2265.780) (-2271.140) [-2261.709] * [-2263.472] (-2264.433) (-2265.232) (-2272.419) -- 0:04:33
394500 -- (-2265.344) (-2260.809) [-2266.866] (-2262.267) * (-2267.507) (-2271.486) [-2267.384] (-2263.876) -- 0:04:34
395000 -- [-2262.702] (-2269.680) (-2267.832) (-2273.973) * (-2268.964) [-2266.920] (-2270.340) (-2270.953) -- 0:04:34
Average standard deviation of split frequencies: 0.009027
395500 -- [-2265.151] (-2268.929) (-2270.298) (-2266.984) * (-2267.273) (-2267.930) (-2265.545) [-2267.198] -- 0:04:33
396000 -- [-2261.812] (-2260.138) (-2269.059) (-2259.550) * (-2269.715) (-2265.733) [-2264.382] (-2263.898) -- 0:04:33
396500 -- [-2263.815] (-2269.980) (-2272.739) (-2276.778) * (-2271.750) [-2265.553] (-2276.163) (-2261.928) -- 0:04:33
397000 -- [-2265.627] (-2270.877) (-2268.557) (-2269.749) * [-2273.287] (-2270.414) (-2274.408) (-2265.273) -- 0:04:33
397500 -- (-2265.454) (-2279.556) [-2264.458] (-2269.687) * (-2273.450) [-2265.057] (-2276.614) (-2270.323) -- 0:04:32
398000 -- (-2266.134) (-2267.076) [-2266.918] (-2275.173) * (-2263.420) (-2264.786) [-2272.720] (-2266.592) -- 0:04:32
398500 -- (-2270.820) [-2267.752] (-2262.909) (-2269.539) * (-2271.561) [-2264.602] (-2276.330) (-2267.658) -- 0:04:31
399000 -- [-2263.817] (-2266.309) (-2276.611) (-2275.398) * [-2268.260] (-2273.077) (-2271.077) (-2265.496) -- 0:04:32
399500 -- (-2270.714) (-2280.119) (-2275.560) [-2275.361] * (-2266.865) (-2269.673) (-2268.523) [-2267.467] -- 0:04:32
400000 -- (-2273.139) (-2278.188) (-2275.933) [-2266.312] * (-2269.979) (-2273.395) [-2264.535] (-2267.805) -- 0:04:31
Average standard deviation of split frequencies: 0.008236
400500 -- (-2279.365) (-2261.684) [-2269.525] (-2266.157) * (-2267.053) (-2273.953) (-2269.747) [-2269.504] -- 0:04:30
401000 -- (-2268.732) [-2265.899] (-2280.485) (-2261.560) * [-2265.366] (-2268.552) (-2281.960) (-2265.877) -- 0:04:31
401500 -- (-2266.504) [-2271.703] (-2265.058) (-2269.808) * (-2269.295) [-2262.625] (-2261.580) (-2272.241) -- 0:04:31
402000 -- (-2265.541) [-2262.833] (-2263.403) (-2277.964) * (-2268.832) (-2264.700) [-2265.076] (-2280.726) -- 0:04:30
402500 -- (-2265.789) [-2271.590] (-2268.959) (-2261.200) * (-2271.085) (-2270.867) [-2265.152] (-2278.816) -- 0:04:30
403000 -- (-2267.275) [-2267.125] (-2275.509) (-2275.476) * (-2274.714) (-2267.927) [-2271.344] (-2266.321) -- 0:04:31
403500 -- [-2262.105] (-2270.607) (-2263.180) (-2273.498) * (-2269.377) [-2259.839] (-2269.291) (-2269.200) -- 0:04:30
404000 -- (-2276.756) (-2271.783) [-2258.081] (-2283.857) * (-2265.746) [-2271.548] (-2264.172) (-2266.012) -- 0:04:29
404500 -- (-2267.529) (-2272.421) (-2262.414) [-2263.207] * (-2274.742) (-2266.749) (-2260.219) [-2264.736] -- 0:04:29
405000 -- (-2266.193) (-2271.548) [-2265.292] (-2270.118) * [-2267.354] (-2267.805) (-2268.482) (-2265.367) -- 0:04:28
Average standard deviation of split frequencies: 0.007644
405500 -- [-2256.142] (-2271.059) (-2264.413) (-2271.595) * (-2268.945) [-2265.001] (-2267.179) (-2279.155) -- 0:04:29
406000 -- [-2267.098] (-2270.790) (-2269.213) (-2274.231) * (-2275.647) (-2264.843) [-2266.152] (-2264.243) -- 0:04:29
406500 -- [-2273.799] (-2268.884) (-2269.869) (-2268.831) * (-2277.271) [-2263.289] (-2267.455) (-2262.748) -- 0:04:28
407000 -- (-2263.700) [-2265.077] (-2271.284) (-2268.705) * [-2260.365] (-2270.749) (-2263.989) (-2269.950) -- 0:04:28
407500 -- (-2268.154) [-2271.183] (-2268.708) (-2264.703) * [-2261.846] (-2266.241) (-2263.565) (-2277.755) -- 0:04:28
408000 -- (-2270.624) (-2260.921) (-2266.417) [-2267.991] * (-2264.759) (-2270.088) (-2266.124) [-2268.063] -- 0:04:28
408500 -- [-2268.306] (-2266.199) (-2268.417) (-2265.871) * (-2265.966) (-2274.004) [-2265.528] (-2270.552) -- 0:04:27
409000 -- (-2271.312) (-2272.401) (-2274.225) [-2265.564] * (-2270.810) [-2264.405] (-2261.611) (-2263.025) -- 0:04:27
409500 -- [-2273.208] (-2271.375) (-2267.135) (-2261.849) * (-2266.542) (-2264.600) (-2268.983) [-2261.630] -- 0:04:26
410000 -- (-2261.766) (-2264.283) [-2266.236] (-2264.882) * (-2270.157) (-2266.940) [-2257.827] (-2267.691) -- 0:04:27
Average standard deviation of split frequencies: 0.006792
410500 -- [-2271.078] (-2268.909) (-2263.084) (-2268.975) * (-2272.232) [-2267.918] (-2268.047) (-2266.176) -- 0:04:27
411000 -- [-2261.059] (-2262.172) (-2277.242) (-2270.932) * (-2270.681) (-2273.514) (-2267.377) [-2263.108] -- 0:04:26
411500 -- (-2264.209) [-2262.591] (-2275.993) (-2267.800) * [-2278.574] (-2272.038) (-2270.113) (-2263.697) -- 0:04:26
412000 -- [-2264.678] (-2267.375) (-2268.942) (-2271.237) * (-2273.371) [-2268.360] (-2271.483) (-2265.352) -- 0:04:26
412500 -- [-2268.917] (-2272.356) (-2267.725) (-2268.368) * [-2271.476] (-2267.712) (-2274.326) (-2270.829) -- 0:04:26
413000 -- (-2270.433) (-2265.388) [-2270.749] (-2278.637) * (-2276.926) (-2278.463) [-2269.118] (-2261.729) -- 0:04:25
413500 -- (-2270.787) (-2269.541) [-2262.846] (-2272.664) * (-2266.768) (-2268.358) (-2272.681) [-2267.664] -- 0:04:25
414000 -- (-2271.761) [-2267.166] (-2266.393) (-2267.349) * [-2265.112] (-2263.446) (-2273.683) (-2265.163) -- 0:04:24
414500 -- (-2275.247) (-2266.438) (-2269.590) [-2267.253] * [-2274.949] (-2267.873) (-2266.248) (-2269.147) -- 0:04:25
415000 -- [-2272.159] (-2266.543) (-2261.285) (-2272.333) * (-2268.088) (-2275.463) [-2269.121] (-2269.666) -- 0:04:25
Average standard deviation of split frequencies: 0.006705
415500 -- (-2274.112) (-2264.479) [-2281.835] (-2270.149) * (-2270.782) [-2264.142] (-2263.518) (-2275.415) -- 0:04:24
416000 -- [-2265.726] (-2261.334) (-2270.446) (-2265.117) * (-2271.107) [-2266.313] (-2270.076) (-2266.577) -- 0:04:23
416500 -- (-2283.050) [-2263.275] (-2263.362) (-2276.533) * [-2262.037] (-2268.287) (-2263.549) (-2265.041) -- 0:04:24
417000 -- (-2273.077) [-2263.056] (-2272.338) (-2267.796) * [-2268.634] (-2271.361) (-2261.665) (-2270.061) -- 0:04:24
417500 -- (-2266.330) [-2266.085] (-2265.659) (-2270.998) * (-2266.451) [-2261.893] (-2267.968) (-2274.312) -- 0:04:23
418000 -- (-2271.672) (-2264.656) [-2268.431] (-2264.665) * (-2264.886) (-2267.995) (-2276.083) [-2270.223] -- 0:04:23
418500 -- [-2265.856] (-2261.071) (-2267.573) (-2270.589) * (-2272.460) [-2266.084] (-2269.219) (-2277.658) -- 0:04:24
419000 -- (-2267.124) (-2266.410) (-2267.502) [-2262.707] * (-2267.020) (-2258.959) (-2285.059) [-2263.829] -- 0:04:23
419500 -- (-2267.009) [-2263.962] (-2263.380) (-2273.237) * (-2285.698) [-2267.418] (-2284.522) (-2275.579) -- 0:04:22
420000 -- (-2268.823) [-2268.487] (-2264.299) (-2267.936) * [-2268.419] (-2269.228) (-2273.117) (-2267.379) -- 0:04:22
Average standard deviation of split frequencies: 0.007029
420500 -- (-2266.871) (-2263.836) (-2274.375) [-2268.846] * (-2265.598) [-2267.284] (-2265.417) (-2268.374) -- 0:04:21
421000 -- (-2265.179) (-2274.741) [-2270.117] (-2272.777) * (-2277.247) (-2264.034) (-2267.536) [-2262.908] -- 0:04:22
421500 -- [-2263.539] (-2272.731) (-2266.593) (-2267.113) * (-2268.003) (-2265.743) [-2271.839] (-2272.347) -- 0:04:22
422000 -- (-2266.947) (-2271.788) (-2267.865) [-2264.519] * [-2267.658] (-2273.109) (-2262.754) (-2265.385) -- 0:04:21
422500 -- (-2268.095) (-2281.892) [-2264.643] (-2273.453) * [-2270.404] (-2282.863) (-2260.073) (-2270.215) -- 0:04:21
423000 -- (-2271.999) [-2271.234] (-2267.532) (-2261.685) * [-2268.548] (-2275.396) (-2275.335) (-2277.319) -- 0:04:21
423500 -- (-2272.838) (-2267.963) (-2278.520) [-2262.480] * (-2272.484) (-2271.600) [-2270.910] (-2262.005) -- 0:04:21
424000 -- (-2264.138) (-2275.316) [-2267.743] (-2261.833) * (-2271.985) (-2273.614) [-2265.493] (-2268.908) -- 0:04:20
424500 -- (-2267.348) (-2271.873) (-2264.546) [-2267.165] * [-2270.478] (-2274.782) (-2271.099) (-2268.595) -- 0:04:20
425000 -- (-2262.956) (-2277.436) (-2269.937) [-2271.995] * (-2272.145) (-2270.477) [-2267.952] (-2270.023) -- 0:04:19
Average standard deviation of split frequencies: 0.007444
425500 -- (-2277.957) (-2266.047) [-2267.497] (-2270.282) * (-2266.908) [-2263.333] (-2268.434) (-2276.053) -- 0:04:20
426000 -- [-2265.620] (-2280.115) (-2264.528) (-2275.809) * (-2271.019) [-2274.172] (-2272.848) (-2270.360) -- 0:04:20
426500 -- (-2276.220) [-2267.984] (-2270.964) (-2272.823) * (-2277.960) [-2265.408] (-2262.938) (-2272.498) -- 0:04:19
427000 -- (-2274.748) (-2262.392) [-2264.780] (-2270.028) * (-2272.844) (-2256.536) (-2263.737) [-2267.340] -- 0:04:18
427500 -- (-2269.633) (-2276.239) (-2270.254) [-2266.494] * (-2268.253) (-2267.521) [-2268.295] (-2265.402) -- 0:04:19
428000 -- (-2270.934) (-2268.004) (-2269.097) [-2273.004] * (-2266.435) (-2262.696) (-2273.559) [-2261.874] -- 0:04:19
428500 -- (-2269.136) [-2264.177] (-2271.479) (-2266.246) * (-2273.907) (-2269.487) [-2272.522] (-2270.654) -- 0:04:18
429000 -- (-2266.520) (-2266.054) [-2272.727] (-2270.920) * [-2273.230] (-2268.413) (-2267.762) (-2268.783) -- 0:04:18
429500 -- (-2272.212) [-2266.557] (-2267.788) (-2274.637) * (-2266.235) (-2271.494) (-2271.106) [-2265.871] -- 0:04:17
430000 -- (-2271.533) (-2269.123) [-2263.430] (-2264.625) * [-2273.295] (-2282.794) (-2273.129) (-2266.964) -- 0:04:18
Average standard deviation of split frequencies: 0.009486
430500 -- (-2265.823) (-2273.055) (-2270.416) [-2265.881] * [-2267.690] (-2268.734) (-2272.579) (-2264.884) -- 0:04:17
431000 -- (-2264.861) (-2271.004) (-2262.396) [-2265.943] * [-2264.122] (-2265.475) (-2280.061) (-2270.471) -- 0:04:17
431500 -- (-2276.555) (-2265.101) [-2269.871] (-2270.667) * (-2268.350) (-2273.607) (-2267.467) [-2269.904] -- 0:04:16
432000 -- (-2262.152) [-2262.474] (-2272.499) (-2272.905) * (-2269.657) (-2269.902) [-2265.321] (-2270.503) -- 0:04:17
432500 -- [-2267.862] (-2266.785) (-2272.524) (-2276.053) * (-2269.970) [-2268.110] (-2270.521) (-2274.476) -- 0:04:17
433000 -- (-2266.167) [-2256.387] (-2269.563) (-2266.440) * (-2264.732) [-2264.519] (-2273.833) (-2268.407) -- 0:04:16
433500 -- (-2268.321) [-2262.438] (-2277.681) (-2270.186) * (-2268.572) [-2267.150] (-2274.717) (-2267.960) -- 0:04:16
434000 -- (-2284.646) (-2263.538) (-2273.390) [-2262.265] * (-2266.162) (-2265.756) [-2264.553] (-2277.235) -- 0:04:15
434500 -- (-2275.701) (-2276.403) [-2267.418] (-2281.342) * (-2265.048) (-2266.073) (-2276.117) [-2265.808] -- 0:04:16
435000 -- [-2274.392] (-2267.287) (-2265.705) (-2266.598) * (-2280.439) [-2263.189] (-2263.240) (-2277.098) -- 0:04:15
Average standard deviation of split frequencies: 0.009641
435500 -- (-2269.105) (-2266.668) [-2266.686] (-2277.679) * (-2261.741) (-2262.003) [-2269.348] (-2265.306) -- 0:04:15
436000 -- (-2269.390) [-2263.144] (-2267.749) (-2259.269) * [-2267.976] (-2269.379) (-2269.186) (-2266.389) -- 0:04:14
436500 -- (-2265.777) (-2269.120) [-2265.148] (-2260.482) * (-2265.194) (-2265.118) (-2280.235) [-2270.630] -- 0:04:15
437000 -- (-2265.081) (-2274.416) (-2271.325) [-2263.814] * (-2270.426) [-2271.283] (-2263.016) (-2272.014) -- 0:04:15
437500 -- (-2266.910) (-2266.220) [-2266.618] (-2265.993) * (-2277.319) (-2275.364) [-2268.713] (-2264.491) -- 0:04:14
438000 -- (-2266.561) [-2266.707] (-2270.204) (-2260.785) * (-2267.225) (-2281.156) (-2278.622) [-2271.188] -- 0:04:14
438500 -- (-2266.085) (-2265.596) (-2268.133) [-2266.782] * (-2267.989) [-2278.247] (-2279.692) (-2270.005) -- 0:04:14
439000 -- (-2263.488) (-2265.226) [-2267.844] (-2263.125) * (-2267.704) (-2272.756) [-2264.116] (-2267.959) -- 0:04:14
439500 -- [-2266.952] (-2262.437) (-2265.262) (-2266.402) * (-2266.614) (-2267.597) (-2268.393) [-2268.288] -- 0:04:13
440000 -- [-2261.768] (-2278.198) (-2272.106) (-2268.456) * (-2271.884) (-2274.107) [-2270.262] (-2273.965) -- 0:04:13
Average standard deviation of split frequencies: 0.008469
440500 -- [-2266.038] (-2280.079) (-2265.678) (-2272.459) * (-2271.060) [-2273.009] (-2264.782) (-2275.100) -- 0:04:12
441000 -- (-2269.659) (-2267.907) (-2273.221) [-2264.213] * (-2274.470) [-2263.187] (-2269.764) (-2271.182) -- 0:04:13
441500 -- (-2286.672) (-2267.661) (-2272.750) [-2265.719] * (-2261.200) [-2266.119] (-2272.905) (-2273.397) -- 0:04:13
442000 -- (-2266.864) (-2267.586) [-2265.598] (-2277.770) * [-2259.029] (-2279.094) (-2271.372) (-2269.067) -- 0:04:12
442500 -- [-2270.557] (-2267.064) (-2265.577) (-2274.730) * [-2263.425] (-2278.094) (-2273.643) (-2265.571) -- 0:04:11
443000 -- (-2258.929) (-2271.120) [-2260.115] (-2274.135) * (-2268.820) (-2283.050) [-2264.259] (-2266.907) -- 0:04:12
443500 -- (-2266.395) [-2271.241] (-2273.760) (-2271.793) * (-2267.821) (-2276.080) (-2273.223) [-2266.409] -- 0:04:12
444000 -- (-2278.278) [-2263.355] (-2267.839) (-2271.348) * (-2261.409) (-2271.175) [-2261.312] (-2272.889) -- 0:04:11
444500 -- [-2261.998] (-2275.467) (-2259.699) (-2262.172) * [-2261.483] (-2263.479) (-2273.566) (-2263.649) -- 0:04:11
445000 -- [-2266.284] (-2274.753) (-2263.836) (-2276.108) * (-2262.494) [-2265.519] (-2271.502) (-2268.845) -- 0:04:10
Average standard deviation of split frequencies: 0.008368
445500 -- (-2277.482) (-2266.495) [-2259.066] (-2269.285) * [-2265.232] (-2266.055) (-2270.999) (-2275.521) -- 0:04:11
446000 -- (-2269.422) (-2267.345) [-2267.975] (-2268.352) * (-2273.828) (-2264.199) [-2262.751] (-2266.827) -- 0:04:10
446500 -- [-2267.214] (-2270.781) (-2264.195) (-2269.473) * (-2268.070) (-2280.539) (-2263.003) [-2272.202] -- 0:04:10
447000 -- (-2286.248) (-2271.366) [-2267.160] (-2263.639) * (-2275.649) [-2268.093] (-2266.527) (-2272.612) -- 0:04:09
447500 -- (-2278.904) (-2272.962) [-2271.363] (-2262.829) * (-2275.142) [-2265.246] (-2274.054) (-2268.675) -- 0:04:10
448000 -- (-2267.053) [-2261.252] (-2277.357) (-2269.807) * (-2275.998) [-2266.525] (-2271.170) (-2272.224) -- 0:04:10
448500 -- (-2269.569) [-2261.873] (-2283.988) (-2264.763) * (-2277.209) [-2261.278] (-2265.695) (-2270.033) -- 0:04:09
449000 -- (-2269.971) [-2268.032] (-2266.305) (-2268.479) * (-2266.282) [-2262.084] (-2267.291) (-2276.713) -- 0:04:09
449500 -- [-2265.324] (-2276.797) (-2277.878) (-2262.415) * (-2269.375) (-2265.912) (-2264.982) [-2261.012] -- 0:04:08
450000 -- (-2265.756) [-2269.055] (-2267.787) (-2265.606) * (-2264.760) (-2262.344) [-2263.517] (-2276.221) -- 0:04:09
Average standard deviation of split frequencies: 0.007671
450500 -- [-2264.091] (-2267.851) (-2264.699) (-2262.761) * (-2261.066) [-2266.477] (-2274.485) (-2271.198) -- 0:04:08
451000 -- (-2268.105) [-2264.464] (-2273.684) (-2265.291) * (-2270.989) (-2263.715) [-2272.485] (-2270.940) -- 0:04:08
451500 -- (-2267.762) (-2272.734) (-2267.962) [-2272.963] * [-2270.166] (-2269.163) (-2267.641) (-2267.312) -- 0:04:07
452000 -- (-2276.411) (-2268.280) [-2266.581] (-2274.798) * (-2272.314) [-2267.946] (-2267.278) (-2269.215) -- 0:04:08
452500 -- [-2269.371] (-2268.992) (-2270.875) (-2271.750) * (-2271.695) (-2270.896) [-2261.326] (-2273.770) -- 0:04:08
453000 -- (-2264.152) (-2265.760) (-2268.699) [-2265.514] * (-2260.969) (-2271.874) [-2263.127] (-2265.462) -- 0:04:07
453500 -- (-2265.357) (-2275.425) [-2271.725] (-2270.095) * (-2263.423) (-2264.212) [-2261.185] (-2270.646) -- 0:04:07
454000 -- (-2271.962) (-2276.689) (-2271.351) [-2264.580] * (-2273.456) [-2269.590] (-2266.721) (-2275.745) -- 0:04:07
454500 -- [-2264.666] (-2268.103) (-2265.118) (-2259.041) * (-2272.934) (-2271.564) [-2265.453] (-2278.719) -- 0:04:07
455000 -- (-2261.261) (-2271.766) [-2269.454] (-2266.576) * (-2271.827) [-2264.296] (-2264.157) (-2272.835) -- 0:04:06
Average standard deviation of split frequencies: 0.007409
455500 -- (-2272.229) [-2266.902] (-2267.704) (-2260.539) * (-2268.992) [-2268.880] (-2274.498) (-2261.399) -- 0:04:06
456000 -- [-2262.776] (-2268.883) (-2272.992) (-2268.019) * [-2263.373] (-2273.710) (-2270.961) (-2266.486) -- 0:04:05
456500 -- (-2280.544) (-2268.148) [-2263.622] (-2264.099) * [-2258.042] (-2273.260) (-2271.007) (-2270.142) -- 0:04:06
457000 -- (-2272.219) [-2262.029] (-2268.307) (-2268.584) * (-2264.560) (-2263.721) (-2265.956) [-2268.615] -- 0:04:05
457500 -- [-2264.045] (-2269.180) (-2269.949) (-2261.995) * (-2266.897) (-2269.687) [-2269.809] (-2271.122) -- 0:04:05
458000 -- (-2267.607) (-2272.440) [-2270.479] (-2269.478) * [-2263.637] (-2274.343) (-2272.337) (-2274.327) -- 0:04:04
458500 -- (-2271.340) [-2264.426] (-2264.176) (-2270.242) * (-2271.672) [-2273.335] (-2263.369) (-2266.282) -- 0:04:05
459000 -- (-2275.576) (-2266.482) [-2261.031] (-2266.363) * [-2261.461] (-2282.967) (-2271.442) (-2277.812) -- 0:04:05
459500 -- (-2265.629) [-2265.700] (-2268.304) (-2265.963) * [-2261.308] (-2262.477) (-2278.570) (-2271.076) -- 0:04:04
460000 -- [-2265.291] (-2266.190) (-2276.795) (-2271.397) * [-2264.416] (-2263.343) (-2269.080) (-2266.199) -- 0:04:04
Average standard deviation of split frequencies: 0.007931
460500 -- [-2267.289] (-2268.536) (-2273.919) (-2267.775) * [-2262.779] (-2271.504) (-2272.674) (-2267.379) -- 0:04:03
461000 -- (-2267.455) (-2279.224) [-2268.829] (-2269.543) * [-2276.881] (-2271.365) (-2279.990) (-2261.785) -- 0:04:04
461500 -- [-2267.815] (-2265.396) (-2272.975) (-2260.932) * (-2269.420) [-2272.001] (-2275.250) (-2266.190) -- 0:04:03
462000 -- [-2269.109] (-2265.589) (-2270.913) (-2264.657) * (-2270.606) (-2271.680) [-2261.611] (-2272.323) -- 0:04:03
462500 -- [-2262.088] (-2267.052) (-2273.521) (-2265.385) * (-2260.949) (-2274.797) [-2271.360] (-2275.814) -- 0:04:02
463000 -- [-2260.419] (-2267.430) (-2264.213) (-2265.781) * (-2267.876) (-2264.900) [-2267.454] (-2272.657) -- 0:04:03
463500 -- (-2266.333) (-2269.532) (-2265.287) [-2266.698] * (-2270.957) (-2269.989) [-2271.249] (-2272.995) -- 0:04:03
464000 -- (-2273.805) [-2267.087] (-2263.230) (-2261.439) * (-2274.396) [-2260.696] (-2271.294) (-2269.599) -- 0:04:02
464500 -- (-2265.906) (-2267.237) (-2268.143) [-2263.178] * (-2273.184) [-2266.332] (-2264.915) (-2274.899) -- 0:04:02
465000 -- (-2265.725) [-2262.959] (-2267.696) (-2265.837) * (-2269.750) (-2265.573) [-2276.193] (-2262.720) -- 0:04:02
Average standard deviation of split frequencies: 0.007840
465500 -- (-2269.572) [-2269.516] (-2262.784) (-2269.139) * (-2263.601) [-2262.574] (-2273.681) (-2282.743) -- 0:04:02
466000 -- (-2259.676) (-2269.722) (-2267.569) [-2268.038] * (-2274.597) [-2265.530] (-2268.016) (-2276.978) -- 0:04:01
466500 -- (-2276.530) (-2267.128) [-2262.225] (-2265.128) * (-2275.111) (-2270.690) (-2268.585) [-2267.550] -- 0:04:01
467000 -- (-2271.018) (-2270.121) [-2266.840] (-2263.516) * (-2273.569) (-2274.607) [-2264.702] (-2270.700) -- 0:04:00
467500 -- (-2278.623) (-2263.218) [-2266.360] (-2266.538) * (-2272.773) (-2267.105) [-2260.237] (-2270.677) -- 0:04:01
468000 -- (-2264.373) (-2278.541) (-2271.416) [-2264.276] * [-2259.772] (-2269.076) (-2265.896) (-2273.233) -- 0:04:00
468500 -- (-2271.699) (-2270.608) [-2265.468] (-2275.069) * [-2262.806] (-2266.959) (-2268.945) (-2264.391) -- 0:04:00
469000 -- [-2266.117] (-2279.708) (-2268.598) (-2270.515) * (-2267.734) (-2265.985) [-2261.565] (-2276.337) -- 0:04:00
469500 -- (-2264.333) [-2272.291] (-2275.516) (-2271.624) * (-2262.807) (-2265.908) [-2260.138] (-2271.741) -- 0:04:00
470000 -- (-2263.710) [-2260.561] (-2268.759) (-2268.913) * (-2267.283) (-2277.374) [-2273.895] (-2271.345) -- 0:04:00
Average standard deviation of split frequencies: 0.008263
470500 -- (-2259.923) (-2262.504) [-2270.224] (-2277.678) * [-2261.732] (-2269.733) (-2261.834) (-2264.188) -- 0:03:59
471000 -- (-2274.861) (-2267.750) [-2268.818] (-2276.432) * (-2265.631) (-2270.213) (-2268.719) [-2262.933] -- 0:03:59
471500 -- [-2261.882] (-2268.216) (-2269.931) (-2272.034) * [-2268.106] (-2267.184) (-2266.045) (-2269.329) -- 0:03:58
472000 -- (-2265.213) (-2277.450) [-2283.461] (-2272.991) * (-2272.197) (-2266.173) (-2265.053) [-2261.440] -- 0:03:59
472500 -- [-2268.654] (-2270.359) (-2275.557) (-2268.248) * (-2276.855) (-2271.137) [-2276.429] (-2262.308) -- 0:03:58
473000 -- (-2277.478) [-2261.889] (-2274.297) (-2270.731) * [-2267.298] (-2272.959) (-2261.218) (-2275.148) -- 0:03:58
473500 -- (-2265.743) (-2260.084) (-2271.815) [-2267.773] * (-2270.531) (-2273.673) [-2264.832] (-2266.203) -- 0:03:57
474000 -- (-2266.793) [-2258.642] (-2275.782) (-2275.429) * (-2264.488) (-2269.661) [-2266.080] (-2269.763) -- 0:03:58
474500 -- (-2268.954) (-2265.811) [-2267.336] (-2268.081) * [-2261.028] (-2271.461) (-2278.061) (-2276.246) -- 0:03:58
475000 -- (-2272.930) [-2267.175] (-2265.215) (-2270.387) * (-2267.199) [-2263.910] (-2268.285) (-2271.745) -- 0:03:57
Average standard deviation of split frequencies: 0.008005
475500 -- (-2267.561) (-2265.862) [-2263.540] (-2277.247) * (-2266.104) (-2279.885) [-2268.436] (-2272.783) -- 0:03:57
476000 -- (-2265.918) (-2276.967) [-2262.970] (-2273.087) * (-2273.486) [-2264.150] (-2259.724) (-2276.403) -- 0:03:56
476500 -- (-2274.191) [-2264.591] (-2270.301) (-2270.286) * (-2261.552) (-2273.071) (-2269.750) [-2266.132] -- 0:03:57
477000 -- [-2278.334] (-2281.710) (-2266.740) (-2267.480) * (-2261.687) (-2267.530) (-2270.993) [-2257.352] -- 0:03:56
477500 -- (-2268.539) (-2272.422) [-2267.544] (-2266.961) * [-2262.038] (-2266.102) (-2284.680) (-2272.638) -- 0:03:56
478000 -- [-2266.119] (-2275.831) (-2260.522) (-2274.761) * (-2262.604) (-2265.327) (-2272.670) [-2271.678] -- 0:03:55
478500 -- (-2275.730) [-2261.220] (-2269.692) (-2269.282) * (-2268.593) [-2269.708] (-2269.827) (-2267.597) -- 0:03:56
479000 -- (-2271.785) [-2265.572] (-2282.158) (-2271.839) * [-2266.925] (-2264.582) (-2275.272) (-2258.814) -- 0:03:56
479500 -- (-2269.590) (-2265.454) [-2271.368] (-2273.812) * (-2272.356) [-2270.833] (-2269.393) (-2263.544) -- 0:03:55
480000 -- (-2270.272) [-2261.350] (-2268.892) (-2278.147) * (-2280.344) (-2273.037) [-2263.805] (-2273.576) -- 0:03:55
Average standard deviation of split frequencies: 0.008581
480500 -- [-2269.133] (-2272.443) (-2274.705) (-2261.620) * (-2273.845) (-2280.484) (-2270.252) [-2262.131] -- 0:03:54
481000 -- [-2272.745] (-2264.107) (-2271.282) (-2269.528) * (-2271.710) (-2261.317) (-2270.119) [-2268.459] -- 0:03:55
481500 -- (-2266.305) [-2275.155] (-2267.959) (-2267.321) * (-2272.287) [-2266.247] (-2268.398) (-2276.206) -- 0:03:54
482000 -- (-2271.487) (-2273.406) [-2273.436] (-2271.426) * (-2270.107) (-2262.875) (-2269.468) [-2263.166] -- 0:03:54
482500 -- [-2267.044] (-2270.496) (-2260.823) (-2269.132) * (-2270.466) [-2263.396] (-2271.837) (-2269.554) -- 0:03:53
483000 -- (-2269.070) (-2268.561) (-2270.795) [-2263.926] * (-2269.568) [-2266.532] (-2266.961) (-2267.935) -- 0:03:54
483500 -- (-2279.569) [-2272.675] (-2270.746) (-2274.391) * (-2272.749) [-2270.747] (-2262.152) (-2264.219) -- 0:03:53
484000 -- (-2273.815) [-2262.647] (-2269.527) (-2265.204) * (-2279.388) (-2265.751) [-2260.317] (-2269.371) -- 0:03:53
484500 -- (-2276.648) (-2266.270) [-2264.585] (-2266.759) * (-2271.603) (-2266.153) [-2261.680] (-2275.851) -- 0:03:53
485000 -- (-2274.138) (-2266.258) [-2268.208] (-2278.404) * (-2272.255) [-2265.082] (-2275.930) (-2267.174) -- 0:03:53
Average standard deviation of split frequencies: 0.007679
485500 -- (-2284.898) [-2262.808] (-2271.974) (-2271.105) * (-2270.516) (-2271.584) [-2271.225] (-2262.465) -- 0:03:53
486000 -- (-2267.336) (-2269.075) (-2273.282) [-2277.071] * [-2277.226] (-2270.531) (-2270.126) (-2269.608) -- 0:03:52
486500 -- (-2280.639) (-2273.192) [-2265.214] (-2276.500) * (-2267.649) (-2267.450) (-2280.323) [-2265.821] -- 0:03:52
487000 -- [-2275.803] (-2275.995) (-2266.055) (-2277.532) * (-2267.461) [-2267.981] (-2276.516) (-2263.830) -- 0:03:51
487500 -- [-2266.242] (-2274.389) (-2271.682) (-2266.976) * (-2266.917) (-2271.110) (-2268.843) [-2270.502] -- 0:03:52
488000 -- (-2277.736) [-2267.791] (-2269.000) (-2265.318) * (-2274.409) [-2267.222] (-2264.957) (-2270.797) -- 0:03:51
488500 -- (-2263.160) [-2266.082] (-2264.415) (-2263.991) * (-2277.800) (-2278.843) [-2268.452] (-2268.721) -- 0:03:51
489000 -- (-2267.012) (-2265.135) (-2267.378) [-2263.258] * (-2260.679) [-2270.123] (-2268.940) (-2270.472) -- 0:03:50
489500 -- (-2275.795) (-2270.778) (-2265.326) [-2262.327] * (-2270.113) (-2267.210) [-2271.531] (-2275.115) -- 0:03:51
490000 -- (-2267.501) [-2266.592] (-2266.463) (-2264.170) * [-2260.096] (-2261.208) (-2283.180) (-2275.810) -- 0:03:51
Average standard deviation of split frequencies: 0.008647
490500 -- [-2269.185] (-2270.433) (-2278.112) (-2267.970) * (-2276.054) [-2267.139] (-2272.372) (-2265.998) -- 0:03:50
491000 -- [-2268.758] (-2265.008) (-2273.753) (-2271.275) * [-2267.650] (-2273.678) (-2275.941) (-2276.647) -- 0:03:50
491500 -- [-2264.352] (-2265.129) (-2279.033) (-2272.856) * (-2265.218) (-2274.993) (-2282.355) [-2264.159] -- 0:03:49
492000 -- (-2272.473) (-2272.838) [-2270.454] (-2265.178) * (-2271.335) [-2267.278] (-2266.980) (-2264.780) -- 0:03:50
492500 -- [-2264.213] (-2273.967) (-2273.511) (-2266.556) * [-2261.085] (-2277.262) (-2267.516) (-2265.348) -- 0:03:49
493000 -- (-2263.908) (-2285.693) (-2267.809) [-2266.598] * (-2268.326) [-2272.672] (-2275.391) (-2273.745) -- 0:03:49
493500 -- (-2265.575) (-2272.435) (-2262.978) [-2266.065] * (-2271.548) (-2271.052) (-2267.343) [-2262.769] -- 0:03:48
494000 -- (-2271.165) (-2272.143) (-2271.405) [-2265.385] * (-2266.759) [-2265.861] (-2274.862) (-2271.592) -- 0:03:49
494500 -- (-2276.129) (-2272.250) [-2275.368] (-2276.363) * [-2264.049] (-2275.747) (-2274.014) (-2269.452) -- 0:03:48
495000 -- (-2274.100) (-2271.027) (-2267.759) [-2274.873] * (-2271.306) [-2270.125] (-2274.121) (-2271.162) -- 0:03:48
Average standard deviation of split frequencies: 0.008316
495500 -- (-2265.575) [-2266.852] (-2264.839) (-2277.297) * [-2275.322] (-2263.276) (-2276.727) (-2274.699) -- 0:03:48
496000 -- (-2265.224) (-2271.923) (-2268.101) [-2271.740] * (-2269.861) [-2258.657] (-2268.035) (-2275.935) -- 0:03:48
496500 -- (-2269.833) (-2283.214) (-2267.395) [-2266.577] * (-2263.899) [-2264.025] (-2268.270) (-2275.547) -- 0:03:48
497000 -- (-2264.340) (-2270.272) (-2268.144) [-2266.126] * (-2272.100) (-2267.282) (-2278.102) [-2265.819] -- 0:03:47
497500 -- (-2281.423) (-2268.663) [-2264.133] (-2272.363) * (-2268.265) (-2268.800) (-2269.128) [-2266.393] -- 0:03:47
498000 -- (-2267.448) [-2267.525] (-2271.045) (-2268.350) * [-2271.362] (-2266.976) (-2262.400) (-2263.878) -- 0:03:46
498500 -- (-2284.412) (-2278.253) (-2282.889) [-2263.354] * [-2264.582] (-2270.461) (-2268.774) (-2271.536) -- 0:03:47
499000 -- (-2269.264) (-2270.650) [-2265.559] (-2268.192) * (-2267.957) [-2277.169] (-2263.132) (-2274.146) -- 0:03:46
499500 -- (-2271.518) (-2279.749) [-2267.465] (-2272.108) * (-2266.069) (-2272.690) [-2267.183] (-2266.938) -- 0:03:46
500000 -- [-2265.693] (-2272.889) (-2258.834) (-2262.675) * (-2262.163) (-2273.760) [-2261.833] (-2264.118) -- 0:03:46
Average standard deviation of split frequencies: 0.008816
500500 -- [-2265.250] (-2263.243) (-2274.778) (-2266.036) * (-2270.861) (-2274.453) [-2265.300] (-2268.315) -- 0:03:46
501000 -- (-2281.964) [-2263.261] (-2265.980) (-2272.768) * (-2275.419) (-2270.186) [-2266.311] (-2268.709) -- 0:03:46
501500 -- (-2266.459) [-2265.051] (-2269.570) (-2268.344) * (-2267.684) [-2267.615] (-2271.476) (-2269.304) -- 0:03:45
502000 -- (-2272.841) (-2271.326) (-2263.497) [-2273.435] * (-2265.114) (-2269.493) [-2268.400] (-2264.675) -- 0:03:45
502500 -- (-2270.439) (-2268.908) (-2270.174) [-2266.589] * (-2272.587) (-2270.900) [-2270.131] (-2283.402) -- 0:03:44
503000 -- (-2270.558) (-2270.988) [-2269.170] (-2269.902) * (-2264.684) (-2272.796) [-2265.713] (-2275.596) -- 0:03:45
503500 -- (-2270.131) (-2265.460) (-2266.171) [-2264.864] * (-2273.623) (-2265.475) (-2275.674) [-2265.160] -- 0:03:44
504000 -- (-2264.965) (-2269.799) [-2264.122] (-2269.117) * [-2261.249] (-2268.097) (-2277.561) (-2263.693) -- 0:03:44
504500 -- (-2269.981) (-2266.513) [-2264.316] (-2265.961) * (-2265.446) (-2263.963) (-2270.811) [-2275.225] -- 0:03:43
505000 -- [-2262.314] (-2267.133) (-2265.403) (-2270.607) * [-2259.637] (-2273.595) (-2267.847) (-2278.414) -- 0:03:44
Average standard deviation of split frequencies: 0.009316
505500 -- (-2262.302) (-2271.716) [-2261.881] (-2271.693) * [-2268.139] (-2278.015) (-2274.276) (-2264.554) -- 0:03:44
506000 -- (-2264.814) (-2274.618) (-2266.897) [-2267.559] * (-2264.126) [-2263.246] (-2277.020) (-2264.088) -- 0:03:43
506500 -- (-2272.174) (-2264.447) (-2269.679) [-2265.127] * (-2269.310) (-2261.878) [-2265.821] (-2260.763) -- 0:03:43
507000 -- (-2264.833) [-2261.365] (-2258.691) (-2267.522) * (-2263.524) [-2265.467] (-2265.441) (-2266.758) -- 0:03:43
507500 -- (-2262.886) (-2266.238) [-2268.469] (-2273.067) * (-2262.503) (-2267.258) (-2272.136) [-2261.350] -- 0:03:43
508000 -- (-2279.921) [-2266.839] (-2266.552) (-2261.213) * (-2274.437) (-2267.016) (-2273.903) [-2263.408] -- 0:03:42
508500 -- (-2266.714) (-2266.881) (-2260.100) [-2262.309] * (-2273.587) [-2261.321] (-2272.483) (-2267.459) -- 0:03:42
509000 -- (-2272.420) (-2266.702) (-2265.299) [-2274.936] * (-2266.502) (-2275.245) (-2267.882) [-2261.479] -- 0:03:41
509500 -- (-2261.288) (-2269.531) [-2266.077] (-2271.323) * (-2267.185) [-2263.979] (-2267.198) (-2265.056) -- 0:03:42
510000 -- [-2256.909] (-2269.484) (-2263.674) (-2273.647) * (-2264.499) (-2270.209) [-2266.661] (-2266.026) -- 0:03:41
Average standard deviation of split frequencies: 0.009000
510500 -- (-2265.289) (-2270.245) [-2266.335] (-2276.571) * (-2276.382) (-2272.545) [-2263.596] (-2273.629) -- 0:03:41
511000 -- (-2273.110) (-2263.894) (-2263.766) [-2268.912] * [-2266.626] (-2264.467) (-2266.926) (-2267.763) -- 0:03:41
511500 -- (-2269.825) (-2274.406) [-2265.611] (-2272.371) * (-2269.150) (-2263.864) (-2266.349) [-2263.944] -- 0:03:41
512000 -- [-2268.289] (-2273.307) (-2273.219) (-2269.856) * (-2262.437) (-2269.744) [-2266.317] (-2274.821) -- 0:03:41
512500 -- (-2265.484) (-2273.185) (-2273.734) [-2269.127] * (-2267.617) [-2263.533] (-2266.958) (-2274.711) -- 0:03:40
513000 -- (-2266.373) [-2266.151] (-2269.508) (-2275.149) * (-2279.547) (-2275.040) [-2266.745] (-2259.854) -- 0:03:40
513500 -- (-2275.790) (-2267.873) [-2257.637] (-2269.735) * [-2268.507] (-2267.540) (-2271.211) (-2262.603) -- 0:03:39
514000 -- (-2273.390) (-2270.482) [-2266.338] (-2267.077) * (-2263.687) [-2264.731] (-2272.339) (-2271.052) -- 0:03:40
514500 -- (-2279.121) (-2264.068) (-2276.520) [-2265.240] * [-2268.454] (-2260.129) (-2268.952) (-2266.659) -- 0:03:39
515000 -- (-2265.164) [-2266.561] (-2275.435) (-2264.234) * (-2270.754) (-2276.004) [-2266.833] (-2279.109) -- 0:03:39
Average standard deviation of split frequencies: 0.008907
515500 -- (-2262.974) [-2263.457] (-2269.863) (-2273.824) * (-2266.668) [-2272.227] (-2274.706) (-2261.567) -- 0:03:38
516000 -- (-2264.976) [-2267.359] (-2279.157) (-2265.195) * (-2271.810) (-2276.721) (-2267.531) [-2264.404] -- 0:03:39
516500 -- (-2265.618) (-2269.469) (-2270.616) [-2267.005] * (-2263.911) (-2270.542) [-2279.442] (-2266.480) -- 0:03:39
517000 -- [-2267.776] (-2277.012) (-2265.705) (-2274.053) * [-2270.058] (-2267.376) (-2270.158) (-2272.363) -- 0:03:38
517500 -- (-2265.816) (-2262.223) [-2266.465] (-2266.600) * [-2267.019] (-2261.419) (-2274.099) (-2275.424) -- 0:03:38
518000 -- (-2269.567) [-2270.424] (-2272.052) (-2263.141) * (-2273.682) [-2269.973] (-2270.169) (-2267.239) -- 0:03:37
518500 -- (-2267.075) (-2264.202) [-2264.474] (-2278.962) * (-2266.609) (-2268.619) [-2267.775] (-2265.837) -- 0:03:38
519000 -- [-2262.405] (-2262.390) (-2271.514) (-2272.702) * (-2273.706) (-2264.672) [-2262.404] (-2271.978) -- 0:03:37
519500 -- (-2276.866) (-2272.817) (-2265.852) [-2265.413] * (-2281.392) [-2269.970] (-2262.328) (-2263.815) -- 0:03:37
520000 -- [-2273.842] (-2263.900) (-2272.931) (-2268.198) * (-2276.403) (-2272.185) (-2266.962) [-2272.733] -- 0:03:36
Average standard deviation of split frequencies: 0.009280
520500 -- (-2268.623) (-2263.199) (-2271.848) [-2270.911] * [-2275.484] (-2267.099) (-2263.978) (-2266.857) -- 0:03:37
521000 -- (-2271.230) (-2266.667) [-2268.684] (-2273.159) * (-2274.436) [-2264.854] (-2265.763) (-2266.643) -- 0:03:36
521500 -- (-2264.014) (-2263.027) [-2262.381] (-2262.629) * (-2278.774) (-2274.061) (-2266.078) [-2261.628] -- 0:03:36
522000 -- (-2272.043) [-2260.118] (-2263.321) (-2264.282) * (-2272.821) (-2265.949) (-2265.780) [-2262.094] -- 0:03:36
522500 -- (-2269.225) (-2266.475) (-2266.150) [-2263.696] * (-2270.777) (-2265.197) (-2269.053) [-2268.580] -- 0:03:36
523000 -- (-2264.208) (-2268.770) [-2259.506] (-2270.912) * (-2268.158) (-2278.383) [-2263.198] (-2267.703) -- 0:03:36
523500 -- (-2263.074) [-2266.292] (-2266.292) (-2270.708) * (-2267.580) (-2264.749) (-2265.501) [-2263.878] -- 0:03:35
524000 -- [-2264.329] (-2260.061) (-2263.714) (-2271.859) * [-2262.916] (-2272.409) (-2275.593) (-2267.475) -- 0:03:35
524500 -- [-2266.689] (-2270.571) (-2266.845) (-2273.639) * (-2267.070) (-2269.714) [-2263.995] (-2266.276) -- 0:03:34
525000 -- [-2259.248] (-2270.809) (-2265.571) (-2271.609) * (-2267.907) (-2266.428) (-2274.153) [-2271.893] -- 0:03:35
Average standard deviation of split frequencies: 0.009560
525500 -- (-2267.808) (-2267.578) [-2267.963] (-2265.986) * (-2274.966) [-2263.751] (-2269.915) (-2267.164) -- 0:03:34
526000 -- (-2274.090) (-2268.767) (-2266.567) [-2261.600] * (-2273.374) [-2267.832] (-2268.476) (-2266.704) -- 0:03:34
526500 -- (-2278.431) [-2269.743] (-2270.813) (-2268.977) * (-2268.621) (-2265.670) [-2263.836] (-2265.410) -- 0:03:34
527000 -- (-2276.580) (-2265.049) [-2260.441] (-2268.067) * [-2271.256] (-2274.643) (-2268.406) (-2271.001) -- 0:03:34
527500 -- (-2270.199) (-2265.368) (-2275.245) [-2263.811] * [-2253.687] (-2266.792) (-2267.562) (-2267.455) -- 0:03:34
528000 -- (-2267.788) [-2267.668] (-2272.130) (-2266.085) * (-2270.862) [-2266.864] (-2263.781) (-2266.564) -- 0:03:33
528500 -- (-2269.866) [-2261.771] (-2273.154) (-2270.648) * (-2265.996) [-2266.796] (-2264.408) (-2264.539) -- 0:03:33
529000 -- (-2273.410) [-2264.320] (-2265.081) (-2268.001) * (-2265.962) (-2275.156) [-2274.105] (-2273.030) -- 0:03:33
529500 -- (-2260.363) (-2270.244) [-2265.646] (-2264.060) * [-2271.983] (-2270.093) (-2277.628) (-2266.225) -- 0:03:33
530000 -- (-2271.249) [-2267.075] (-2264.454) (-2265.297) * (-2270.967) [-2264.341] (-2267.424) (-2265.965) -- 0:03:32
Average standard deviation of split frequencies: 0.008513
530500 -- (-2265.332) (-2266.693) (-2272.294) [-2263.355] * (-2262.538) (-2261.998) (-2267.602) [-2256.959] -- 0:03:32
531000 -- [-2266.530] (-2271.288) (-2265.483) (-2267.353) * [-2264.163] (-2268.555) (-2270.055) (-2262.232) -- 0:03:31
531500 -- (-2265.637) (-2277.381) (-2272.860) [-2268.012] * [-2268.921] (-2270.720) (-2269.155) (-2262.881) -- 0:03:32
532000 -- (-2262.051) (-2268.907) [-2272.150] (-2260.812) * (-2270.121) (-2281.674) (-2269.181) [-2268.702] -- 0:03:32
532500 -- [-2267.261] (-2266.974) (-2269.021) (-2261.531) * (-2266.904) (-2274.379) [-2273.680] (-2276.831) -- 0:03:31
533000 -- (-2277.718) (-2268.915) [-2260.669] (-2266.352) * [-2268.673] (-2290.891) (-2270.533) (-2271.115) -- 0:03:31
533500 -- [-2265.192] (-2269.663) (-2261.549) (-2270.733) * (-2271.833) (-2269.770) [-2267.412] (-2286.975) -- 0:03:31
534000 -- (-2259.251) (-2270.875) [-2257.671] (-2267.100) * (-2275.500) (-2267.472) [-2276.946] (-2267.363) -- 0:03:31
534500 -- [-2262.900] (-2269.672) (-2275.051) (-2265.892) * (-2270.071) (-2266.861) (-2281.939) [-2265.436] -- 0:03:30
535000 -- (-2272.502) (-2264.324) [-2262.180] (-2266.334) * (-2274.582) [-2260.990] (-2270.652) (-2267.536) -- 0:03:30
Average standard deviation of split frequencies: 0.008062
535500 -- (-2263.801) (-2273.845) (-2267.557) [-2272.810] * (-2265.409) (-2263.472) [-2263.652] (-2263.204) -- 0:03:29
536000 -- (-2261.097) (-2263.448) [-2270.653] (-2265.800) * (-2270.757) [-2267.901] (-2260.477) (-2267.463) -- 0:03:30
536500 -- (-2270.020) (-2271.558) [-2263.416] (-2276.971) * (-2267.303) (-2268.881) [-2269.178] (-2273.150) -- 0:03:29
537000 -- (-2281.439) [-2267.498] (-2268.473) (-2268.135) * (-2273.583) (-2273.178) [-2264.301] (-2269.133) -- 0:03:29
537500 -- (-2267.684) (-2273.453) (-2266.741) [-2268.779] * (-2265.094) (-2267.164) (-2264.850) [-2267.520] -- 0:03:29
538000 -- (-2277.355) (-2259.963) [-2266.174] (-2270.661) * [-2269.876] (-2271.586) (-2270.371) (-2266.283) -- 0:03:29
538500 -- [-2263.048] (-2268.018) (-2275.551) (-2281.275) * (-2268.367) [-2266.787] (-2266.741) (-2273.820) -- 0:03:29
539000 -- (-2272.697) [-2266.180] (-2279.689) (-2266.712) * [-2265.862] (-2275.335) (-2266.203) (-2263.333) -- 0:03:28
539500 -- [-2265.653] (-2267.137) (-2278.662) (-2268.515) * (-2263.911) (-2274.310) [-2274.968] (-2269.254) -- 0:03:28
540000 -- (-2268.710) (-2268.421) (-2277.476) [-2274.355] * [-2272.277] (-2264.922) (-2277.575) (-2275.719) -- 0:03:27
Average standard deviation of split frequencies: 0.008356
540500 -- (-2271.541) (-2272.203) (-2269.909) [-2264.475] * (-2269.147) (-2265.244) [-2265.466] (-2267.364) -- 0:03:28
541000 -- (-2269.468) (-2275.159) (-2268.360) [-2266.382] * [-2263.887] (-2270.911) (-2270.993) (-2262.018) -- 0:03:27
541500 -- (-2261.492) (-2271.378) (-2266.845) [-2270.745] * (-2275.667) (-2273.331) [-2268.398] (-2266.840) -- 0:03:27
542000 -- [-2269.563] (-2270.260) (-2268.494) (-2268.411) * [-2264.892] (-2271.774) (-2264.031) (-2268.348) -- 0:03:27
542500 -- (-2277.066) [-2261.983] (-2272.880) (-2275.535) * [-2262.597] (-2272.533) (-2269.279) (-2273.068) -- 0:03:27
543000 -- (-2276.509) (-2276.249) [-2264.572] (-2266.833) * (-2264.376) [-2273.432] (-2263.592) (-2277.369) -- 0:03:27
543500 -- [-2273.640] (-2275.541) (-2270.885) (-2267.348) * (-2272.169) (-2273.026) [-2265.244] (-2284.942) -- 0:03:26
544000 -- (-2270.681) (-2281.708) (-2263.084) [-2262.254] * (-2267.407) (-2264.928) [-2268.159] (-2269.664) -- 0:03:26
544500 -- (-2263.931) [-2273.994] (-2277.860) (-2266.123) * [-2257.864] (-2260.056) (-2268.216) (-2268.150) -- 0:03:26
545000 -- [-2265.965] (-2271.889) (-2280.084) (-2269.375) * (-2267.878) [-2267.222] (-2267.120) (-2265.006) -- 0:03:26
Average standard deviation of split frequencies: 0.009209
545500 -- [-2264.532] (-2268.770) (-2277.108) (-2269.397) * (-2263.359) [-2264.383] (-2266.358) (-2267.798) -- 0:03:25
546000 -- (-2266.316) (-2265.097) [-2268.970] (-2272.553) * (-2271.080) (-2270.245) (-2268.223) [-2258.821] -- 0:03:25
546500 -- (-2263.859) (-2264.490) [-2263.692] (-2270.451) * [-2260.489] (-2268.935) (-2268.596) (-2265.706) -- 0:03:24
547000 -- (-2267.788) (-2272.895) [-2268.385] (-2273.469) * (-2276.735) (-2262.410) [-2268.202] (-2280.255) -- 0:03:25
547500 -- (-2275.332) (-2267.634) [-2267.709] (-2267.472) * (-2274.158) [-2263.777] (-2275.235) (-2268.565) -- 0:03:24
548000 -- (-2267.156) (-2264.915) (-2275.916) [-2262.515] * [-2270.974] (-2274.624) (-2271.144) (-2266.613) -- 0:03:24
548500 -- (-2269.359) (-2269.457) [-2263.815] (-2265.454) * (-2269.997) [-2272.872] (-2270.123) (-2263.788) -- 0:03:24
549000 -- (-2272.216) (-2270.760) [-2264.691] (-2266.257) * (-2265.800) [-2255.428] (-2268.340) (-2267.365) -- 0:03:24
549500 -- [-2262.705] (-2263.178) (-2275.440) (-2266.157) * [-2266.895] (-2268.781) (-2270.133) (-2261.767) -- 0:03:24
550000 -- (-2267.254) (-2265.288) [-2272.155] (-2273.075) * [-2265.139] (-2266.110) (-2272.899) (-2263.797) -- 0:03:23
Average standard deviation of split frequencies: 0.010273
550500 -- (-2275.023) (-2277.853) (-2270.232) [-2269.273] * (-2266.783) [-2269.360] (-2275.289) (-2265.807) -- 0:03:23
551000 -- [-2265.813] (-2273.974) (-2264.714) (-2274.144) * (-2268.623) [-2263.083] (-2268.293) (-2269.899) -- 0:03:22
551500 -- (-2259.355) (-2262.895) [-2266.989] (-2275.250) * [-2268.128] (-2264.923) (-2271.468) (-2267.120) -- 0:03:23
552000 -- (-2271.477) (-2266.703) [-2265.787] (-2268.573) * (-2274.446) [-2270.092] (-2277.308) (-2264.908) -- 0:03:22
552500 -- (-2264.674) (-2271.224) [-2260.722] (-2263.589) * (-2273.979) [-2264.402] (-2268.532) (-2268.345) -- 0:03:22
553000 -- [-2265.547] (-2267.140) (-2275.699) (-2271.067) * (-2281.511) (-2273.443) [-2264.538] (-2267.900) -- 0:03:22
553500 -- [-2271.684] (-2266.692) (-2267.001) (-2269.872) * (-2270.726) (-2280.808) [-2263.650] (-2263.667) -- 0:03:22
554000 -- (-2266.972) (-2271.612) [-2265.564] (-2273.369) * (-2271.768) [-2270.187] (-2274.518) (-2260.521) -- 0:03:22
554500 -- (-2283.951) (-2267.797) (-2269.473) [-2263.485] * (-2270.832) [-2265.105] (-2271.979) (-2267.769) -- 0:03:21
555000 -- (-2268.644) (-2267.755) [-2278.667] (-2269.858) * (-2278.571) (-2281.393) (-2265.750) [-2261.425] -- 0:03:21
Average standard deviation of split frequencies: 0.009892
555500 -- [-2260.176] (-2274.200) (-2277.145) (-2259.597) * (-2280.681) (-2271.316) [-2263.725] (-2263.539) -- 0:03:21
556000 -- (-2265.600) (-2273.187) (-2264.891) [-2262.264] * (-2273.807) [-2257.329] (-2261.974) (-2269.605) -- 0:03:21
556500 -- (-2277.434) [-2267.639] (-2262.041) (-2265.362) * (-2267.307) (-2265.417) [-2261.629] (-2263.610) -- 0:03:20
557000 -- (-2275.957) (-2262.929) (-2269.361) [-2265.047] * (-2265.613) [-2265.059] (-2271.258) (-2273.637) -- 0:03:20
557500 -- [-2264.169] (-2260.616) (-2269.185) (-2270.837) * (-2270.612) (-2267.011) (-2281.879) [-2272.032] -- 0:03:20
558000 -- (-2276.802) [-2262.018] (-2274.605) (-2262.325) * (-2275.795) (-2272.272) [-2270.766] (-2273.152) -- 0:03:20
558500 -- (-2274.558) (-2265.110) [-2266.641] (-2281.168) * (-2269.034) (-2268.177) [-2265.020] (-2269.897) -- 0:03:19
559000 -- (-2277.068) [-2272.448] (-2267.577) (-2267.857) * (-2268.594) (-2270.794) (-2268.027) [-2266.770] -- 0:03:19
559500 -- (-2282.741) (-2264.928) (-2266.716) [-2272.896] * [-2260.137] (-2269.970) (-2272.214) (-2262.896) -- 0:03:19
560000 -- (-2273.588) [-2263.457] (-2261.308) (-2269.671) * (-2267.462) (-2264.297) (-2273.951) [-2260.878] -- 0:03:19
Average standard deviation of split frequencies: 0.010230
560500 -- (-2276.605) (-2266.640) [-2267.136] (-2267.902) * (-2277.318) [-2265.108] (-2263.705) (-2268.863) -- 0:03:19
561000 -- (-2279.389) (-2272.370) [-2266.516] (-2274.858) * (-2263.285) (-2273.723) [-2270.273] (-2268.179) -- 0:03:18
561500 -- (-2277.045) [-2265.338] (-2270.985) (-2264.564) * (-2267.221) [-2264.790] (-2269.374) (-2270.184) -- 0:03:18
562000 -- (-2287.871) (-2262.517) [-2267.010] (-2260.882) * [-2260.783] (-2269.337) (-2269.824) (-2270.567) -- 0:03:18
562500 -- (-2274.493) (-2271.369) [-2271.329] (-2267.486) * (-2265.864) (-2267.312) [-2267.413] (-2264.033) -- 0:03:18
563000 -- (-2271.692) (-2276.080) (-2275.542) [-2265.088] * (-2270.858) (-2269.358) (-2268.269) [-2267.713] -- 0:03:17
563500 -- (-2278.402) (-2271.500) (-2273.968) [-2264.531] * (-2268.966) [-2264.604] (-2268.877) (-2268.248) -- 0:03:17
564000 -- [-2269.589] (-2278.768) (-2273.774) (-2265.081) * (-2264.253) (-2264.998) (-2271.374) [-2263.702] -- 0:03:17
564500 -- (-2281.487) [-2265.295] (-2273.335) (-2263.197) * (-2268.820) [-2261.428] (-2270.286) (-2263.287) -- 0:03:17
565000 -- (-2273.518) (-2267.744) (-2267.267) [-2264.512] * (-2263.989) (-2269.749) [-2265.637] (-2275.435) -- 0:03:17
Average standard deviation of split frequencies: 0.009786
565500 -- (-2278.227) (-2269.094) [-2268.484] (-2269.842) * (-2270.403) (-2271.765) [-2262.876] (-2270.425) -- 0:03:16
566000 -- (-2274.300) [-2264.850] (-2271.133) (-2270.711) * (-2267.913) [-2265.186] (-2270.496) (-2268.435) -- 0:03:17
566500 -- (-2271.646) (-2264.928) [-2265.133] (-2276.800) * (-2269.740) (-2260.698) (-2273.760) [-2277.184] -- 0:03:16
567000 -- (-2270.038) [-2258.463] (-2262.098) (-2260.616) * (-2270.174) (-2271.960) [-2271.599] (-2267.214) -- 0:03:16
567500 -- (-2261.912) (-2266.254) [-2263.844] (-2281.912) * (-2274.325) [-2260.727] (-2267.884) (-2267.551) -- 0:03:15
568000 -- [-2269.394] (-2273.916) (-2264.416) (-2268.574) * (-2263.285) [-2262.142] (-2263.912) (-2278.952) -- 0:03:15
568500 -- (-2269.429) [-2266.486] (-2268.298) (-2269.572) * (-2269.756) (-2272.495) [-2271.688] (-2272.811) -- 0:03:15
569000 -- (-2266.598) [-2262.786] (-2264.235) (-2271.072) * (-2273.954) [-2273.855] (-2273.320) (-2278.906) -- 0:03:15
569500 -- [-2272.898] (-2271.697) (-2266.280) (-2265.624) * [-2272.162] (-2264.389) (-2273.983) (-2274.539) -- 0:03:15
570000 -- [-2261.943] (-2268.450) (-2265.954) (-2275.695) * (-2277.273) (-2272.527) (-2272.494) [-2261.785] -- 0:03:14
Average standard deviation of split frequencies: 0.009775
570500 -- (-2267.308) [-2273.156] (-2261.361) (-2267.077) * (-2272.563) (-2278.589) [-2265.545] (-2267.471) -- 0:03:14
571000 -- (-2267.062) (-2270.123) [-2267.884] (-2266.083) * (-2272.200) [-2263.450] (-2270.411) (-2268.268) -- 0:03:14
571500 -- [-2262.661] (-2272.619) (-2265.580) (-2278.714) * (-2274.579) (-2270.437) (-2271.091) [-2265.139] -- 0:03:14
572000 -- [-2271.615] (-2267.582) (-2270.498) (-2274.953) * [-2263.148] (-2282.668) (-2269.817) (-2264.558) -- 0:03:13
572500 -- (-2268.227) (-2270.121) [-2262.181] (-2276.269) * (-2264.563) (-2267.467) [-2265.207] (-2265.096) -- 0:03:14
573000 -- (-2274.404) (-2266.472) [-2266.874] (-2268.619) * (-2271.511) [-2266.922] (-2270.334) (-2273.107) -- 0:03:13
573500 -- [-2259.260] (-2277.237) (-2269.891) (-2268.360) * [-2271.120] (-2266.807) (-2262.213) (-2270.140) -- 0:03:13
574000 -- (-2265.425) (-2261.868) (-2277.707) [-2269.040] * (-2269.075) [-2261.864] (-2263.461) (-2271.538) -- 0:03:12
574500 -- (-2266.936) (-2272.454) (-2263.911) [-2263.882] * (-2273.918) (-2274.514) (-2277.442) [-2261.473] -- 0:03:13
575000 -- [-2269.091] (-2281.458) (-2259.169) (-2261.887) * (-2266.771) (-2272.248) (-2264.955) [-2266.363] -- 0:03:12
Average standard deviation of split frequencies: 0.010094
575500 -- (-2262.785) (-2275.789) [-2259.231] (-2263.829) * (-2269.520) (-2262.982) (-2265.944) [-2265.501] -- 0:03:12
576000 -- [-2263.255] (-2275.801) (-2272.737) (-2263.766) * (-2265.636) (-2274.832) [-2269.025] (-2268.082) -- 0:03:12
576500 -- (-2266.321) [-2262.527] (-2274.645) (-2266.675) * (-2265.131) (-2269.275) [-2262.377] (-2271.809) -- 0:03:11
577000 -- (-2265.878) (-2270.878) (-2268.613) [-2261.411] * [-2260.434] (-2278.916) (-2264.554) (-2268.320) -- 0:03:12
577500 -- (-2277.875) (-2267.681) [-2269.513] (-2268.122) * [-2262.879] (-2264.324) (-2266.924) (-2262.831) -- 0:03:11
578000 -- (-2273.789) (-2274.419) (-2275.902) [-2264.227] * (-2264.473) (-2265.085) [-2263.110] (-2275.110) -- 0:03:11
578500 -- [-2259.801] (-2262.616) (-2270.217) (-2266.907) * [-2266.579] (-2263.317) (-2269.350) (-2277.711) -- 0:03:10
579000 -- (-2265.001) [-2266.004] (-2269.149) (-2270.600) * (-2269.237) [-2262.516] (-2278.379) (-2267.478) -- 0:03:11
579500 -- (-2269.582) [-2260.883] (-2283.032) (-2272.248) * (-2269.566) (-2271.175) [-2263.030] (-2264.193) -- 0:03:10
580000 -- (-2268.012) [-2266.236] (-2267.314) (-2271.944) * (-2279.969) (-2275.561) [-2266.919] (-2265.127) -- 0:03:10
Average standard deviation of split frequencies: 0.009336
580500 -- [-2268.384] (-2265.579) (-2270.712) (-2271.195) * [-2263.478] (-2271.026) (-2272.875) (-2271.438) -- 0:03:10
581000 -- (-2265.219) [-2273.962] (-2272.072) (-2278.675) * (-2263.239) (-2276.687) (-2272.783) [-2265.314] -- 0:03:10
581500 -- (-2269.983) (-2263.988) [-2265.967] (-2273.251) * (-2264.893) (-2273.813) [-2263.558] (-2264.660) -- 0:03:09
582000 -- [-2265.020] (-2265.475) (-2265.275) (-2276.910) * (-2259.627) [-2267.865] (-2279.393) (-2275.692) -- 0:03:09
582500 -- (-2267.965) (-2266.403) [-2264.617] (-2279.698) * (-2271.061) [-2266.515] (-2266.982) (-2268.475) -- 0:03:09
583000 -- (-2265.117) (-2269.632) (-2278.374) [-2261.804] * [-2262.263] (-2268.341) (-2263.456) (-2261.959) -- 0:03:08
583500 -- [-2273.486] (-2278.909) (-2268.904) (-2280.026) * (-2274.218) (-2272.531) [-2267.224] (-2267.281) -- 0:03:09
584000 -- (-2267.938) (-2288.097) [-2269.475] (-2272.237) * (-2280.740) (-2263.163) [-2264.185] (-2266.385) -- 0:03:08
584500 -- (-2268.508) (-2272.905) (-2276.666) [-2274.744] * [-2272.485] (-2268.380) (-2281.607) (-2264.077) -- 0:03:08
585000 -- (-2279.011) (-2281.422) (-2277.984) [-2269.791] * (-2269.982) (-2264.566) (-2270.019) [-2260.552] -- 0:03:07
Average standard deviation of split frequencies: 0.009452
585500 -- (-2276.702) (-2280.577) [-2269.439] (-2263.532) * (-2270.950) (-2267.723) [-2274.248] (-2263.244) -- 0:03:08
586000 -- (-2281.216) (-2282.521) [-2272.484] (-2271.783) * (-2272.021) (-2264.424) [-2266.785] (-2261.466) -- 0:03:07
586500 -- (-2268.554) [-2270.628] (-2282.016) (-2269.552) * (-2263.598) (-2265.485) (-2265.891) [-2264.838] -- 0:03:07
587000 -- (-2274.825) [-2266.974] (-2264.084) (-2278.864) * (-2263.097) (-2264.561) [-2263.372] (-2272.239) -- 0:03:07
587500 -- (-2271.608) (-2268.142) [-2262.413] (-2261.585) * (-2269.167) (-2267.135) (-2261.884) [-2268.510] -- 0:03:06
588000 -- (-2281.327) [-2267.381] (-2272.793) (-2268.055) * [-2269.773] (-2268.713) (-2268.215) (-2269.825) -- 0:03:07
588500 -- (-2272.255) [-2267.442] (-2262.451) (-2275.649) * (-2268.840) (-2271.548) [-2263.365] (-2270.228) -- 0:03:06
589000 -- (-2269.814) (-2266.958) (-2262.362) [-2264.267] * (-2265.985) [-2263.690] (-2271.548) (-2269.349) -- 0:03:06
589500 -- (-2270.398) (-2273.504) (-2269.570) [-2264.689] * [-2262.873] (-2272.376) (-2262.809) (-2265.129) -- 0:03:05
590000 -- (-2274.253) [-2270.390] (-2261.424) (-2266.901) * (-2269.106) (-2271.603) [-2264.746] (-2285.152) -- 0:03:06
Average standard deviation of split frequencies: 0.009777
590500 -- [-2266.339] (-2266.092) (-2279.394) (-2271.849) * (-2265.639) [-2260.072] (-2277.530) (-2270.179) -- 0:03:05
591000 -- (-2267.357) [-2268.714] (-2267.945) (-2263.928) * [-2265.818] (-2260.451) (-2264.927) (-2270.744) -- 0:03:05
591500 -- (-2269.762) (-2268.546) (-2270.435) [-2265.235] * (-2270.163) (-2269.567) [-2264.651] (-2273.892) -- 0:03:05
592000 -- (-2269.073) (-2267.405) (-2270.891) [-2274.038] * (-2267.326) [-2264.343] (-2280.990) (-2284.443) -- 0:03:04
592500 -- (-2270.191) (-2271.617) [-2263.064] (-2265.329) * (-2267.731) [-2261.988] (-2271.718) (-2270.711) -- 0:03:05
593000 -- (-2271.504) (-2264.156) (-2266.554) [-2262.108] * (-2267.749) [-2267.889] (-2271.968) (-2270.435) -- 0:03:04
593500 -- (-2275.094) [-2265.074] (-2266.724) (-2262.413) * (-2267.718) [-2266.073] (-2270.016) (-2270.136) -- 0:03:04
594000 -- (-2263.422) [-2265.732] (-2271.375) (-2270.595) * (-2268.409) [-2269.355] (-2272.039) (-2269.647) -- 0:03:03
594500 -- [-2263.572] (-2262.268) (-2262.579) (-2271.865) * [-2268.177] (-2264.261) (-2269.054) (-2276.286) -- 0:03:04
595000 -- (-2267.607) [-2267.930] (-2266.492) (-2275.088) * (-2272.671) [-2270.416] (-2281.122) (-2259.493) -- 0:03:03
Average standard deviation of split frequencies: 0.009953
595500 -- (-2272.306) (-2276.387) (-2263.127) [-2271.510] * (-2260.824) (-2272.764) (-2269.915) [-2262.913] -- 0:03:03
596000 -- (-2275.231) (-2265.680) [-2262.816] (-2266.260) * (-2272.573) (-2273.071) [-2271.743] (-2271.667) -- 0:03:03
596500 -- (-2271.511) (-2261.970) [-2260.603] (-2264.730) * (-2263.869) (-2270.890) [-2257.533] (-2267.988) -- 0:03:02
597000 -- (-2276.539) (-2271.119) [-2265.249] (-2266.701) * (-2274.781) (-2274.187) (-2269.382) [-2261.874] -- 0:03:02
597500 -- [-2271.171] (-2274.482) (-2265.412) (-2268.716) * (-2264.318) (-2270.387) (-2269.454) [-2265.478] -- 0:03:02
598000 -- (-2266.583) (-2280.555) (-2277.670) [-2270.817] * [-2265.323] (-2264.740) (-2272.345) (-2270.991) -- 0:03:02
598500 -- (-2276.710) [-2265.806] (-2266.676) (-2264.626) * (-2267.967) (-2279.395) (-2268.250) [-2270.713] -- 0:03:01
599000 -- [-2263.453] (-2275.338) (-2262.137) (-2276.366) * (-2271.369) (-2288.720) (-2265.074) [-2266.311] -- 0:03:02
599500 -- (-2266.710) (-2262.312) (-2266.241) [-2267.558] * (-2270.091) (-2267.032) (-2263.794) [-2270.108] -- 0:03:01
600000 -- [-2262.712] (-2272.546) (-2272.146) (-2275.388) * (-2260.720) (-2263.148) (-2270.548) [-2267.644] -- 0:03:01
Average standard deviation of split frequencies: 0.008829
600500 -- [-2268.043] (-2266.682) (-2274.432) (-2272.095) * (-2268.677) [-2268.038] (-2265.651) (-2267.006) -- 0:03:00
601000 -- (-2264.878) [-2265.336] (-2272.218) (-2266.704) * (-2276.184) (-2271.731) [-2270.790] (-2267.430) -- 0:03:01
601500 -- (-2265.140) [-2266.476] (-2263.623) (-2268.114) * (-2281.049) [-2262.695] (-2288.958) (-2270.170) -- 0:03:00
602000 -- (-2276.183) (-2270.931) [-2268.279] (-2279.511) * (-2271.055) (-2282.386) (-2273.431) [-2266.739] -- 0:03:00
602500 -- (-2263.210) [-2264.678] (-2264.998) (-2264.195) * (-2281.472) [-2262.536] (-2275.532) (-2268.213) -- 0:03:00
603000 -- (-2270.750) (-2270.331) [-2266.301] (-2276.789) * (-2279.506) [-2262.584] (-2270.962) (-2264.461) -- 0:02:59
603500 -- (-2267.319) [-2268.328] (-2263.379) (-2274.096) * (-2269.348) (-2267.858) [-2271.382] (-2265.181) -- 0:03:00
604000 -- (-2274.685) (-2274.916) (-2269.610) [-2274.454] * (-2270.434) (-2273.852) (-2273.564) [-2264.293] -- 0:02:59
604500 -- (-2272.334) [-2263.560] (-2282.613) (-2266.364) * (-2266.474) [-2265.585] (-2265.961) (-2270.124) -- 0:02:59
605000 -- [-2266.834] (-2264.905) (-2272.768) (-2274.025) * (-2264.159) [-2263.768] (-2269.153) (-2273.908) -- 0:02:58
Average standard deviation of split frequencies: 0.008427
605500 -- (-2268.471) (-2272.820) (-2272.301) [-2267.114] * (-2272.290) [-2264.350] (-2263.998) (-2286.120) -- 0:02:59
606000 -- (-2263.876) [-2266.946] (-2266.068) (-2267.581) * (-2269.937) [-2265.099] (-2264.336) (-2267.602) -- 0:02:58
606500 -- [-2267.329] (-2285.994) (-2277.006) (-2262.756) * (-2275.745) (-2264.868) (-2271.036) [-2273.539] -- 0:02:58
607000 -- (-2272.662) (-2268.380) (-2266.795) [-2262.221] * [-2263.448] (-2269.886) (-2265.893) (-2269.638) -- 0:02:58
607500 -- (-2270.939) (-2276.514) (-2271.274) [-2271.304] * (-2262.167) [-2261.905] (-2263.832) (-2276.994) -- 0:02:57
608000 -- [-2262.521] (-2266.049) (-2267.559) (-2271.234) * (-2263.347) (-2272.506) (-2262.481) [-2259.642] -- 0:02:57
608500 -- [-2263.234] (-2262.602) (-2275.611) (-2267.450) * (-2268.998) (-2268.720) (-2268.830) [-2263.643] -- 0:02:57
609000 -- [-2272.754] (-2272.553) (-2273.654) (-2268.668) * (-2265.029) [-2263.621] (-2265.067) (-2273.557) -- 0:02:57
609500 -- (-2273.224) (-2267.445) (-2273.827) [-2270.175] * [-2263.842] (-2271.506) (-2278.367) (-2275.601) -- 0:02:56
610000 -- (-2267.821) [-2259.431] (-2268.749) (-2266.044) * (-2272.667) (-2273.921) [-2272.328] (-2263.814) -- 0:02:57
Average standard deviation of split frequencies: 0.008491
610500 -- (-2270.453) (-2271.651) (-2268.252) [-2265.975] * [-2267.602] (-2262.288) (-2267.410) (-2263.194) -- 0:02:56
611000 -- (-2266.581) [-2277.126] (-2273.701) (-2266.228) * (-2269.016) [-2268.229] (-2265.516) (-2269.996) -- 0:02:56
611500 -- (-2266.435) [-2269.605] (-2270.782) (-2274.390) * (-2283.129) [-2287.723] (-2276.618) (-2265.105) -- 0:02:55
612000 -- (-2270.619) (-2272.761) (-2271.164) [-2275.509] * (-2275.783) [-2267.861] (-2265.124) (-2269.336) -- 0:02:56
612500 -- (-2266.604) (-2278.945) (-2261.784) [-2261.615] * (-2268.071) (-2266.219) (-2266.830) [-2275.179] -- 0:02:55
613000 -- (-2274.532) (-2264.035) [-2269.043] (-2270.295) * (-2275.003) (-2265.822) (-2267.593) [-2264.978] -- 0:02:55
613500 -- (-2274.287) (-2272.678) [-2263.751] (-2267.880) * (-2272.959) (-2272.070) (-2275.153) [-2267.819] -- 0:02:55
614000 -- (-2267.937) (-2269.655) [-2265.951] (-2271.502) * (-2260.085) (-2265.933) [-2266.919] (-2270.296) -- 0:02:54
614500 -- (-2266.841) (-2264.750) (-2271.298) [-2270.730] * [-2267.905] (-2278.513) (-2269.204) (-2269.123) -- 0:02:55
615000 -- (-2277.436) (-2262.592) [-2276.016] (-2264.836) * [-2271.823] (-2269.367) (-2262.805) (-2262.571) -- 0:02:54
Average standard deviation of split frequencies: 0.008099
615500 -- (-2273.139) [-2263.511] (-2264.308) (-2272.491) * (-2270.322) (-2274.478) [-2263.761] (-2262.976) -- 0:02:54
616000 -- (-2270.215) (-2265.968) [-2261.967] (-2271.351) * (-2272.606) (-2270.452) [-2267.786] (-2265.302) -- 0:02:53
616500 -- [-2264.966] (-2269.887) (-2270.628) (-2265.812) * (-2273.167) (-2265.601) [-2275.244] (-2267.439) -- 0:02:54
617000 -- (-2270.229) (-2265.346) [-2267.195] (-2279.831) * (-2277.317) [-2262.268] (-2272.529) (-2273.362) -- 0:02:53
617500 -- [-2271.514] (-2271.662) (-2267.525) (-2266.906) * (-2267.943) [-2262.359] (-2268.156) (-2274.584) -- 0:02:53
618000 -- (-2272.989) [-2266.899] (-2268.362) (-2260.698) * (-2267.544) (-2274.048) (-2261.732) [-2266.706] -- 0:02:53
618500 -- [-2268.505] (-2264.465) (-2273.541) (-2266.515) * (-2272.485) [-2272.713] (-2270.432) (-2270.703) -- 0:02:52
619000 -- (-2267.053) (-2270.916) [-2262.522] (-2274.350) * [-2267.729] (-2272.653) (-2266.748) (-2269.993) -- 0:02:52
619500 -- [-2266.509] (-2260.618) (-2268.896) (-2287.489) * [-2263.944] (-2261.466) (-2272.338) (-2268.319) -- 0:02:52
620000 -- (-2275.092) [-2267.644] (-2267.293) (-2269.324) * (-2262.294) (-2269.529) [-2275.519] (-2264.952) -- 0:02:52
Average standard deviation of split frequencies: 0.007722
620500 -- (-2265.508) (-2283.140) (-2276.360) [-2263.264] * (-2274.890) (-2267.747) [-2263.082] (-2270.952) -- 0:02:51
621000 -- (-2270.385) (-2270.111) (-2266.510) [-2269.400] * (-2264.632) (-2273.840) [-2265.196] (-2278.432) -- 0:02:52
621500 -- (-2271.556) (-2272.684) (-2267.857) [-2277.167] * [-2259.321] (-2273.878) (-2272.558) (-2281.539) -- 0:02:51
622000 -- (-2262.697) (-2262.802) (-2262.206) [-2260.047] * (-2262.494) [-2265.338] (-2273.099) (-2272.416) -- 0:02:51
622500 -- [-2272.757] (-2262.783) (-2261.301) (-2275.214) * (-2267.684) (-2261.020) (-2263.162) [-2268.443] -- 0:02:51
623000 -- (-2262.353) (-2265.905) [-2279.833] (-2271.427) * (-2269.239) (-2273.051) (-2266.903) [-2264.383] -- 0:02:51
623500 -- (-2268.543) (-2277.004) (-2262.365) [-2263.320] * (-2270.436) (-2273.040) (-2266.614) [-2270.177] -- 0:02:50
624000 -- (-2269.015) (-2269.627) (-2260.675) [-2262.821] * (-2262.515) (-2277.056) [-2266.064] (-2279.263) -- 0:02:50
624500 -- (-2260.068) (-2261.260) (-2266.723) [-2266.233] * (-2273.076) [-2266.778] (-2273.316) (-2259.684) -- 0:02:50
625000 -- (-2271.375) (-2269.585) [-2265.630] (-2281.002) * (-2275.631) (-2276.257) (-2264.212) [-2261.712] -- 0:02:49
Average standard deviation of split frequencies: 0.007844
625500 -- (-2264.731) (-2279.091) [-2260.443] (-2262.282) * (-2262.710) (-2266.358) (-2276.334) [-2268.469] -- 0:02:50
626000 -- [-2263.010] (-2267.923) (-2274.779) (-2265.597) * (-2264.253) [-2257.780] (-2266.508) (-2266.854) -- 0:02:49
626500 -- (-2269.142) (-2264.385) (-2261.995) [-2265.192] * [-2263.307] (-2271.675) (-2270.967) (-2268.730) -- 0:02:49
627000 -- (-2266.383) (-2266.006) [-2267.208] (-2264.738) * (-2273.154) [-2265.962] (-2276.515) (-2268.037) -- 0:02:48
627500 -- [-2268.472] (-2265.853) (-2272.905) (-2264.851) * (-2268.653) (-2269.724) [-2264.597] (-2275.677) -- 0:02:49
628000 -- (-2274.943) (-2268.230) [-2265.391] (-2282.980) * (-2269.780) [-2270.877] (-2266.168) (-2274.491) -- 0:02:48
628500 -- (-2265.029) (-2271.699) [-2261.552] (-2264.578) * (-2270.070) (-2270.584) [-2265.994] (-2263.041) -- 0:02:48
629000 -- (-2269.906) (-2269.785) [-2264.568] (-2264.665) * (-2272.361) [-2274.236] (-2290.524) (-2271.343) -- 0:02:48
629500 -- (-2278.117) (-2267.499) (-2276.126) [-2269.793] * [-2260.599] (-2265.589) (-2286.403) (-2267.943) -- 0:02:47
630000 -- [-2262.493] (-2261.720) (-2275.904) (-2271.222) * [-2265.501] (-2270.560) (-2280.445) (-2275.611) -- 0:02:47
Average standard deviation of split frequencies: 0.007662
630500 -- (-2263.689) (-2266.835) (-2264.460) [-2266.097] * [-2260.587] (-2270.036) (-2277.356) (-2271.257) -- 0:02:47
631000 -- (-2282.080) [-2261.544] (-2270.849) (-2279.380) * (-2263.633) (-2277.875) (-2281.864) [-2266.195] -- 0:02:47
631500 -- [-2263.268] (-2276.527) (-2269.700) (-2264.232) * [-2269.405] (-2265.031) (-2284.052) (-2263.218) -- 0:02:46
632000 -- (-2264.217) (-2269.196) [-2276.377] (-2264.668) * (-2281.387) (-2282.327) (-2282.539) [-2262.243] -- 0:02:47
632500 -- (-2271.071) (-2269.924) (-2267.039) [-2263.526] * (-2262.058) (-2268.266) (-2282.243) [-2269.111] -- 0:02:46
633000 -- (-2289.415) (-2266.280) [-2259.873] (-2269.570) * [-2259.551] (-2267.928) (-2266.734) (-2273.269) -- 0:02:46
633500 -- (-2271.960) (-2280.466) (-2259.304) [-2260.249] * (-2268.248) (-2259.375) [-2265.510] (-2274.221) -- 0:02:46
634000 -- (-2276.945) (-2267.883) [-2262.695] (-2266.005) * (-2274.066) [-2270.557] (-2272.009) (-2265.753) -- 0:02:45
634500 -- [-2272.113] (-2267.435) (-2268.097) (-2267.270) * (-2272.765) (-2269.291) (-2269.370) [-2268.499] -- 0:02:45
635000 -- (-2266.072) [-2265.165] (-2276.273) (-2260.610) * [-2262.076] (-2265.819) (-2267.264) (-2277.961) -- 0:02:45
Average standard deviation of split frequencies: 0.007659
635500 -- [-2262.716] (-2264.859) (-2269.915) (-2266.962) * [-2266.648] (-2273.613) (-2267.078) (-2274.149) -- 0:02:45
636000 -- (-2266.600) [-2265.154] (-2269.960) (-2271.289) * [-2264.374] (-2268.795) (-2267.129) (-2276.742) -- 0:02:44
636500 -- (-2270.453) (-2262.689) (-2267.363) [-2270.081] * [-2267.308] (-2263.164) (-2264.858) (-2279.406) -- 0:02:45
637000 -- (-2271.589) (-2268.251) [-2263.192] (-2270.527) * (-2268.972) (-2267.916) [-2266.112] (-2265.948) -- 0:02:44
637500 -- (-2271.634) [-2266.856] (-2273.932) (-2266.620) * [-2266.877] (-2265.642) (-2262.399) (-2272.077) -- 0:02:44
638000 -- (-2263.185) (-2261.759) [-2261.996] (-2265.630) * (-2274.304) (-2267.670) (-2269.743) [-2267.182] -- 0:02:43
638500 -- (-2269.170) (-2277.265) [-2267.634] (-2265.112) * (-2273.515) (-2266.365) (-2274.611) [-2269.189] -- 0:02:43
639000 -- (-2265.505) (-2269.983) (-2277.674) [-2269.794] * (-2279.805) (-2269.680) (-2267.126) [-2268.088] -- 0:02:43
639500 -- (-2266.454) [-2266.916] (-2277.543) (-2267.141) * [-2265.816] (-2268.572) (-2266.928) (-2259.520) -- 0:02:43
640000 -- (-2267.913) [-2268.632] (-2272.867) (-2277.896) * [-2263.837] (-2267.276) (-2265.901) (-2261.162) -- 0:02:43
Average standard deviation of split frequencies: 0.008033
640500 -- [-2273.611] (-2265.501) (-2262.705) (-2272.021) * (-2264.827) [-2262.358] (-2268.030) (-2265.339) -- 0:02:42
641000 -- (-2270.572) (-2270.476) [-2266.294] (-2272.902) * (-2273.552) [-2264.246] (-2262.351) (-2271.882) -- 0:02:42
641500 -- (-2265.988) (-2272.142) [-2262.117] (-2272.796) * (-2267.760) (-2267.801) (-2265.963) [-2260.199] -- 0:02:42
642000 -- (-2271.115) (-2268.576) (-2271.329) [-2265.605] * (-2261.685) [-2275.723] (-2277.478) (-2262.238) -- 0:02:42
642500 -- (-2269.486) (-2269.083) (-2287.560) [-2263.442] * [-2265.757] (-2263.650) (-2277.768) (-2262.983) -- 0:02:41
643000 -- (-2268.751) (-2273.091) (-2266.860) [-2264.276] * (-2269.187) [-2265.809] (-2272.890) (-2264.443) -- 0:02:42
643500 -- (-2264.498) [-2265.542] (-2271.329) (-2269.788) * (-2264.746) [-2275.621] (-2276.512) (-2260.647) -- 0:02:41
644000 -- (-2277.331) (-2269.565) [-2268.626] (-2269.977) * (-2268.262) (-2276.459) (-2273.395) [-2260.351] -- 0:02:41
644500 -- [-2268.519] (-2265.414) (-2273.186) (-2278.104) * (-2263.929) [-2258.575] (-2270.515) (-2260.143) -- 0:02:41
645000 -- (-2269.595) (-2275.454) [-2270.087] (-2269.019) * (-2270.963) (-2274.739) (-2271.036) [-2278.137] -- 0:02:40
Average standard deviation of split frequencies: 0.008818
645500 -- (-2262.064) (-2271.742) (-2275.254) [-2265.347] * (-2269.507) (-2270.042) [-2269.515] (-2274.492) -- 0:02:40
646000 -- (-2265.026) (-2266.893) (-2267.616) [-2265.463] * [-2271.692] (-2266.230) (-2269.173) (-2267.572) -- 0:02:40
646500 -- [-2264.978] (-2278.143) (-2267.482) (-2269.909) * (-2271.486) [-2261.871] (-2267.567) (-2272.105) -- 0:02:40
647000 -- (-2267.088) (-2272.249) [-2271.427] (-2272.035) * (-2272.366) (-2271.577) [-2259.698] (-2264.719) -- 0:02:39
647500 -- (-2265.382) (-2267.964) [-2272.824] (-2275.123) * (-2264.313) [-2266.077] (-2269.345) (-2266.774) -- 0:02:40
648000 -- (-2265.194) (-2268.534) [-2260.709] (-2272.238) * (-2277.701) (-2266.312) (-2279.909) [-2267.242] -- 0:02:39
648500 -- [-2272.802] (-2268.041) (-2272.555) (-2272.261) * (-2276.364) (-2267.163) (-2262.690) [-2267.581] -- 0:02:39
649000 -- [-2270.745] (-2269.720) (-2265.831) (-2266.507) * (-2269.145) (-2268.530) (-2262.428) [-2266.063] -- 0:02:39
649500 -- (-2274.238) (-2262.881) (-2277.560) [-2260.582] * (-2276.130) (-2262.474) [-2267.820] (-2269.524) -- 0:02:38
650000 -- (-2262.611) [-2260.836] (-2273.670) (-2277.268) * (-2261.447) (-2272.065) (-2278.063) [-2261.278] -- 0:02:38
Average standard deviation of split frequencies: 0.007909
650500 -- [-2267.331] (-2263.679) (-2271.069) (-2265.935) * (-2272.135) [-2268.753] (-2273.261) (-2267.529) -- 0:02:38
651000 -- (-2274.528) [-2262.566] (-2277.991) (-2271.084) * [-2272.549] (-2266.205) (-2264.930) (-2275.713) -- 0:02:38
651500 -- (-2268.134) (-2273.823) (-2269.441) [-2271.410] * (-2266.622) (-2263.791) (-2275.593) [-2267.786] -- 0:02:37
652000 -- (-2265.166) (-2270.635) (-2273.476) [-2269.616] * (-2280.133) (-2263.053) (-2280.008) [-2264.403] -- 0:02:37
652500 -- (-2268.930) (-2267.843) (-2278.882) [-2261.006] * (-2272.577) [-2264.780] (-2268.762) (-2265.622) -- 0:02:37
653000 -- [-2263.175] (-2263.137) (-2265.262) (-2264.694) * (-2266.453) [-2268.551] (-2266.095) (-2267.063) -- 0:02:37
653500 -- (-2276.026) (-2263.859) (-2261.273) [-2264.773] * (-2272.115) (-2270.490) [-2270.801] (-2265.813) -- 0:02:36
654000 -- (-2269.396) (-2268.710) [-2263.520] (-2269.766) * [-2276.855] (-2271.536) (-2265.671) (-2269.037) -- 0:02:36
654500 -- (-2266.500) (-2270.313) [-2266.630] (-2275.326) * [-2267.542] (-2265.331) (-2267.123) (-2269.933) -- 0:02:36
655000 -- (-2267.257) [-2271.211] (-2264.547) (-2279.450) * (-2264.162) (-2273.003) [-2270.502] (-2280.642) -- 0:02:36
Average standard deviation of split frequencies: 0.007725
655500 -- (-2263.702) (-2273.235) [-2267.418] (-2282.110) * [-2278.449] (-2277.590) (-2261.036) (-2272.667) -- 0:02:36
656000 -- (-2274.884) [-2272.167] (-2266.447) (-2275.851) * (-2263.123) [-2272.561] (-2268.159) (-2263.104) -- 0:02:35
656500 -- (-2280.357) (-2269.377) [-2266.475] (-2286.517) * (-2271.908) (-2265.162) (-2273.162) [-2261.831] -- 0:02:35
657000 -- (-2275.883) (-2275.161) [-2262.882] (-2272.342) * (-2270.744) (-2264.572) [-2269.267] (-2264.163) -- 0:02:35
657500 -- (-2273.639) (-2262.309) [-2266.072] (-2279.082) * [-2263.463] (-2263.627) (-2280.332) (-2267.815) -- 0:02:35
658000 -- (-2276.885) (-2269.020) [-2268.728] (-2275.950) * [-2277.320] (-2274.697) (-2272.262) (-2267.386) -- 0:02:34
658500 -- (-2265.486) (-2272.688) (-2265.332) [-2266.497] * (-2268.891) [-2267.690] (-2265.276) (-2267.511) -- 0:02:35
659000 -- [-2272.752] (-2271.198) (-2264.750) (-2266.750) * (-2263.736) (-2269.150) (-2270.443) [-2267.729] -- 0:02:34
659500 -- (-2269.033) (-2264.167) (-2266.130) [-2268.289] * (-2273.060) (-2269.014) [-2268.108] (-2265.725) -- 0:02:34
660000 -- (-2270.196) (-2259.803) (-2283.204) [-2264.644] * (-2270.743) (-2279.526) [-2260.725] (-2265.752) -- 0:02:34
Average standard deviation of split frequencies: 0.008027
660500 -- (-2270.812) [-2264.536] (-2266.123) (-2281.040) * (-2267.384) (-2268.711) (-2270.660) [-2262.062] -- 0:02:33
661000 -- (-2271.126) [-2265.062] (-2272.222) (-2266.623) * [-2265.759] (-2269.595) (-2270.753) (-2265.254) -- 0:02:33
661500 -- (-2275.859) [-2271.072] (-2275.920) (-2269.474) * [-2263.082] (-2263.963) (-2264.429) (-2272.355) -- 0:02:33
662000 -- (-2272.549) (-2269.836) (-2275.591) [-2270.720] * (-2266.433) [-2262.348] (-2261.587) (-2265.793) -- 0:02:33
662500 -- (-2266.045) [-2267.923] (-2279.792) (-2266.577) * (-2269.998) (-2264.932) (-2268.134) [-2265.484] -- 0:02:32
663000 -- [-2258.360] (-2282.683) (-2268.084) (-2270.079) * (-2265.962) (-2280.127) [-2270.564] (-2264.236) -- 0:02:32
663500 -- (-2264.137) (-2271.080) (-2266.005) [-2264.426] * (-2264.710) (-2265.918) [-2263.882] (-2271.292) -- 0:02:32
664000 -- (-2275.079) (-2278.593) [-2267.118] (-2259.108) * (-2261.488) (-2269.672) [-2264.860] (-2269.884) -- 0:02:32
664500 -- (-2270.003) (-2271.082) [-2267.893] (-2267.566) * (-2262.191) (-2279.348) [-2266.714] (-2278.180) -- 0:02:31
665000 -- (-2262.498) (-2265.382) (-2265.624) [-2268.261] * (-2265.006) (-2278.805) [-2271.073] (-2277.779) -- 0:02:31
Average standard deviation of split frequencies: 0.008317
665500 -- (-2269.868) (-2273.889) [-2261.735] (-2268.361) * (-2265.850) [-2271.150] (-2265.811) (-2269.034) -- 0:02:31
666000 -- (-2262.328) (-2265.138) [-2267.455] (-2275.262) * [-2261.844] (-2269.831) (-2271.910) (-2265.983) -- 0:02:31
666500 -- (-2263.076) [-2267.019] (-2269.989) (-2274.794) * (-2260.285) (-2268.847) [-2258.409] (-2270.317) -- 0:02:31
667000 -- (-2265.835) (-2280.770) [-2277.052] (-2271.480) * (-2265.685) [-2272.429] (-2267.988) (-2273.034) -- 0:02:30
667500 -- (-2272.638) (-2266.653) [-2266.866] (-2267.980) * (-2267.495) (-2279.428) [-2261.549] (-2269.073) -- 0:02:30
668000 -- (-2271.962) (-2270.830) [-2274.304] (-2268.731) * (-2273.560) [-2271.814] (-2266.653) (-2267.475) -- 0:02:30
668500 -- (-2268.088) (-2266.523) (-2280.274) [-2264.544] * (-2274.019) (-2269.183) (-2271.980) [-2272.587] -- 0:02:30
669000 -- (-2271.086) (-2257.994) [-2272.629] (-2272.994) * (-2274.949) (-2263.940) (-2269.153) [-2271.317] -- 0:02:29
669500 -- (-2273.629) (-2263.394) [-2265.114] (-2267.499) * (-2274.145) (-2268.178) [-2264.793] (-2262.369) -- 0:02:30
670000 -- (-2277.619) (-2265.590) [-2268.070] (-2264.665) * (-2268.867) [-2265.000] (-2265.517) (-2272.408) -- 0:02:29
Average standard deviation of split frequencies: 0.007673
670500 -- (-2274.444) [-2260.164] (-2260.235) (-2263.338) * (-2277.533) (-2268.577) [-2267.874] (-2265.701) -- 0:02:29
671000 -- [-2268.351] (-2262.674) (-2260.969) (-2272.402) * (-2275.182) (-2264.331) [-2265.009] (-2267.376) -- 0:02:29
671500 -- (-2266.925) [-2265.572] (-2260.494) (-2279.372) * [-2271.210] (-2263.709) (-2265.974) (-2264.857) -- 0:02:28
672000 -- (-2267.352) (-2269.221) (-2269.949) [-2268.099] * (-2265.292) (-2267.484) (-2276.544) [-2269.508] -- 0:02:28
672500 -- (-2265.694) [-2264.067] (-2271.810) (-2268.234) * (-2272.678) [-2266.679] (-2266.576) (-2265.197) -- 0:02:28
673000 -- [-2257.912] (-2271.994) (-2273.549) (-2262.443) * (-2273.993) (-2274.737) (-2261.842) [-2267.700] -- 0:02:28
673500 -- (-2270.112) (-2265.497) [-2264.576] (-2269.938) * (-2265.552) [-2259.190] (-2263.533) (-2274.561) -- 0:02:27
674000 -- (-2266.785) (-2268.010) (-2263.568) [-2269.723] * (-2268.051) [-2262.521] (-2261.931) (-2267.265) -- 0:02:28
674500 -- [-2268.123] (-2271.087) (-2276.024) (-2270.660) * [-2263.996] (-2265.058) (-2268.581) (-2271.487) -- 0:02:27
675000 -- (-2268.739) [-2265.658] (-2263.012) (-2268.772) * (-2277.218) (-2279.819) (-2270.049) [-2266.438] -- 0:02:27
Average standard deviation of split frequencies: 0.008019
675500 -- (-2268.045) (-2271.446) [-2271.058] (-2264.016) * (-2265.388) (-2274.720) (-2263.963) [-2273.982] -- 0:02:26
676000 -- (-2272.444) (-2263.579) [-2263.682] (-2270.041) * (-2264.643) [-2257.324] (-2279.022) (-2270.737) -- 0:02:26
676500 -- (-2272.984) [-2259.424] (-2266.935) (-2279.871) * (-2272.337) (-2270.197) [-2264.731] (-2263.933) -- 0:02:26
677000 -- [-2263.592] (-2261.261) (-2276.224) (-2260.458) * [-2265.515] (-2280.084) (-2269.595) (-2275.501) -- 0:02:26
677500 -- (-2275.680) [-2270.183] (-2260.021) (-2266.213) * (-2265.863) (-2279.763) (-2264.270) [-2268.614] -- 0:02:26
678000 -- (-2261.237) (-2269.008) (-2266.348) [-2261.344] * (-2262.342) (-2271.191) (-2271.564) [-2270.319] -- 0:02:25
678500 -- (-2271.533) (-2268.896) [-2264.832] (-2268.625) * (-2264.609) [-2260.195] (-2281.011) (-2258.905) -- 0:02:25
679000 -- (-2270.573) [-2264.184] (-2265.487) (-2274.578) * (-2261.359) [-2269.246] (-2275.485) (-2274.741) -- 0:02:25
679500 -- (-2266.642) [-2263.165] (-2273.774) (-2261.330) * [-2266.565] (-2262.916) (-2281.790) (-2270.414) -- 0:02:25
680000 -- (-2267.438) (-2269.090) [-2266.459] (-2265.416) * (-2267.105) (-2271.659) [-2263.756] (-2269.828) -- 0:02:24
Average standard deviation of split frequencies: 0.007618
680500 -- [-2266.127] (-2265.808) (-2276.299) (-2268.276) * (-2272.740) [-2265.333] (-2268.343) (-2263.559) -- 0:02:24
681000 -- (-2261.724) [-2266.942] (-2271.016) (-2273.050) * (-2264.581) (-2281.692) (-2273.140) [-2266.382] -- 0:02:24
681500 -- [-2261.603] (-2265.540) (-2276.040) (-2264.758) * (-2267.795) (-2270.295) [-2265.223] (-2271.715) -- 0:02:24
682000 -- [-2265.511] (-2280.051) (-2273.017) (-2273.487) * (-2276.765) (-2265.338) [-2268.698] (-2267.904) -- 0:02:24
682500 -- (-2269.756) (-2268.349) (-2266.145) [-2268.554] * (-2266.402) (-2278.919) [-2262.632] (-2265.757) -- 0:02:23
683000 -- (-2262.253) (-2262.269) (-2280.651) [-2268.622] * [-2264.525] (-2261.784) (-2266.611) (-2263.501) -- 0:02:23
683500 -- (-2274.560) [-2271.608] (-2268.186) (-2272.140) * (-2264.464) [-2260.538] (-2267.693) (-2262.688) -- 0:02:23
684000 -- (-2265.953) (-2262.511) [-2261.609] (-2274.438) * (-2260.818) (-2270.211) (-2271.550) [-2266.640] -- 0:02:23
684500 -- [-2268.499] (-2262.292) (-2270.593) (-2275.968) * (-2269.939) (-2269.540) (-2267.387) [-2269.688] -- 0:02:22
685000 -- (-2274.679) (-2261.701) (-2267.534) [-2267.692] * [-2260.644] (-2273.076) (-2270.391) (-2267.598) -- 0:02:23
Average standard deviation of split frequencies: 0.008132
685500 -- (-2267.735) [-2265.008] (-2270.405) (-2266.107) * (-2260.495) (-2270.815) [-2268.751] (-2265.757) -- 0:02:22
686000 -- (-2274.524) (-2270.596) (-2266.951) [-2267.565] * (-2269.657) (-2264.614) (-2268.712) [-2266.229] -- 0:02:22
686500 -- [-2264.181] (-2268.758) (-2266.632) (-2273.536) * (-2268.031) [-2266.254] (-2273.581) (-2280.168) -- 0:02:22
687000 -- [-2268.102] (-2273.512) (-2279.761) (-2270.549) * (-2271.178) [-2267.878] (-2264.818) (-2268.671) -- 0:02:21
687500 -- (-2275.194) (-2265.885) (-2267.613) [-2265.814] * (-2262.510) (-2273.814) [-2263.065] (-2278.159) -- 0:02:21
688000 -- [-2264.715] (-2281.238) (-2266.185) (-2277.926) * (-2264.625) (-2277.294) (-2274.366) [-2269.188] -- 0:02:21
688500 -- (-2276.195) [-2258.847] (-2267.343) (-2277.814) * [-2264.030] (-2273.371) (-2265.031) (-2263.556) -- 0:02:21
689000 -- [-2264.123] (-2263.277) (-2271.338) (-2270.004) * (-2270.160) (-2281.989) (-2268.445) [-2274.027] -- 0:02:20
689500 -- (-2265.076) (-2263.849) (-2274.876) [-2269.765] * [-2263.417] (-2272.353) (-2276.367) (-2266.347) -- 0:02:20
690000 -- (-2266.165) (-2269.591) [-2264.673] (-2263.753) * [-2261.624] (-2264.431) (-2270.220) (-2262.007) -- 0:02:20
Average standard deviation of split frequencies: 0.008702
690500 -- [-2262.745] (-2270.127) (-2269.750) (-2265.798) * (-2270.161) (-2266.336) (-2273.520) [-2260.862] -- 0:02:20
691000 -- [-2261.798] (-2275.543) (-2266.201) (-2267.190) * (-2267.726) (-2266.043) [-2269.378] (-2266.125) -- 0:02:19
691500 -- (-2273.733) [-2264.357] (-2268.743) (-2267.443) * (-2269.682) (-2272.969) (-2265.323) [-2264.403] -- 0:02:19
692000 -- (-2269.019) [-2265.709] (-2271.002) (-2268.578) * (-2262.744) (-2266.429) (-2268.501) [-2263.047] -- 0:02:19
692500 -- (-2268.658) (-2269.332) [-2262.126] (-2264.184) * [-2261.058] (-2275.668) (-2269.494) (-2267.905) -- 0:02:19
693000 -- (-2266.911) (-2266.820) (-2258.388) [-2261.572] * (-2263.031) (-2275.313) [-2263.585] (-2261.742) -- 0:02:19
693500 -- (-2277.479) (-2262.210) [-2271.546] (-2265.651) * (-2265.858) [-2263.925] (-2262.042) (-2269.764) -- 0:02:18
694000 -- (-2271.064) (-2276.420) (-2269.411) [-2259.030] * [-2267.034] (-2269.506) (-2274.064) (-2276.525) -- 0:02:18
694500 -- (-2276.575) (-2270.134) (-2272.159) [-2272.616] * (-2271.173) (-2263.990) [-2266.933] (-2275.087) -- 0:02:18
695000 -- (-2267.331) (-2260.951) (-2274.136) [-2266.764] * (-2270.988) (-2263.486) [-2264.140] (-2265.282) -- 0:02:18
Average standard deviation of split frequencies: 0.008805
695500 -- (-2271.251) [-2264.652] (-2270.501) (-2273.639) * (-2269.771) [-2266.651] (-2265.292) (-2281.164) -- 0:02:17
696000 -- (-2273.855) (-2270.706) (-2273.160) [-2267.670] * [-2266.195] (-2265.887) (-2267.718) (-2275.789) -- 0:02:18
696500 -- (-2264.030) (-2270.320) [-2261.521] (-2265.796) * [-2270.442] (-2267.370) (-2276.139) (-2269.028) -- 0:02:17
697000 -- (-2263.982) (-2270.190) (-2259.750) [-2262.171] * [-2268.546] (-2268.107) (-2274.530) (-2276.125) -- 0:02:17
697500 -- [-2268.958] (-2277.231) (-2268.739) (-2265.801) * [-2266.608] (-2269.244) (-2275.168) (-2273.818) -- 0:02:17
698000 -- (-2268.480) [-2280.960] (-2272.517) (-2264.150) * [-2270.387] (-2264.366) (-2276.181) (-2260.884) -- 0:02:16
698500 -- (-2268.436) (-2267.138) [-2266.354] (-2263.101) * [-2261.394] (-2261.507) (-2266.286) (-2270.656) -- 0:02:16
699000 -- [-2266.320] (-2269.873) (-2275.270) (-2262.423) * [-2265.721] (-2264.105) (-2268.694) (-2279.310) -- 0:02:16
699500 -- (-2270.426) (-2272.285) [-2263.802] (-2274.903) * [-2263.160] (-2268.794) (-2270.650) (-2280.905) -- 0:02:16
700000 -- (-2270.995) (-2268.200) [-2268.550] (-2264.735) * (-2263.019) (-2275.066) (-2278.284) [-2269.015] -- 0:02:15
Average standard deviation of split frequencies: 0.008410
700500 -- [-2271.243] (-2274.232) (-2276.609) (-2269.802) * (-2261.586) (-2261.873) [-2270.132] (-2266.605) -- 0:02:15
701000 -- (-2269.907) (-2276.948) [-2265.822] (-2269.953) * (-2273.106) (-2269.015) (-2277.854) [-2268.981] -- 0:02:15
701500 -- (-2275.778) (-2264.784) (-2267.079) [-2266.707] * [-2266.069] (-2266.318) (-2269.624) (-2274.441) -- 0:02:15
702000 -- (-2270.361) (-2267.627) (-2272.257) [-2274.633] * (-2269.981) (-2268.183) [-2268.480] (-2272.732) -- 0:02:14
702500 -- (-2268.193) [-2269.105] (-2272.501) (-2272.966) * (-2266.863) (-2269.079) (-2259.892) [-2261.903] -- 0:02:14
703000 -- (-2264.389) [-2265.905] (-2269.290) (-2261.814) * (-2268.079) (-2262.980) (-2274.975) [-2261.881] -- 0:02:14
703500 -- [-2261.154] (-2270.652) (-2265.963) (-2273.400) * [-2271.489] (-2264.783) (-2269.924) (-2277.901) -- 0:02:14
704000 -- [-2265.642] (-2268.173) (-2278.487) (-2264.963) * [-2266.891] (-2261.617) (-2270.804) (-2272.800) -- 0:02:14
704500 -- (-2266.451) (-2278.605) (-2267.148) [-2261.697] * [-2269.373] (-2279.528) (-2268.046) (-2272.368) -- 0:02:13
705000 -- [-2265.128] (-2268.882) (-2269.187) (-2267.301) * (-2262.873) [-2272.486] (-2270.484) (-2268.691) -- 0:02:13
Average standard deviation of split frequencies: 0.008346
705500 -- (-2261.226) (-2272.126) [-2274.277] (-2266.301) * [-2268.371] (-2269.225) (-2273.977) (-2264.612) -- 0:02:13
706000 -- (-2266.525) (-2269.537) (-2263.393) [-2267.533] * (-2270.656) [-2268.919] (-2264.476) (-2265.092) -- 0:02:13
706500 -- (-2271.637) (-2268.719) (-2272.424) [-2266.862] * [-2271.999] (-2278.796) (-2271.013) (-2268.286) -- 0:02:12
707000 -- (-2261.697) [-2264.040] (-2271.673) (-2270.898) * (-2261.814) [-2269.966] (-2265.964) (-2264.812) -- 0:02:13
707500 -- (-2268.012) [-2261.750] (-2277.803) (-2269.491) * [-2263.679] (-2262.575) (-2273.503) (-2274.497) -- 0:02:12
708000 -- (-2260.387) (-2276.680) (-2267.494) [-2261.264] * (-2271.891) (-2273.608) (-2271.949) [-2267.968] -- 0:02:12
708500 -- (-2268.483) (-2262.728) [-2267.293] (-2264.362) * (-2274.892) (-2268.189) (-2271.973) [-2276.370] -- 0:02:12
709000 -- (-2269.143) [-2264.988] (-2262.787) (-2263.532) * [-2271.544] (-2273.220) (-2258.974) (-2271.151) -- 0:02:11
709500 -- [-2268.079] (-2273.088) (-2260.343) (-2265.592) * (-2271.472) (-2270.532) [-2260.478] (-2272.678) -- 0:02:11
710000 -- (-2276.174) [-2264.916] (-2274.413) (-2264.720) * (-2278.166) (-2263.637) (-2272.497) [-2267.710] -- 0:02:11
Average standard deviation of split frequencies: 0.008126
710500 -- (-2264.532) (-2269.540) [-2261.208] (-2267.430) * [-2259.762] (-2271.550) (-2278.104) (-2270.035) -- 0:02:11
711000 -- [-2263.827] (-2263.729) (-2268.077) (-2282.606) * (-2264.873) [-2263.015] (-2273.764) (-2282.305) -- 0:02:10
711500 -- (-2275.711) (-2265.047) [-2266.535] (-2267.627) * (-2274.685) (-2269.494) [-2263.424] (-2273.344) -- 0:02:10
712000 -- (-2280.718) (-2276.418) [-2263.046] (-2272.940) * [-2268.767] (-2273.236) (-2274.785) (-2261.820) -- 0:02:10
712500 -- (-2268.059) (-2274.829) (-2262.271) [-2266.818] * (-2269.960) (-2269.372) (-2265.622) [-2260.106] -- 0:02:10
713000 -- [-2268.020] (-2264.537) (-2278.510) (-2273.160) * [-2264.447] (-2271.643) (-2264.023) (-2277.239) -- 0:02:10
713500 -- [-2267.062] (-2267.437) (-2278.009) (-2271.713) * (-2264.967) [-2262.232] (-2265.935) (-2274.202) -- 0:02:09
714000 -- (-2270.068) [-2262.296] (-2268.617) (-2273.772) * (-2272.993) (-2264.043) [-2269.705] (-2263.930) -- 0:02:09
714500 -- (-2268.967) (-2275.815) (-2275.693) [-2262.164] * [-2271.310] (-2265.171) (-2275.698) (-2268.829) -- 0:02:09
715000 -- (-2272.553) [-2267.701] (-2261.981) (-2270.317) * [-2263.663] (-2271.267) (-2278.567) (-2265.856) -- 0:02:09
Average standard deviation of split frequencies: 0.008175
715500 -- (-2274.690) (-2270.187) [-2264.441] (-2276.894) * [-2265.509] (-2280.435) (-2265.253) (-2273.900) -- 0:02:08
716000 -- [-2269.509] (-2273.149) (-2269.930) (-2269.842) * (-2269.449) (-2275.909) (-2264.692) [-2268.975] -- 0:02:08
716500 -- (-2265.079) (-2266.743) (-2274.041) [-2268.383] * (-2267.550) (-2265.215) [-2263.857] (-2266.089) -- 0:02:08
717000 -- (-2266.939) (-2277.353) [-2266.794] (-2265.328) * (-2270.279) (-2269.859) [-2262.530] (-2279.941) -- 0:02:08
717500 -- (-2265.390) (-2265.973) (-2274.105) [-2264.560] * [-2274.519] (-2270.677) (-2268.089) (-2277.618) -- 0:02:07
718000 -- [-2264.980] (-2261.440) (-2275.033) (-2267.513) * [-2266.222] (-2269.755) (-2277.770) (-2268.543) -- 0:02:07
718500 -- (-2267.171) (-2263.329) (-2283.716) [-2263.306] * (-2279.307) (-2272.361) [-2259.821] (-2269.372) -- 0:02:07
719000 -- (-2266.312) (-2264.911) (-2281.661) [-2264.944] * (-2264.964) (-2269.835) (-2263.645) [-2274.660] -- 0:02:07
719500 -- [-2268.077] (-2270.111) (-2272.778) (-2263.092) * (-2270.855) (-2270.684) [-2260.537] (-2263.629) -- 0:02:07
720000 -- (-2264.015) [-2267.917] (-2273.353) (-2274.043) * (-2284.140) (-2273.320) [-2263.622] (-2265.323) -- 0:02:06
Average standard deviation of split frequencies: 0.007577
720500 -- (-2266.371) (-2270.885) (-2267.439) [-2268.544] * [-2268.589] (-2271.747) (-2267.523) (-2268.191) -- 0:02:06
721000 -- [-2260.205] (-2273.359) (-2261.121) (-2273.667) * (-2277.203) (-2267.043) [-2262.548] (-2281.665) -- 0:02:06
721500 -- (-2267.335) (-2270.168) [-2259.206] (-2266.341) * (-2271.824) (-2272.097) [-2266.085] (-2262.561) -- 0:02:06
722000 -- (-2267.496) (-2280.360) [-2267.483] (-2266.851) * (-2276.620) (-2270.031) [-2268.258] (-2271.877) -- 0:02:05
722500 -- (-2265.003) (-2270.652) [-2265.917] (-2267.151) * (-2266.508) (-2267.843) (-2281.083) [-2260.883] -- 0:02:05
723000 -- [-2270.705] (-2279.370) (-2279.440) (-2272.017) * (-2262.062) (-2264.254) [-2266.527] (-2274.415) -- 0:02:05
723500 -- [-2264.555] (-2264.255) (-2271.313) (-2275.723) * (-2280.781) (-2264.593) [-2268.367] (-2273.991) -- 0:02:05
724000 -- (-2268.274) (-2267.419) (-2275.337) [-2278.507] * (-2270.094) (-2267.626) [-2270.238] (-2265.907) -- 0:02:05
724500 -- (-2275.949) (-2264.542) (-2270.596) [-2269.038] * [-2271.464] (-2267.046) (-2271.261) (-2272.340) -- 0:02:04
725000 -- (-2271.668) (-2270.753) (-2267.782) [-2270.909] * (-2256.988) (-2263.951) [-2277.757] (-2277.850) -- 0:02:04
Average standard deviation of split frequencies: 0.007251
725500 -- (-2278.343) [-2272.801] (-2270.637) (-2271.463) * [-2265.877] (-2272.575) (-2278.046) (-2284.362) -- 0:02:04
726000 -- (-2266.321) [-2269.482] (-2267.401) (-2271.378) * (-2266.195) (-2269.424) [-2272.707] (-2269.991) -- 0:02:04
726500 -- (-2266.146) [-2269.107] (-2279.747) (-2269.670) * (-2264.782) [-2274.315] (-2279.126) (-2267.681) -- 0:02:03
727000 -- [-2261.059] (-2265.219) (-2281.395) (-2273.825) * (-2259.020) (-2268.981) [-2273.449] (-2273.589) -- 0:02:03
727500 -- [-2265.019] (-2269.200) (-2276.237) (-2264.065) * [-2264.644] (-2267.147) (-2271.753) (-2279.099) -- 0:02:03
728000 -- (-2273.262) (-2273.934) (-2275.690) [-2273.870] * [-2273.145] (-2261.524) (-2263.064) (-2273.596) -- 0:02:03
728500 -- (-2269.196) [-2266.299] (-2267.484) (-2269.273) * (-2270.583) [-2260.511] (-2261.204) (-2272.538) -- 0:02:02
729000 -- [-2270.188] (-2269.648) (-2268.928) (-2272.069) * [-2264.095] (-2264.236) (-2265.227) (-2264.198) -- 0:02:02
729500 -- (-2267.822) (-2265.953) [-2268.734] (-2276.403) * (-2264.486) (-2269.984) (-2271.755) [-2261.816] -- 0:02:02
730000 -- [-2266.071] (-2268.427) (-2265.886) (-2277.955) * (-2268.997) (-2264.890) [-2266.221] (-2266.171) -- 0:02:02
Average standard deviation of split frequencies: 0.007043
730500 -- (-2270.734) (-2266.987) (-2267.925) [-2269.824] * [-2266.942] (-2266.211) (-2272.096) (-2259.588) -- 0:02:02
731000 -- (-2270.354) (-2267.995) (-2267.901) [-2265.016] * (-2263.475) (-2266.244) (-2274.888) [-2266.080] -- 0:02:01
731500 -- (-2263.174) (-2261.073) [-2263.372] (-2267.445) * (-2274.290) (-2264.353) [-2271.351] (-2278.143) -- 0:02:01
732000 -- [-2268.188] (-2273.645) (-2269.997) (-2268.052) * [-2275.560] (-2268.720) (-2257.829) (-2260.422) -- 0:02:01
732500 -- (-2269.898) (-2265.919) (-2281.310) [-2273.159] * (-2275.074) (-2270.828) (-2274.751) [-2267.270] -- 0:02:01
733000 -- (-2271.268) (-2268.343) [-2264.370] (-2272.769) * (-2262.968) (-2268.134) (-2274.644) [-2262.273] -- 0:02:00
733500 -- [-2274.899] (-2275.102) (-2258.923) (-2264.845) * (-2263.317) (-2259.266) (-2281.557) [-2262.190] -- 0:02:00
734000 -- (-2268.710) (-2268.063) (-2265.724) [-2261.768] * [-2263.009] (-2264.456) (-2267.741) (-2268.429) -- 0:02:00
734500 -- (-2269.333) [-2262.253] (-2265.048) (-2273.740) * [-2269.572] (-2265.884) (-2274.529) (-2270.502) -- 0:02:00
735000 -- [-2265.792] (-2269.443) (-2270.753) (-2265.769) * [-2267.976] (-2273.259) (-2275.338) (-2266.588) -- 0:02:00
Average standard deviation of split frequencies: 0.007152
735500 -- (-2276.987) (-2268.039) (-2272.613) [-2269.960] * [-2264.666] (-2267.877) (-2269.376) (-2270.416) -- 0:01:59
736000 -- (-2278.216) (-2264.836) [-2269.714] (-2268.926) * (-2264.512) (-2268.180) [-2263.630] (-2268.808) -- 0:01:59
736500 -- (-2286.041) [-2266.443] (-2270.361) (-2274.055) * [-2274.444] (-2269.169) (-2271.192) (-2276.904) -- 0:01:59
737000 -- (-2271.353) (-2267.232) (-2275.298) [-2262.989] * (-2273.307) [-2271.108] (-2266.824) (-2272.212) -- 0:01:59
737500 -- (-2267.824) [-2261.152] (-2281.295) (-2267.679) * (-2264.980) (-2268.563) (-2260.165) [-2262.447] -- 0:01:58
738000 -- (-2263.647) (-2269.285) (-2271.750) [-2265.455] * (-2272.322) (-2280.365) (-2269.549) [-2263.434] -- 0:01:58
738500 -- [-2264.588] (-2267.368) (-2266.240) (-2266.516) * (-2277.325) (-2263.289) (-2264.148) [-2268.449] -- 0:01:58
739000 -- [-2268.893] (-2268.474) (-2263.481) (-2267.715) * [-2262.912] (-2268.203) (-2264.594) (-2266.008) -- 0:01:58
739500 -- (-2266.736) (-2269.675) [-2264.212] (-2276.607) * (-2275.950) [-2258.590] (-2272.187) (-2267.993) -- 0:01:58
740000 -- (-2267.679) (-2261.323) (-2262.984) [-2268.262] * (-2272.610) [-2268.654] (-2273.997) (-2268.169) -- 0:01:57
Average standard deviation of split frequencies: 0.006577
740500 -- [-2257.629] (-2262.875) (-2279.043) (-2266.557) * (-2261.485) (-2269.080) (-2278.420) [-2266.362] -- 0:01:57
741000 -- [-2270.228] (-2271.408) (-2269.026) (-2278.275) * (-2272.309) [-2264.636] (-2265.827) (-2276.548) -- 0:01:57
741500 -- (-2268.024) (-2269.224) (-2274.886) [-2265.591] * (-2263.198) [-2264.602] (-2269.175) (-2269.827) -- 0:01:57
742000 -- [-2266.669] (-2271.875) (-2274.374) (-2279.468) * (-2267.241) [-2264.878] (-2270.086) (-2263.248) -- 0:01:56
742500 -- (-2266.996) [-2259.032] (-2269.741) (-2266.445) * (-2267.348) (-2272.671) [-2263.843] (-2278.660) -- 0:01:56
743000 -- (-2269.909) [-2266.850] (-2265.047) (-2268.852) * [-2261.575] (-2271.535) (-2269.466) (-2268.419) -- 0:01:56
743500 -- (-2264.364) (-2269.289) [-2269.017] (-2259.805) * [-2277.634] (-2267.182) (-2268.453) (-2259.977) -- 0:01:56
744000 -- (-2259.975) (-2274.897) (-2270.122) [-2272.077] * (-2281.160) [-2270.290] (-2262.228) (-2262.006) -- 0:01:55
744500 -- (-2265.792) [-2272.974] (-2260.775) (-2267.989) * [-2267.558] (-2270.477) (-2267.883) (-2271.940) -- 0:01:55
745000 -- [-2269.136] (-2276.264) (-2266.959) (-2267.672) * [-2261.575] (-2266.094) (-2268.346) (-2264.942) -- 0:01:55
Average standard deviation of split frequencies: 0.006056
745500 -- [-2270.178] (-2271.562) (-2274.445) (-2261.793) * (-2263.283) (-2261.928) [-2264.215] (-2274.392) -- 0:01:55
746000 -- (-2279.356) [-2268.797] (-2271.621) (-2265.805) * (-2268.154) (-2278.431) (-2272.855) [-2261.250] -- 0:01:55
746500 -- (-2277.940) (-2271.066) (-2266.229) [-2262.417] * (-2261.222) (-2278.026) [-2261.354] (-2263.346) -- 0:01:54
747000 -- (-2268.597) (-2274.929) [-2273.091] (-2260.615) * (-2270.199) [-2272.413] (-2275.076) (-2268.561) -- 0:01:54
747500 -- (-2271.136) (-2270.783) (-2272.509) [-2270.467] * (-2269.757) (-2279.015) (-2273.956) [-2276.442] -- 0:01:54
748000 -- (-2270.476) (-2272.140) (-2265.891) [-2270.925] * (-2260.367) (-2273.464) [-2266.262] (-2270.815) -- 0:01:54
748500 -- (-2270.350) (-2277.352) (-2277.241) [-2269.145] * (-2271.372) [-2263.063] (-2275.387) (-2276.569) -- 0:01:53
749000 -- [-2267.893] (-2274.351) (-2271.042) (-2272.191) * [-2266.694] (-2276.589) (-2268.604) (-2269.852) -- 0:01:53
749500 -- (-2278.906) [-2268.183] (-2262.362) (-2265.545) * (-2269.307) [-2260.847] (-2279.153) (-2269.763) -- 0:01:53
750000 -- (-2276.426) (-2271.878) [-2263.549] (-2268.509) * (-2270.253) (-2260.666) (-2268.673) [-2261.798] -- 0:01:53
Average standard deviation of split frequencies: 0.005704
750500 -- (-2265.952) (-2267.473) [-2274.267] (-2268.280) * [-2263.128] (-2270.459) (-2266.774) (-2265.689) -- 0:01:53
751000 -- (-2264.113) (-2270.525) [-2271.885] (-2266.828) * [-2274.288] (-2269.017) (-2274.201) (-2269.860) -- 0:01:52
751500 -- (-2268.748) (-2261.676) [-2268.028] (-2269.874) * [-2265.528] (-2289.157) (-2273.723) (-2278.883) -- 0:01:52
752000 -- (-2271.474) (-2262.682) [-2272.484] (-2268.908) * [-2263.691] (-2269.182) (-2269.577) (-2273.978) -- 0:01:52
752500 -- (-2269.770) (-2267.696) (-2269.533) [-2265.798] * (-2275.942) [-2269.442] (-2275.604) (-2269.154) -- 0:01:52
753000 -- [-2269.581] (-2263.936) (-2278.962) (-2287.954) * (-2269.535) (-2284.473) [-2267.686] (-2276.942) -- 0:01:51
753500 -- (-2275.406) (-2267.351) [-2270.843] (-2285.172) * (-2265.237) (-2269.189) (-2270.276) [-2264.933] -- 0:01:51
754000 -- [-2265.845] (-2261.576) (-2269.613) (-2275.286) * [-2264.834] (-2261.027) (-2276.608) (-2269.397) -- 0:01:51
754500 -- [-2269.084] (-2265.785) (-2277.741) (-2273.081) * [-2266.341] (-2268.505) (-2267.712) (-2277.666) -- 0:01:51
755000 -- (-2261.709) (-2269.524) [-2264.139] (-2272.921) * (-2265.002) (-2277.864) (-2267.200) [-2266.376] -- 0:01:50
Average standard deviation of split frequencies: 0.005820
755500 -- (-2267.927) (-2261.765) (-2266.365) [-2259.130] * [-2268.453] (-2267.910) (-2264.303) (-2266.536) -- 0:01:50
756000 -- (-2273.552) (-2271.352) [-2264.381] (-2268.821) * (-2267.740) (-2262.919) [-2270.742] (-2268.110) -- 0:01:50
756500 -- (-2275.363) (-2261.478) [-2262.456] (-2267.388) * (-2260.845) [-2265.145] (-2266.156) (-2279.111) -- 0:01:50
757000 -- (-2273.761) (-2265.202) [-2268.814] (-2268.993) * [-2270.808] (-2273.740) (-2265.729) (-2267.679) -- 0:01:50
757500 -- (-2264.702) [-2263.451] (-2273.444) (-2264.115) * (-2277.195) (-2264.621) [-2270.030] (-2275.571) -- 0:01:49
758000 -- (-2273.562) [-2266.960] (-2271.098) (-2274.829) * (-2266.532) [-2266.447] (-2271.803) (-2261.316) -- 0:01:49
758500 -- (-2273.437) (-2271.470) (-2272.890) [-2276.006] * (-2269.309) (-2265.521) (-2276.038) [-2261.213] -- 0:01:49
759000 -- (-2271.417) (-2266.358) (-2280.357) [-2266.368] * (-2281.350) (-2267.752) (-2267.374) [-2263.692] -- 0:01:49
759500 -- (-2277.218) (-2281.515) [-2265.255] (-2275.402) * (-2273.015) (-2269.576) [-2266.448] (-2274.369) -- 0:01:48
760000 -- (-2270.776) (-2274.431) [-2270.807] (-2284.406) * (-2262.514) (-2273.215) [-2264.648] (-2269.834) -- 0:01:48
Average standard deviation of split frequencies: 0.005629
760500 -- (-2269.149) [-2263.038] (-2263.821) (-2281.588) * (-2279.024) [-2268.956] (-2264.009) (-2267.150) -- 0:01:48
761000 -- (-2261.883) [-2265.251] (-2276.456) (-2268.065) * (-2268.772) (-2269.915) [-2266.162] (-2271.803) -- 0:01:48
761500 -- [-2267.171] (-2271.887) (-2281.135) (-2264.256) * (-2274.133) (-2269.352) (-2267.753) [-2264.649] -- 0:01:48
762000 -- (-2275.119) (-2274.507) (-2287.811) [-2268.089] * (-2266.529) (-2265.574) [-2268.865] (-2276.820) -- 0:01:47
762500 -- (-2267.134) [-2282.324] (-2276.136) (-2269.541) * (-2278.237) (-2272.105) (-2274.514) [-2261.697] -- 0:01:47
763000 -- (-2282.188) [-2264.725] (-2274.924) (-2269.253) * (-2278.021) [-2262.084] (-2269.725) (-2266.383) -- 0:01:47
763500 -- (-2262.760) (-2264.321) (-2274.219) [-2270.685] * (-2269.506) (-2268.354) (-2271.932) [-2262.977] -- 0:01:47
764000 -- (-2262.490) (-2271.646) [-2274.293] (-2263.080) * (-2269.983) (-2270.151) [-2268.974] (-2270.601) -- 0:01:46
764500 -- (-2267.131) (-2270.786) (-2279.915) [-2266.136] * (-2265.435) (-2268.254) [-2266.409] (-2263.441) -- 0:01:46
765000 -- (-2269.085) [-2262.214] (-2280.582) (-2267.515) * (-2268.557) [-2264.695] (-2267.196) (-2260.987) -- 0:01:46
Average standard deviation of split frequencies: 0.005898
765500 -- [-2267.089] (-2266.084) (-2278.826) (-2269.378) * (-2263.048) [-2260.031] (-2277.044) (-2273.328) -- 0:01:46
766000 -- [-2267.776] (-2270.931) (-2270.298) (-2270.525) * (-2271.741) [-2263.286] (-2266.605) (-2279.530) -- 0:01:46
766500 -- [-2270.265] (-2271.618) (-2272.598) (-2263.841) * (-2261.736) [-2262.572] (-2266.624) (-2263.275) -- 0:01:45
767000 -- (-2271.492) [-2267.184] (-2267.450) (-2275.513) * (-2272.400) [-2261.525] (-2261.019) (-2271.586) -- 0:01:45
767500 -- (-2265.705) (-2268.760) [-2269.308] (-2281.286) * (-2272.539) [-2259.520] (-2265.825) (-2266.588) -- 0:01:45
768000 -- (-2263.503) (-2267.614) [-2263.930] (-2267.772) * [-2270.399] (-2282.112) (-2266.109) (-2271.654) -- 0:01:45
768500 -- (-2260.253) (-2267.708) (-2266.390) [-2262.625] * [-2266.573] (-2267.518) (-2264.558) (-2271.537) -- 0:01:44
769000 -- (-2267.612) [-2270.675] (-2273.219) (-2269.400) * (-2270.019) (-2275.645) (-2270.885) [-2267.757] -- 0:01:44
769500 -- [-2262.576] (-2260.131) (-2264.059) (-2267.243) * [-2265.802] (-2266.119) (-2272.763) (-2279.018) -- 0:01:44
770000 -- [-2261.639] (-2266.550) (-2270.089) (-2269.915) * [-2276.221] (-2282.195) (-2265.315) (-2278.259) -- 0:01:44
Average standard deviation of split frequencies: 0.005862
770500 -- (-2272.240) [-2264.972] (-2266.013) (-2277.173) * (-2268.640) (-2269.133) (-2265.556) [-2261.816] -- 0:01:43
771000 -- (-2263.986) (-2274.075) [-2270.740] (-2272.974) * (-2267.598) (-2274.545) (-2263.073) [-2264.741] -- 0:01:43
771500 -- (-2272.614) (-2277.698) (-2264.705) [-2270.114] * (-2264.323) (-2271.887) (-2273.310) [-2268.943] -- 0:01:43
772000 -- [-2258.335] (-2274.578) (-2268.143) (-2265.738) * [-2263.460] (-2267.129) (-2266.545) (-2268.848) -- 0:01:43
772500 -- (-2273.387) (-2268.213) [-2266.315] (-2266.495) * (-2267.426) [-2273.422] (-2274.473) (-2288.795) -- 0:01:43
773000 -- (-2268.719) (-2268.573) (-2263.914) [-2267.533] * (-2271.389) (-2262.806) [-2270.411] (-2281.334) -- 0:01:43
773500 -- (-2265.039) [-2269.011] (-2281.290) (-2266.941) * (-2270.599) (-2267.096) (-2264.334) [-2261.515] -- 0:01:42
774000 -- [-2271.676] (-2266.799) (-2274.297) (-2258.639) * (-2262.153) (-2277.568) [-2273.271] (-2264.364) -- 0:01:42
774500 -- (-2271.024) (-2267.324) (-2274.418) [-2261.724] * [-2271.659] (-2272.600) (-2264.165) (-2268.194) -- 0:01:42
775000 -- (-2260.399) (-2265.716) [-2266.621] (-2264.526) * (-2279.949) (-2275.483) (-2268.970) [-2266.484] -- 0:01:41
Average standard deviation of split frequencies: 0.006176
775500 -- (-2282.584) [-2268.874] (-2271.534) (-2264.579) * [-2263.503] (-2272.739) (-2266.704) (-2260.019) -- 0:01:41
776000 -- (-2271.167) (-2266.091) (-2272.648) [-2258.636] * (-2259.859) (-2265.805) (-2263.623) [-2267.273] -- 0:01:41
776500 -- (-2280.865) [-2266.414] (-2268.139) (-2266.414) * (-2269.675) (-2266.174) [-2272.919] (-2268.177) -- 0:01:41
777000 -- (-2272.020) (-2269.842) (-2263.786) [-2282.183] * (-2272.186) [-2270.131] (-2265.036) (-2265.516) -- 0:01:41
777500 -- (-2266.081) (-2282.981) (-2269.269) [-2272.901] * (-2272.561) (-2277.675) (-2265.457) [-2259.840] -- 0:01:41
778000 -- [-2264.819] (-2275.713) (-2270.701) (-2269.735) * (-2265.871) (-2269.375) [-2268.803] (-2268.087) -- 0:01:40
778500 -- [-2264.813] (-2271.028) (-2269.104) (-2270.322) * [-2262.440] (-2262.187) (-2268.216) (-2275.589) -- 0:01:40
779000 -- [-2261.862] (-2264.185) (-2271.508) (-2267.882) * (-2263.886) (-2268.378) [-2267.665] (-2265.962) -- 0:01:40
779500 -- [-2263.689] (-2277.043) (-2278.132) (-2275.611) * (-2273.375) (-2271.983) [-2263.111] (-2271.431) -- 0:01:40
780000 -- (-2259.977) (-2281.749) (-2270.140) [-2262.309] * [-2269.895] (-2275.314) (-2264.821) (-2270.328) -- 0:01:39
Average standard deviation of split frequencies: 0.005837
780500 -- (-2265.517) [-2265.476] (-2274.245) (-2273.963) * (-2267.535) (-2270.900) [-2261.066] (-2265.413) -- 0:01:39
781000 -- (-2263.354) (-2269.832) (-2283.620) [-2267.005] * (-2272.352) [-2267.207] (-2267.771) (-2272.936) -- 0:01:39
781500 -- [-2273.065] (-2270.320) (-2267.065) (-2270.428) * (-2270.581) (-2265.730) [-2262.773] (-2274.309) -- 0:01:38
782000 -- [-2263.900] (-2263.361) (-2260.741) (-2267.334) * (-2265.396) [-2268.933] (-2266.001) (-2271.463) -- 0:01:38
782500 -- (-2266.495) [-2266.418] (-2259.132) (-2263.937) * (-2275.169) (-2263.327) (-2264.163) [-2259.012] -- 0:01:38
783000 -- (-2278.473) (-2270.654) (-2269.503) [-2268.747] * (-2269.765) (-2268.420) (-2264.532) [-2267.394] -- 0:01:38
783500 -- (-2273.285) [-2261.909] (-2265.718) (-2270.100) * (-2276.928) (-2273.634) (-2272.052) [-2274.527] -- 0:01:38
784000 -- (-2270.804) (-2265.965) (-2266.854) [-2276.931] * (-2272.566) (-2269.010) [-2284.649] (-2263.539) -- 0:01:38
784500 -- (-2265.511) [-2263.047] (-2267.933) (-2271.121) * [-2268.306] (-2273.674) (-2267.548) (-2265.731) -- 0:01:37
785000 -- (-2271.529) [-2269.157] (-2277.683) (-2267.187) * (-2270.202) (-2269.370) (-2261.361) [-2269.085] -- 0:01:37
Average standard deviation of split frequencies: 0.005848
785500 -- [-2268.109] (-2269.218) (-2263.721) (-2267.516) * (-2260.234) [-2270.831] (-2277.046) (-2270.954) -- 0:01:37
786000 -- [-2271.867] (-2274.322) (-2264.263) (-2276.879) * (-2267.936) (-2269.390) (-2270.131) [-2277.006] -- 0:01:37
786500 -- [-2266.533] (-2263.360) (-2270.124) (-2276.567) * (-2265.460) (-2265.410) (-2264.760) [-2274.588] -- 0:01:36
787000 -- (-2280.308) (-2278.797) [-2267.409] (-2276.549) * (-2270.710) (-2267.571) (-2263.966) [-2263.607] -- 0:01:36
787500 -- (-2260.399) (-2271.475) [-2263.641] (-2280.372) * (-2266.704) (-2266.888) [-2261.504] (-2275.639) -- 0:01:36
788000 -- (-2264.630) (-2265.544) [-2265.029] (-2263.010) * (-2265.925) (-2266.621) [-2264.131] (-2266.108) -- 0:01:36
788500 -- [-2261.180] (-2268.758) (-2269.190) (-2267.694) * (-2269.338) (-2278.060) (-2274.278) [-2265.930] -- 0:01:36
789000 -- (-2274.067) [-2262.000] (-2276.000) (-2274.883) * [-2262.917] (-2263.547) (-2267.856) (-2266.633) -- 0:01:35
789500 -- (-2274.709) (-2268.626) [-2266.734] (-2262.617) * (-2265.139) [-2263.903] (-2269.128) (-2271.719) -- 0:01:35
790000 -- (-2273.077) (-2263.747) [-2269.058] (-2269.275) * (-2267.948) (-2273.975) [-2266.330] (-2265.821) -- 0:01:35
Average standard deviation of split frequencies: 0.006012
790500 -- (-2275.057) [-2268.738] (-2267.661) (-2266.977) * [-2263.596] (-2272.337) (-2265.752) (-2273.170) -- 0:01:35
791000 -- [-2260.441] (-2273.549) (-2274.977) (-2262.944) * (-2270.132) (-2272.893) (-2273.839) [-2267.540] -- 0:01:34
791500 -- [-2263.619] (-2273.306) (-2267.844) (-2265.803) * (-2270.532) [-2263.930] (-2265.574) (-2264.719) -- 0:01:34
792000 -- [-2267.993] (-2266.231) (-2274.894) (-2273.254) * [-2266.071] (-2266.715) (-2267.488) (-2276.066) -- 0:01:34
792500 -- (-2269.939) (-2265.656) (-2280.171) [-2270.067] * [-2266.688] (-2264.953) (-2269.939) (-2275.688) -- 0:01:33
793000 -- [-2267.211] (-2261.103) (-2285.746) (-2276.832) * (-2263.378) [-2263.359] (-2271.076) (-2270.355) -- 0:01:33
793500 -- [-2264.002] (-2262.772) (-2271.045) (-2271.117) * (-2272.495) (-2259.976) (-2268.935) [-2269.096] -- 0:01:33
794000 -- [-2272.129] (-2266.016) (-2264.423) (-2276.021) * (-2267.329) (-2267.491) [-2270.856] (-2275.855) -- 0:01:33
794500 -- (-2281.665) [-2269.101] (-2266.139) (-2268.449) * (-2264.315) (-2276.087) [-2263.816] (-2275.780) -- 0:01:33
795000 -- (-2264.863) [-2261.430] (-2267.936) (-2265.942) * [-2262.530] (-2276.792) (-2262.569) (-2271.113) -- 0:01:33
Average standard deviation of split frequencies: 0.005675
795500 -- [-2267.321] (-2263.038) (-2280.968) (-2282.367) * (-2266.766) [-2276.290] (-2266.804) (-2273.834) -- 0:01:32
796000 -- (-2267.866) (-2262.968) (-2261.954) [-2266.372] * (-2266.342) (-2275.952) (-2269.770) [-2268.035] -- 0:01:32
796500 -- (-2266.725) (-2264.903) [-2259.434] (-2271.362) * [-2267.243] (-2269.453) (-2267.539) (-2265.664) -- 0:01:32
797000 -- (-2265.413) [-2276.339] (-2264.294) (-2269.605) * (-2278.204) (-2268.209) (-2269.620) [-2259.555] -- 0:01:32
797500 -- (-2273.445) (-2274.983) (-2274.125) [-2264.511] * (-2271.186) (-2283.434) [-2264.800] (-2261.727) -- 0:01:31
798000 -- (-2271.780) (-2282.958) (-2285.018) [-2262.891] * (-2272.115) (-2272.684) (-2271.193) [-2266.310] -- 0:01:31
798500 -- [-2265.106] (-2268.740) (-2274.309) (-2266.661) * [-2266.191] (-2267.928) (-2265.644) (-2262.848) -- 0:01:31
799000 -- (-2268.732) (-2269.132) (-2264.608) [-2266.184] * (-2265.625) (-2271.857) [-2262.442] (-2268.737) -- 0:01:31
799500 -- (-2262.959) (-2273.379) [-2264.349] (-2264.997) * (-2267.102) [-2270.148] (-2263.791) (-2264.550) -- 0:01:31
800000 -- (-2268.072) (-2271.746) (-2275.533) [-2265.429] * (-2267.323) [-2260.040] (-2264.786) (-2274.350) -- 0:01:30
Average standard deviation of split frequencies: 0.005839
800500 -- (-2277.064) (-2275.094) [-2267.480] (-2267.305) * [-2271.641] (-2271.166) (-2270.156) (-2264.241) -- 0:01:30
801000 -- [-2263.275] (-2271.622) (-2268.215) (-2273.013) * [-2273.140] (-2272.914) (-2274.338) (-2275.721) -- 0:01:30
801500 -- (-2268.198) (-2270.666) [-2265.171] (-2267.411) * (-2264.896) (-2264.484) (-2271.161) [-2262.408] -- 0:01:30
802000 -- (-2266.147) (-2271.060) [-2267.723] (-2267.195) * (-2266.687) [-2260.844] (-2271.919) (-2262.033) -- 0:01:29
802500 -- (-2262.013) (-2264.592) [-2262.563] (-2262.956) * (-2267.803) (-2271.541) (-2265.789) [-2268.092] -- 0:01:29
803000 -- (-2261.610) [-2265.822] (-2271.908) (-2264.818) * [-2274.648] (-2264.840) (-2268.241) (-2265.288) -- 0:01:29
803500 -- (-2268.463) [-2263.180] (-2269.908) (-2263.136) * (-2274.647) (-2273.442) [-2266.959] (-2266.933) -- 0:01:29
804000 -- [-2266.389] (-2262.434) (-2275.561) (-2277.157) * [-2263.663] (-2282.705) (-2260.914) (-2277.025) -- 0:01:28
804500 -- [-2268.667] (-2260.900) (-2264.991) (-2273.515) * (-2273.610) (-2272.121) [-2270.501] (-2267.361) -- 0:01:28
805000 -- [-2266.941] (-2264.415) (-2266.610) (-2268.024) * [-2282.012] (-2264.546) (-2271.899) (-2262.612) -- 0:01:28
Average standard deviation of split frequencies: 0.005264
805500 -- (-2265.237) [-2259.986] (-2264.125) (-2269.530) * (-2272.589) [-2267.217] (-2268.496) (-2271.487) -- 0:01:28
806000 -- (-2272.796) (-2269.231) (-2270.477) [-2268.162] * (-2272.115) [-2265.590] (-2269.086) (-2273.059) -- 0:01:28
806500 -- [-2267.113] (-2273.162) (-2264.864) (-2269.265) * [-2268.761] (-2282.252) (-2266.184) (-2268.615) -- 0:01:27
807000 -- (-2265.065) (-2274.096) (-2279.638) [-2265.675] * (-2267.776) (-2276.314) (-2262.757) [-2268.972] -- 0:01:27
807500 -- (-2262.734) (-2274.063) [-2266.787] (-2280.021) * (-2267.041) [-2264.173] (-2274.193) (-2270.597) -- 0:01:27
808000 -- (-2263.282) [-2268.209] (-2260.679) (-2277.009) * (-2270.239) (-2268.127) (-2272.178) [-2259.318] -- 0:01:27
808500 -- (-2272.984) (-2264.402) [-2265.195] (-2269.045) * [-2260.208] (-2267.504) (-2273.990) (-2270.861) -- 0:01:26
809000 -- (-2279.345) (-2261.530) [-2264.663] (-2279.145) * (-2262.995) [-2266.061] (-2264.942) (-2262.505) -- 0:01:26
809500 -- (-2267.344) [-2263.297] (-2265.165) (-2268.763) * [-2270.621] (-2274.168) (-2261.487) (-2271.576) -- 0:01:26
810000 -- [-2262.568] (-2269.100) (-2267.693) (-2273.725) * (-2270.604) [-2261.274] (-2273.708) (-2275.273) -- 0:01:26
Average standard deviation of split frequencies: 0.005863
810500 -- [-2264.324] (-2262.735) (-2266.269) (-2268.878) * (-2271.107) (-2270.356) [-2267.951] (-2278.116) -- 0:01:26
811000 -- (-2272.836) (-2262.431) [-2266.924] (-2267.956) * (-2265.783) (-2275.310) [-2262.439] (-2271.062) -- 0:01:25
811500 -- (-2275.564) (-2281.279) (-2264.383) [-2270.065] * (-2272.252) [-2263.853] (-2266.706) (-2280.078) -- 0:01:25
812000 -- (-2279.337) (-2271.606) (-2263.207) [-2262.201] * (-2281.678) (-2267.604) (-2264.649) [-2270.080] -- 0:01:25
812500 -- (-2282.241) (-2267.641) (-2263.420) [-2262.791] * (-2270.374) [-2266.843] (-2271.980) (-2276.323) -- 0:01:25
813000 -- (-2268.527) (-2269.522) (-2268.835) [-2261.966] * (-2267.260) (-2267.843) [-2267.910] (-2267.766) -- 0:01:24
813500 -- (-2268.707) [-2267.865] (-2267.634) (-2273.512) * [-2268.277] (-2267.178) (-2275.653) (-2268.479) -- 0:01:24
814000 -- [-2266.357] (-2266.275) (-2275.967) (-2269.948) * (-2270.385) [-2269.440] (-2267.404) (-2275.429) -- 0:01:24
814500 -- (-2270.050) [-2269.065] (-2267.418) (-2265.838) * [-2269.138] (-2268.030) (-2281.142) (-2274.712) -- 0:01:24
815000 -- (-2280.537) (-2278.303) [-2259.507] (-2273.317) * [-2273.818] (-2267.778) (-2273.554) (-2260.453) -- 0:01:23
Average standard deviation of split frequencies: 0.006210
815500 -- [-2272.253] (-2268.781) (-2259.883) (-2267.338) * (-2269.458) [-2277.702] (-2274.966) (-2276.996) -- 0:01:23
816000 -- [-2269.780] (-2272.697) (-2271.653) (-2270.794) * (-2263.287) [-2278.909] (-2281.994) (-2269.635) -- 0:01:23
816500 -- (-2276.989) (-2266.732) (-2265.418) [-2269.383] * (-2280.832) (-2271.494) (-2267.202) [-2261.338] -- 0:01:23
817000 -- (-2270.539) (-2266.579) [-2278.824] (-2270.194) * (-2263.941) [-2261.131] (-2271.772) (-2261.257) -- 0:01:23
817500 -- (-2263.868) [-2268.262] (-2272.621) (-2263.442) * (-2268.816) (-2266.404) [-2263.920] (-2269.633) -- 0:01:22
818000 -- (-2272.045) (-2265.315) (-2259.531) [-2264.263] * [-2265.974] (-2267.013) (-2267.532) (-2271.840) -- 0:01:22
818500 -- [-2259.215] (-2267.462) (-2264.743) (-2266.311) * [-2261.949] (-2268.488) (-2264.729) (-2279.251) -- 0:01:22
819000 -- (-2262.896) [-2268.185] (-2269.357) (-2262.004) * (-2267.004) [-2267.424] (-2265.870) (-2272.359) -- 0:01:22
819500 -- [-2269.987] (-2272.288) (-2281.152) (-2263.297) * (-2267.383) [-2261.821] (-2263.892) (-2266.591) -- 0:01:21
820000 -- (-2272.614) [-2277.722] (-2277.353) (-2262.906) * (-2271.746) (-2269.493) (-2270.153) [-2270.071] -- 0:01:21
Average standard deviation of split frequencies: 0.005888
820500 -- (-2270.303) (-2264.019) [-2277.935] (-2264.212) * (-2276.341) [-2260.196] (-2265.014) (-2266.691) -- 0:01:21
821000 -- [-2265.710] (-2263.863) (-2272.074) (-2269.113) * (-2280.984) [-2260.302] (-2269.176) (-2273.620) -- 0:01:21
821500 -- (-2283.047) [-2267.153] (-2269.952) (-2278.540) * [-2268.930] (-2268.296) (-2263.822) (-2269.865) -- 0:01:21
822000 -- (-2276.910) (-2263.175) [-2262.911] (-2262.422) * [-2265.765] (-2269.078) (-2262.996) (-2267.434) -- 0:01:20
822500 -- (-2264.759) (-2260.687) [-2261.247] (-2269.272) * (-2268.115) (-2262.265) [-2270.245] (-2264.949) -- 0:01:20
823000 -- (-2266.548) (-2269.601) [-2263.400] (-2267.785) * (-2264.669) (-2268.757) (-2267.312) [-2264.293] -- 0:01:20
823500 -- (-2263.507) [-2264.836] (-2269.441) (-2275.084) * [-2269.312] (-2261.536) (-2274.553) (-2261.438) -- 0:01:20
824000 -- (-2280.426) [-2262.514] (-2265.989) (-2272.378) * (-2272.235) (-2266.073) [-2266.297] (-2272.038) -- 0:01:19
824500 -- (-2266.048) (-2273.966) (-2263.926) [-2278.891] * (-2262.890) (-2273.285) (-2268.938) [-2265.859] -- 0:01:19
825000 -- (-2265.443) (-2262.537) [-2265.512] (-2269.268) * [-2266.534] (-2270.665) (-2275.775) (-2272.954) -- 0:01:19
Average standard deviation of split frequencies: 0.005517
825500 -- (-2266.167) (-2277.240) (-2264.753) [-2261.793] * (-2262.099) [-2266.940] (-2268.735) (-2267.533) -- 0:01:19
826000 -- (-2268.552) (-2276.328) [-2272.714] (-2263.642) * (-2271.269) (-2262.293) (-2270.451) [-2265.141] -- 0:01:18
826500 -- [-2271.318] (-2267.040) (-2266.883) (-2272.867) * (-2266.134) [-2262.464] (-2264.485) (-2278.502) -- 0:01:18
827000 -- (-2271.632) (-2268.566) (-2271.889) [-2263.517] * (-2263.632) [-2260.759] (-2260.093) (-2272.306) -- 0:01:18
827500 -- (-2271.814) (-2262.419) [-2265.922] (-2279.152) * (-2284.436) (-2265.455) [-2266.608] (-2267.342) -- 0:01:18
828000 -- (-2266.558) (-2271.003) [-2265.690] (-2269.489) * [-2266.548] (-2277.911) (-2265.580) (-2271.963) -- 0:01:18
828500 -- (-2260.531) [-2262.977] (-2275.006) (-2269.015) * (-2277.407) [-2272.788] (-2262.796) (-2268.618) -- 0:01:17
829000 -- [-2269.106] (-2265.076) (-2268.040) (-2273.939) * (-2268.603) [-2270.161] (-2267.708) (-2279.178) -- 0:01:17
829500 -- [-2269.240] (-2275.322) (-2280.005) (-2264.876) * (-2269.538) (-2267.770) (-2260.477) [-2269.889] -- 0:01:17
830000 -- (-2274.138) (-2265.309) [-2264.887] (-2264.757) * (-2270.961) (-2267.411) (-2269.292) [-2266.937] -- 0:01:17
Average standard deviation of split frequencies: 0.005155
830500 -- [-2264.363] (-2268.301) (-2267.502) (-2261.450) * [-2265.255] (-2274.105) (-2270.503) (-2267.701) -- 0:01:16
831000 -- (-2268.685) [-2263.069] (-2274.325) (-2270.915) * (-2263.046) [-2275.877] (-2268.982) (-2263.518) -- 0:01:16
831500 -- (-2269.214) [-2264.713] (-2270.986) (-2273.506) * [-2270.205] (-2275.290) (-2271.038) (-2261.847) -- 0:01:16
832000 -- (-2274.921) [-2264.494] (-2267.738) (-2269.192) * (-2271.980) (-2275.253) (-2261.149) [-2263.924] -- 0:01:16
832500 -- (-2261.000) [-2268.690] (-2266.218) (-2261.900) * (-2275.185) (-2272.509) [-2266.556] (-2258.733) -- 0:01:16
833000 -- (-2272.980) [-2261.034] (-2272.687) (-2271.611) * (-2275.245) (-2263.976) (-2269.244) [-2258.795] -- 0:01:15
833500 -- (-2264.976) (-2266.532) (-2265.917) [-2263.342] * (-2288.178) (-2267.593) (-2270.441) [-2257.659] -- 0:01:15
834000 -- (-2260.115) (-2269.768) [-2269.662] (-2267.893) * (-2272.844) (-2268.642) [-2266.486] (-2265.605) -- 0:01:15
834500 -- [-2262.922] (-2268.323) (-2261.727) (-2263.055) * (-2270.733) [-2259.885] (-2257.959) (-2270.873) -- 0:01:15
835000 -- (-2261.418) [-2268.767] (-2271.970) (-2257.188) * [-2278.205] (-2271.322) (-2267.406) (-2275.525) -- 0:01:14
Average standard deviation of split frequencies: 0.005545
835500 -- (-2258.609) [-2259.783] (-2270.356) (-2265.806) * (-2268.440) (-2264.290) (-2272.373) [-2277.575] -- 0:01:14
836000 -- (-2262.155) (-2265.139) (-2262.933) [-2269.163] * (-2266.396) (-2276.154) [-2260.373] (-2276.661) -- 0:01:14
836500 -- (-2265.419) (-2268.705) [-2268.274] (-2277.884) * (-2263.931) (-2267.237) [-2265.247] (-2273.091) -- 0:01:14
837000 -- [-2264.275] (-2265.258) (-2271.925) (-2270.558) * (-2271.833) (-2270.723) [-2260.351] (-2265.143) -- 0:01:14
837500 -- [-2267.390] (-2266.216) (-2269.745) (-2279.643) * (-2268.228) (-2269.529) [-2257.394] (-2268.672) -- 0:01:13
838000 -- [-2262.533] (-2272.350) (-2265.359) (-2267.776) * (-2276.947) (-2266.124) (-2270.927) [-2263.107] -- 0:01:13
838500 -- (-2277.532) (-2268.109) (-2264.654) [-2260.468] * (-2269.468) (-2270.406) (-2262.677) [-2267.019] -- 0:01:13
839000 -- (-2279.229) (-2268.345) (-2262.706) [-2264.957] * (-2273.134) (-2269.449) (-2274.010) [-2267.120] -- 0:01:13
839500 -- (-2276.323) (-2263.843) [-2270.109] (-2265.936) * (-2270.798) [-2263.975] (-2266.948) (-2272.074) -- 0:01:12
840000 -- [-2274.427] (-2272.871) (-2270.357) (-2267.615) * (-2272.520) (-2265.692) (-2269.324) [-2263.553] -- 0:01:12
Average standard deviation of split frequencies: 0.005467
840500 -- (-2264.387) [-2261.751] (-2271.871) (-2263.336) * (-2272.607) (-2265.188) [-2270.628] (-2269.069) -- 0:01:12
841000 -- (-2267.357) (-2260.871) (-2263.752) [-2261.183] * (-2273.000) (-2274.947) (-2264.518) [-2267.324] -- 0:01:12
841500 -- (-2276.347) (-2265.602) [-2272.759] (-2268.081) * (-2270.658) [-2262.053] (-2269.424) (-2275.298) -- 0:01:11
842000 -- (-2264.340) (-2267.149) (-2266.909) [-2264.479] * (-2273.411) (-2267.218) [-2266.559] (-2270.711) -- 0:01:11
842500 -- (-2271.537) [-2271.555] (-2265.891) (-2267.176) * (-2270.359) (-2265.780) [-2258.893] (-2268.250) -- 0:01:11
843000 -- (-2263.940) (-2272.310) [-2273.255] (-2270.611) * (-2281.154) [-2273.747] (-2266.578) (-2268.250) -- 0:01:11
843500 -- (-2268.069) (-2275.668) [-2260.322] (-2271.817) * (-2269.587) [-2263.896] (-2267.311) (-2268.782) -- 0:01:11
844000 -- (-2264.439) [-2266.056] (-2264.092) (-2264.388) * (-2259.254) (-2268.211) [-2272.078] (-2267.213) -- 0:01:10
844500 -- [-2264.120] (-2264.868) (-2267.914) (-2259.855) * [-2269.228] (-2268.860) (-2274.906) (-2268.303) -- 0:01:10
845000 -- (-2270.288) (-2267.702) (-2277.904) [-2267.482] * (-2272.876) (-2262.396) (-2274.117) [-2261.524] -- 0:01:10
Average standard deviation of split frequencies: 0.005758
845500 -- (-2274.801) [-2269.264] (-2265.294) (-2273.888) * (-2267.784) [-2269.516] (-2280.925) (-2269.138) -- 0:01:10
846000 -- [-2265.876] (-2272.786) (-2270.238) (-2262.347) * (-2264.945) (-2281.118) [-2267.098] (-2270.664) -- 0:01:09
846500 -- [-2261.248] (-2269.474) (-2268.650) (-2270.671) * [-2264.967] (-2272.282) (-2270.653) (-2263.870) -- 0:01:09
847000 -- (-2267.783) (-2268.122) (-2271.410) [-2268.973] * (-2266.036) (-2271.176) (-2267.540) [-2266.791] -- 0:01:09
847500 -- (-2274.091) (-2262.689) [-2266.077] (-2272.774) * (-2273.146) (-2263.409) [-2264.585] (-2264.473) -- 0:01:09
848000 -- (-2274.072) (-2267.628) [-2261.560] (-2275.201) * (-2274.666) (-2269.360) (-2273.882) [-2264.949] -- 0:01:09
848500 -- [-2263.229] (-2272.913) (-2263.747) (-2263.725) * [-2271.584] (-2269.950) (-2266.605) (-2264.715) -- 0:01:08
849000 -- (-2263.054) (-2270.321) [-2262.888] (-2279.133) * (-2275.822) (-2266.469) (-2265.403) [-2264.953] -- 0:01:08
849500 -- (-2265.111) [-2263.538] (-2270.575) (-2272.980) * (-2268.010) (-2274.637) [-2262.705] (-2261.607) -- 0:01:08
850000 -- (-2269.164) (-2266.890) (-2264.925) [-2262.689] * (-2266.971) (-2273.579) (-2270.771) [-2272.521] -- 0:01:08
Average standard deviation of split frequencies: 0.005819
850500 -- (-2265.681) [-2265.807] (-2288.542) (-2269.901) * [-2262.993] (-2279.998) (-2273.741) (-2280.621) -- 0:01:07
851000 -- (-2261.797) [-2260.267] (-2282.747) (-2271.132) * [-2260.009] (-2276.280) (-2272.235) (-2261.791) -- 0:01:07
851500 -- [-2266.404] (-2276.138) (-2283.903) (-2275.647) * (-2263.058) [-2265.422] (-2278.884) (-2272.811) -- 0:01:07
852000 -- [-2267.140] (-2264.803) (-2282.231) (-2272.272) * (-2268.735) [-2274.412] (-2265.287) (-2268.539) -- 0:01:07
852500 -- (-2268.915) (-2269.258) (-2275.270) [-2263.037] * (-2262.680) (-2261.979) (-2268.610) [-2268.672] -- 0:01:06
853000 -- (-2282.472) [-2274.752] (-2280.064) (-2271.774) * (-2269.654) (-2268.903) [-2260.423] (-2266.254) -- 0:01:06
853500 -- (-2275.918) (-2270.877) (-2263.761) [-2263.166] * (-2271.807) (-2261.946) (-2270.167) [-2268.557] -- 0:01:06
854000 -- (-2269.441) [-2266.273] (-2264.872) (-2271.656) * (-2274.171) (-2265.602) [-2273.469] (-2270.662) -- 0:01:06
854500 -- (-2266.636) [-2272.930] (-2269.317) (-2277.721) * (-2262.211) [-2265.984] (-2278.419) (-2270.706) -- 0:01:06
855000 -- [-2258.878] (-2263.504) (-2267.778) (-2282.316) * (-2270.278) [-2260.271] (-2273.823) (-2261.798) -- 0:01:05
Average standard deviation of split frequencies: 0.005599
855500 -- (-2269.151) (-2261.618) [-2261.502] (-2288.707) * [-2260.396] (-2272.757) (-2260.225) (-2267.812) -- 0:01:05
856000 -- (-2264.773) (-2262.971) [-2268.436] (-2266.562) * (-2265.265) (-2269.359) (-2266.156) [-2261.998] -- 0:01:05
856500 -- (-2268.223) (-2270.858) [-2266.708] (-2271.769) * [-2263.226] (-2262.086) (-2276.733) (-2270.439) -- 0:01:05
857000 -- (-2261.222) (-2271.496) (-2277.908) [-2262.140] * (-2269.674) [-2261.934] (-2268.231) (-2264.412) -- 0:01:04
857500 -- (-2277.464) (-2265.925) [-2267.297] (-2267.423) * [-2265.295] (-2270.632) (-2272.270) (-2261.994) -- 0:01:04
858000 -- (-2273.501) [-2264.416] (-2264.687) (-2268.596) * (-2261.890) (-2274.903) (-2265.439) [-2263.535] -- 0:01:04
858500 -- (-2266.388) (-2267.316) [-2259.722] (-2263.181) * (-2269.251) [-2273.394] (-2259.853) (-2265.006) -- 0:01:04
859000 -- [-2265.231] (-2279.510) (-2272.374) (-2264.831) * [-2269.130] (-2269.329) (-2278.374) (-2259.623) -- 0:01:04
859500 -- (-2269.417) [-2260.446] (-2266.441) (-2262.546) * (-2265.338) [-2270.985] (-2278.451) (-2276.570) -- 0:01:03
860000 -- (-2268.658) [-2261.059] (-2266.204) (-2265.992) * (-2271.494) (-2262.585) (-2266.585) [-2264.182] -- 0:01:03
Average standard deviation of split frequencies: 0.004975
860500 -- (-2278.087) (-2269.394) (-2272.308) [-2264.049] * (-2265.433) [-2266.850] (-2266.140) (-2267.509) -- 0:01:03
861000 -- (-2274.862) [-2266.924] (-2272.847) (-2270.921) * (-2268.007) [-2263.086] (-2264.363) (-2259.679) -- 0:01:03
861500 -- (-2270.260) [-2259.965] (-2269.538) (-2275.518) * (-2268.383) (-2266.401) (-2266.328) [-2268.116] -- 0:01:02
862000 -- [-2261.803] (-2273.454) (-2258.424) (-2263.674) * (-2275.749) [-2265.090] (-2270.788) (-2269.555) -- 0:01:02
862500 -- (-2264.619) (-2278.153) [-2270.043] (-2270.251) * (-2276.114) (-2266.685) (-2266.348) [-2267.750] -- 0:01:02
863000 -- (-2259.579) [-2275.757] (-2271.197) (-2264.436) * (-2271.614) (-2271.130) [-2274.853] (-2268.138) -- 0:01:02
863500 -- (-2270.829) (-2264.563) (-2265.543) [-2266.308] * [-2260.979] (-2271.213) (-2277.216) (-2264.305) -- 0:01:01
864000 -- (-2258.332) (-2269.735) (-2264.136) [-2270.674] * (-2265.306) (-2275.643) [-2266.746] (-2269.043) -- 0:01:01
864500 -- (-2268.442) (-2269.227) [-2273.010] (-2267.819) * (-2261.656) [-2271.827] (-2267.646) (-2258.547) -- 0:01:01
865000 -- (-2269.297) (-2278.639) [-2264.556] (-2262.797) * [-2261.908] (-2267.415) (-2269.228) (-2265.008) -- 0:01:01
Average standard deviation of split frequencies: 0.005126
865500 -- (-2268.396) (-2270.480) (-2268.493) [-2269.379] * [-2271.022] (-2269.812) (-2265.150) (-2273.641) -- 0:01:01
866000 -- [-2261.861] (-2263.164) (-2276.599) (-2271.039) * (-2268.348) (-2272.754) (-2269.485) [-2267.409] -- 0:01:00
866500 -- (-2264.359) [-2263.336] (-2266.549) (-2265.995) * (-2269.777) (-2277.273) [-2275.477] (-2262.016) -- 0:01:00
867000 -- (-2259.059) (-2271.053) [-2269.855] (-2264.333) * [-2260.880] (-2276.812) (-2265.709) (-2270.564) -- 0:01:00
867500 -- (-2269.135) [-2261.624] (-2278.545) (-2271.911) * (-2270.346) (-2265.000) (-2265.789) [-2263.682] -- 0:01:00
868000 -- (-2267.851) (-2272.083) (-2275.174) [-2266.657] * [-2269.612] (-2267.564) (-2269.669) (-2266.985) -- 0:00:59
868500 -- (-2264.820) (-2262.373) (-2267.111) [-2268.305] * [-2271.422] (-2268.772) (-2267.691) (-2269.668) -- 0:00:59
869000 -- (-2270.839) [-2272.873] (-2270.546) (-2263.223) * (-2270.577) (-2274.769) (-2269.288) [-2265.623] -- 0:00:59
869500 -- (-2269.509) (-2273.711) (-2264.902) [-2260.989] * (-2263.062) [-2268.434] (-2277.224) (-2270.891) -- 0:00:59
870000 -- (-2269.000) [-2263.485] (-2283.873) (-2262.029) * (-2264.380) (-2264.189) [-2263.123] (-2267.887) -- 0:00:59
Average standard deviation of split frequencies: 0.005053
870500 -- (-2264.897) (-2275.637) [-2265.814] (-2267.347) * (-2282.772) [-2266.221] (-2261.518) (-2270.043) -- 0:00:58
871000 -- (-2268.949) [-2268.587] (-2269.589) (-2272.739) * (-2273.190) (-2269.508) [-2266.728] (-2269.798) -- 0:00:58
871500 -- (-2273.929) (-2278.065) [-2260.947] (-2268.318) * (-2271.112) [-2265.309] (-2273.428) (-2267.173) -- 0:00:58
872000 -- (-2275.006) [-2276.963] (-2270.191) (-2265.143) * (-2265.706) (-2267.786) [-2266.235] (-2276.172) -- 0:00:58
872500 -- (-2276.476) (-2278.893) [-2268.000] (-2267.500) * [-2264.443] (-2268.728) (-2273.885) (-2271.162) -- 0:00:57
873000 -- (-2266.578) (-2268.453) (-2279.010) [-2265.900] * [-2267.896] (-2266.609) (-2279.433) (-2271.327) -- 0:00:57
873500 -- (-2260.718) (-2263.840) [-2275.034] (-2265.112) * (-2265.783) (-2272.609) (-2293.366) [-2267.931] -- 0:00:57
874000 -- (-2265.037) (-2278.855) [-2266.597] (-2274.722) * (-2263.391) (-2264.271) (-2273.034) [-2263.837] -- 0:00:57
874500 -- (-2265.328) (-2266.429) (-2283.691) [-2266.154] * (-2272.919) (-2270.255) (-2269.962) [-2273.582] -- 0:00:56
875000 -- (-2277.912) (-2269.673) (-2266.324) [-2270.110] * (-2264.592) (-2270.901) [-2266.220] (-2267.743) -- 0:00:56
Average standard deviation of split frequencies: 0.004574
875500 -- [-2268.131] (-2274.106) (-2268.375) (-2271.519) * (-2271.218) (-2266.066) (-2271.944) [-2270.843] -- 0:00:56
876000 -- (-2272.225) [-2260.599] (-2271.821) (-2263.516) * (-2266.734) (-2268.283) [-2268.044] (-2268.233) -- 0:00:56
876500 -- (-2270.667) (-2270.237) (-2262.200) [-2261.904] * (-2267.325) [-2267.096] (-2269.685) (-2266.518) -- 0:00:56
877000 -- (-2274.471) (-2274.951) (-2267.811) [-2268.860] * (-2278.759) [-2265.427] (-2271.985) (-2266.674) -- 0:00:55
877500 -- (-2269.278) (-2261.227) (-2263.406) [-2264.230] * [-2264.182] (-2277.067) (-2271.492) (-2287.234) -- 0:00:55
878000 -- (-2269.637) [-2261.316] (-2270.515) (-2268.261) * [-2267.809] (-2273.594) (-2262.718) (-2264.249) -- 0:00:55
878500 -- [-2265.025] (-2270.758) (-2268.893) (-2266.936) * (-2266.590) (-2269.047) (-2263.725) [-2266.582] -- 0:00:55
879000 -- [-2261.220] (-2270.881) (-2270.978) (-2271.984) * (-2263.886) (-2268.316) (-2268.071) [-2263.396] -- 0:00:54
879500 -- (-2276.246) (-2269.755) (-2269.862) [-2268.481] * [-2264.532] (-2270.424) (-2270.190) (-2273.600) -- 0:00:54
880000 -- (-2272.691) (-2284.091) (-2263.220) [-2268.871] * (-2262.977) (-2265.729) [-2274.450] (-2261.355) -- 0:00:54
Average standard deviation of split frequencies: 0.004461
880500 -- (-2270.289) [-2263.803] (-2270.921) (-2267.804) * (-2267.941) [-2275.328] (-2264.088) (-2272.881) -- 0:00:54
881000 -- (-2273.719) [-2270.067] (-2267.163) (-2273.545) * (-2265.072) (-2267.579) (-2269.525) [-2263.458] -- 0:00:54
881500 -- [-2270.667] (-2264.620) (-2271.257) (-2270.038) * (-2271.410) [-2280.554] (-2268.906) (-2271.942) -- 0:00:53
882000 -- (-2266.950) [-2263.992] (-2270.664) (-2267.579) * [-2267.398] (-2276.572) (-2282.500) (-2278.986) -- 0:00:53
882500 -- (-2264.517) (-2269.710) [-2270.006] (-2270.102) * (-2265.734) (-2261.289) [-2275.910] (-2281.388) -- 0:00:53
883000 -- (-2263.669) [-2266.480] (-2275.009) (-2266.975) * (-2266.411) [-2267.374] (-2279.416) (-2266.113) -- 0:00:53
883500 -- (-2267.529) [-2270.984] (-2272.934) (-2264.740) * [-2259.048] (-2272.143) (-2270.893) (-2274.759) -- 0:00:52
884000 -- [-2269.240] (-2261.882) (-2265.080) (-2267.783) * (-2269.835) (-2274.036) [-2264.070] (-2274.351) -- 0:00:52
884500 -- [-2267.471] (-2265.662) (-2273.723) (-2269.818) * (-2273.516) (-2272.538) [-2267.108] (-2262.677) -- 0:00:52
885000 -- (-2268.301) (-2268.692) [-2269.919] (-2277.400) * (-2280.652) (-2262.270) (-2266.570) [-2267.066] -- 0:00:52
Average standard deviation of split frequencies: 0.004256
885500 -- (-2266.795) [-2266.806] (-2271.520) (-2277.845) * (-2272.217) (-2263.070) [-2265.372] (-2264.988) -- 0:00:51
886000 -- (-2278.249) [-2275.548] (-2284.523) (-2277.724) * [-2272.748] (-2268.339) (-2270.677) (-2268.333) -- 0:00:51
886500 -- (-2270.443) (-2267.290) [-2264.668] (-2272.733) * (-2260.313) [-2271.968] (-2273.818) (-2272.435) -- 0:00:51
887000 -- (-2264.448) [-2277.775] (-2270.310) (-2264.437) * (-2268.436) (-2276.290) [-2266.870] (-2267.959) -- 0:00:51
887500 -- (-2277.073) [-2267.216] (-2272.285) (-2268.151) * [-2264.163] (-2264.333) (-2265.798) (-2265.383) -- 0:00:51
888000 -- [-2265.418] (-2267.077) (-2276.693) (-2269.814) * [-2266.060] (-2270.370) (-2270.326) (-2271.618) -- 0:00:50
888500 -- (-2271.083) (-2277.311) [-2272.596] (-2263.789) * (-2268.346) (-2267.015) (-2267.993) [-2266.608] -- 0:00:50
889000 -- [-2264.348] (-2271.535) (-2265.219) (-2274.115) * (-2266.166) (-2272.077) [-2268.692] (-2264.337) -- 0:00:50
889500 -- (-2268.435) (-2267.575) (-2287.376) [-2265.927] * (-2276.010) (-2270.681) (-2272.968) [-2265.528] -- 0:00:50
890000 -- (-2274.811) [-2260.832] (-2267.733) (-2283.058) * (-2275.853) (-2269.044) (-2275.104) [-2265.741] -- 0:00:49
Average standard deviation of split frequencies: 0.004102
890500 -- (-2263.009) [-2265.477] (-2268.716) (-2278.428) * (-2265.493) [-2267.297] (-2266.234) (-2268.020) -- 0:00:49
891000 -- [-2266.393] (-2262.720) (-2274.485) (-2268.798) * (-2265.715) (-2266.418) [-2265.635] (-2273.312) -- 0:00:49
891500 -- (-2280.463) [-2268.257] (-2271.301) (-2269.136) * [-2264.732] (-2261.336) (-2284.295) (-2283.342) -- 0:00:49
892000 -- [-2265.779] (-2266.860) (-2279.702) (-2267.361) * (-2265.073) (-2270.440) [-2265.772] (-2264.276) -- 0:00:49
892500 -- (-2268.837) (-2277.710) [-2261.196] (-2276.506) * (-2267.919) (-2275.287) (-2269.814) [-2265.562] -- 0:00:48
893000 -- (-2278.031) [-2270.012] (-2267.450) (-2285.417) * (-2266.363) (-2274.756) (-2271.041) [-2272.164] -- 0:00:48
893500 -- (-2266.641) [-2256.675] (-2269.652) (-2269.603) * (-2269.245) (-2272.298) [-2273.175] (-2270.727) -- 0:00:48
894000 -- [-2268.550] (-2265.351) (-2264.289) (-2265.766) * (-2269.441) (-2270.779) (-2270.795) [-2271.298] -- 0:00:48
894500 -- (-2275.549) (-2260.043) [-2264.729] (-2267.399) * (-2271.972) (-2268.289) (-2261.581) [-2261.961] -- 0:00:47
895000 -- (-2270.454) [-2259.032] (-2264.311) (-2272.088) * (-2269.032) (-2274.123) [-2259.518] (-2263.653) -- 0:00:47
Average standard deviation of split frequencies: 0.004121
895500 -- (-2266.247) [-2266.762] (-2267.970) (-2273.372) * (-2270.197) (-2267.280) [-2265.206] (-2270.718) -- 0:00:47
896000 -- (-2270.474) (-2262.579) [-2267.147] (-2276.260) * (-2264.711) (-2273.660) (-2264.545) [-2267.016] -- 0:00:47
896500 -- (-2270.097) [-2266.133] (-2274.635) (-2267.232) * (-2261.408) (-2275.378) (-2271.245) [-2268.447] -- 0:00:46
897000 -- (-2267.828) (-2262.346) [-2264.096] (-2267.485) * (-2264.887) (-2282.956) [-2281.551] (-2267.129) -- 0:00:46
897500 -- [-2271.207] (-2267.054) (-2267.810) (-2259.752) * [-2260.730] (-2265.194) (-2269.138) (-2285.651) -- 0:00:46
898000 -- (-2265.070) (-2267.654) (-2269.072) [-2265.911] * [-2264.940] (-2283.447) (-2276.572) (-2264.253) -- 0:00:46
898500 -- (-2265.839) (-2261.636) [-2271.445] (-2271.742) * [-2270.674] (-2262.365) (-2269.814) (-2273.248) -- 0:00:46
899000 -- (-2277.550) (-2261.229) (-2271.798) [-2267.060] * (-2283.918) (-2272.436) [-2267.156] (-2272.793) -- 0:00:45
899500 -- (-2271.081) (-2278.777) [-2267.847] (-2262.404) * (-2273.897) (-2280.080) (-2274.278) [-2259.934] -- 0:00:45
900000 -- (-2269.422) (-2270.037) (-2269.480) [-2257.635] * (-2272.768) (-2276.076) [-2260.948] (-2272.415) -- 0:00:45
Average standard deviation of split frequencies: 0.004318
900500 -- (-2272.443) (-2268.270) (-2265.790) [-2261.724] * (-2266.360) (-2265.550) (-2267.012) [-2267.085] -- 0:00:45
901000 -- (-2264.595) [-2262.337] (-2274.779) (-2266.947) * (-2260.907) (-2269.077) [-2260.297] (-2270.313) -- 0:00:44
901500 -- (-2283.098) (-2268.099) [-2270.057] (-2265.795) * (-2262.606) [-2267.633] (-2268.551) (-2275.235) -- 0:00:44
902000 -- [-2265.572] (-2267.919) (-2266.084) (-2279.190) * [-2268.511] (-2275.699) (-2268.185) (-2269.901) -- 0:00:44
902500 -- (-2275.429) (-2271.045) [-2273.119] (-2275.974) * (-2277.507) [-2261.982] (-2268.462) (-2264.588) -- 0:00:44
903000 -- (-2273.163) (-2271.127) [-2269.926] (-2267.398) * (-2274.538) (-2271.710) (-2264.975) [-2267.269] -- 0:00:44
903500 -- (-2264.928) (-2265.970) [-2263.313] (-2272.178) * (-2265.662) (-2283.814) [-2262.684] (-2261.916) -- 0:00:43
904000 -- (-2279.964) [-2263.934] (-2265.974) (-2271.053) * (-2263.504) (-2275.757) [-2265.176] (-2264.612) -- 0:00:43
904500 -- (-2273.372) (-2264.682) [-2265.777] (-2264.179) * (-2266.436) [-2266.943] (-2265.972) (-2267.706) -- 0:00:43
905000 -- (-2269.843) (-2267.811) (-2267.808) [-2266.492] * (-2274.238) (-2279.425) [-2267.522] (-2272.218) -- 0:00:43
Average standard deviation of split frequencies: 0.004596
905500 -- (-2268.001) [-2265.778] (-2272.130) (-2266.747) * [-2256.189] (-2274.737) (-2269.484) (-2275.450) -- 0:00:42
906000 -- (-2271.119) [-2268.235] (-2274.263) (-2267.991) * (-2263.973) (-2267.879) [-2265.315] (-2272.762) -- 0:00:42
906500 -- (-2266.232) (-2277.806) (-2278.062) [-2262.313] * (-2274.635) (-2260.151) [-2263.485] (-2266.050) -- 0:00:42
907000 -- (-2265.048) [-2268.771] (-2270.739) (-2268.001) * (-2267.389) [-2266.235] (-2268.653) (-2269.366) -- 0:00:42
907500 -- (-2264.245) (-2263.149) [-2272.281] (-2274.139) * (-2264.791) [-2266.774] (-2277.793) (-2276.197) -- 0:00:41
908000 -- (-2275.655) (-2275.065) (-2263.461) [-2265.859] * [-2265.861] (-2267.654) (-2273.190) (-2261.228) -- 0:00:41
908500 -- (-2273.682) (-2273.697) (-2263.771) [-2266.536] * (-2268.114) (-2273.345) (-2271.310) [-2262.242] -- 0:00:41
909000 -- (-2271.032) (-2270.514) (-2264.268) [-2265.582] * (-2272.520) (-2274.345) [-2270.499] (-2268.639) -- 0:00:41
909500 -- [-2261.813] (-2268.071) (-2269.852) (-2267.056) * [-2264.491] (-2275.864) (-2273.514) (-2266.973) -- 0:00:41
910000 -- (-2270.650) (-2264.178) (-2266.328) [-2272.477] * [-2258.035] (-2264.344) (-2272.388) (-2263.298) -- 0:00:40
Average standard deviation of split frequencies: 0.004529
910500 -- (-2264.707) [-2266.430] (-2265.915) (-2283.827) * (-2266.524) (-2261.348) [-2266.924] (-2266.067) -- 0:00:40
911000 -- [-2261.836] (-2267.034) (-2264.388) (-2280.651) * (-2274.343) [-2263.438] (-2268.511) (-2268.159) -- 0:00:40
911500 -- [-2265.297] (-2272.547) (-2270.611) (-2272.158) * (-2261.735) [-2260.589] (-2271.628) (-2258.797) -- 0:00:40
912000 -- (-2273.789) (-2264.864) [-2266.672] (-2272.459) * (-2263.051) (-2273.922) (-2263.191) [-2266.662] -- 0:00:39
912500 -- (-2274.128) (-2267.973) (-2270.787) [-2268.150] * [-2267.466] (-2276.347) (-2271.687) (-2272.728) -- 0:00:39
913000 -- (-2268.307) (-2266.149) [-2268.193] (-2276.944) * (-2278.446) (-2265.435) (-2268.203) [-2270.292] -- 0:00:39
913500 -- (-2269.001) [-2264.389] (-2271.895) (-2277.378) * (-2273.312) [-2270.082] (-2272.976) (-2269.709) -- 0:00:39
914000 -- (-2276.997) (-2264.443) (-2264.925) [-2265.852] * (-2266.152) (-2276.190) (-2273.996) [-2263.624] -- 0:00:39
914500 -- (-2271.422) (-2264.859) [-2265.371] (-2279.940) * (-2264.841) [-2269.353] (-2268.764) (-2265.500) -- 0:00:38
915000 -- (-2267.027) [-2265.148] (-2267.698) (-2273.214) * (-2260.845) (-2282.645) (-2268.667) [-2260.881] -- 0:00:38
Average standard deviation of split frequencies: 0.004332
915500 -- (-2262.781) [-2275.853] (-2268.114) (-2269.420) * [-2266.365] (-2274.043) (-2269.093) (-2271.593) -- 0:00:38
916000 -- (-2275.997) (-2277.067) (-2269.957) [-2270.765] * (-2270.027) (-2270.782) [-2269.098] (-2273.015) -- 0:00:38
916500 -- (-2262.830) [-2267.360] (-2270.456) (-2264.187) * [-2262.362] (-2273.447) (-2286.157) (-2264.802) -- 0:00:37
917000 -- (-2269.692) [-2261.702] (-2273.871) (-2272.336) * [-2274.844] (-2273.910) (-2265.414) (-2269.165) -- 0:00:37
917500 -- [-2270.033] (-2267.209) (-2275.605) (-2273.077) * [-2265.321] (-2267.760) (-2272.345) (-2262.014) -- 0:00:37
918000 -- (-2266.856) (-2277.664) [-2267.100] (-2268.750) * (-2267.870) (-2272.604) (-2263.677) [-2263.514] -- 0:00:37
918500 -- [-2262.683] (-2271.066) (-2268.003) (-2268.450) * (-2263.685) (-2278.597) [-2266.387] (-2267.555) -- 0:00:37
919000 -- [-2269.103] (-2278.325) (-2259.610) (-2272.168) * [-2263.248] (-2264.173) (-2276.937) (-2273.464) -- 0:00:36
919500 -- (-2268.854) (-2271.124) (-2259.340) [-2269.017] * (-2264.180) [-2259.470] (-2272.968) (-2279.268) -- 0:00:36
920000 -- (-2270.057) (-2267.006) [-2264.584] (-2271.633) * (-2264.081) (-2265.094) [-2274.060] (-2276.098) -- 0:00:36
Average standard deviation of split frequencies: 0.004566
920500 -- [-2272.933] (-2276.359) (-2265.472) (-2275.705) * (-2259.776) (-2270.380) [-2270.605] (-2272.582) -- 0:00:36
921000 -- (-2265.666) (-2267.522) [-2263.307] (-2270.134) * (-2263.155) (-2266.478) [-2270.837] (-2268.858) -- 0:00:35
921500 -- (-2266.920) [-2268.005] (-2263.585) (-2266.428) * (-2272.824) (-2260.431) (-2277.438) [-2269.905] -- 0:00:35
922000 -- (-2263.485) (-2267.568) (-2261.665) [-2270.003] * [-2262.767] (-2266.283) (-2271.808) (-2273.199) -- 0:00:35
922500 -- (-2280.989) [-2273.187] (-2267.314) (-2269.501) * (-2268.408) (-2276.790) [-2274.307] (-2267.919) -- 0:00:35
923000 -- (-2267.722) (-2264.954) [-2264.991] (-2268.013) * (-2262.694) (-2271.487) [-2271.985] (-2260.995) -- 0:00:34
923500 -- (-2269.796) (-2269.817) (-2275.746) [-2264.856] * [-2267.576] (-2269.495) (-2273.815) (-2268.934) -- 0:00:34
924000 -- (-2266.449) (-2275.715) (-2270.396) [-2276.072] * (-2271.742) (-2272.134) [-2268.656] (-2270.685) -- 0:00:34
924500 -- [-2267.742] (-2259.898) (-2274.378) (-2263.678) * (-2267.232) (-2269.346) (-2270.189) [-2276.249] -- 0:00:34
925000 -- (-2265.736) (-2259.590) [-2266.332] (-2268.905) * (-2271.777) (-2273.662) [-2268.390] (-2271.644) -- 0:00:34
Average standard deviation of split frequencies: 0.004539
925500 -- (-2266.537) (-2271.144) (-2262.594) [-2261.736] * (-2269.981) (-2262.679) [-2265.408] (-2274.279) -- 0:00:33
926000 -- [-2264.854] (-2265.892) (-2276.712) (-2271.620) * (-2265.622) (-2262.492) (-2269.437) [-2270.996] -- 0:00:33
926500 -- (-2274.930) (-2272.202) [-2260.080] (-2274.754) * (-2273.995) (-2275.079) [-2265.353] (-2268.636) -- 0:00:33
927000 -- [-2269.829] (-2265.653) (-2267.850) (-2266.746) * (-2279.656) (-2269.009) (-2267.711) [-2265.995] -- 0:00:33
927500 -- [-2269.638] (-2267.723) (-2269.858) (-2274.151) * (-2266.840) (-2268.773) (-2271.390) [-2262.685] -- 0:00:32
928000 -- [-2271.817] (-2265.008) (-2271.802) (-2270.989) * (-2265.285) (-2271.935) (-2267.736) [-2269.597] -- 0:00:32
928500 -- (-2265.594) [-2275.064] (-2271.028) (-2272.346) * [-2259.918] (-2280.777) (-2267.985) (-2263.132) -- 0:00:32
929000 -- (-2272.424) (-2265.966) [-2266.262] (-2267.405) * [-2262.096] (-2266.853) (-2283.353) (-2264.274) -- 0:00:32
929500 -- (-2267.558) [-2266.714] (-2268.511) (-2270.090) * (-2266.953) [-2261.159] (-2277.539) (-2269.116) -- 0:00:32
930000 -- (-2268.154) (-2259.949) [-2264.858] (-2270.421) * [-2261.809] (-2263.405) (-2271.259) (-2258.390) -- 0:00:31
Average standard deviation of split frequencies: 0.004854
930500 -- [-2260.865] (-2271.057) (-2275.358) (-2271.250) * (-2280.750) [-2262.430] (-2274.910) (-2264.642) -- 0:00:31
931000 -- (-2271.886) (-2268.094) [-2264.881] (-2260.522) * (-2280.860) [-2265.516] (-2268.506) (-2271.430) -- 0:00:31
931500 -- (-2267.355) (-2263.391) (-2273.684) [-2265.063] * [-2269.176] (-2278.093) (-2266.786) (-2268.452) -- 0:00:31
932000 -- (-2271.392) (-2262.168) (-2264.704) [-2258.935] * (-2273.509) [-2263.146] (-2267.349) (-2267.313) -- 0:00:30
932500 -- (-2270.683) [-2262.263] (-2268.522) (-2268.151) * (-2265.773) [-2269.455] (-2266.061) (-2270.110) -- 0:00:30
933000 -- (-2284.708) (-2276.782) [-2272.036] (-2273.260) * [-2267.416] (-2271.372) (-2262.087) (-2271.429) -- 0:00:30
933500 -- [-2271.980] (-2266.669) (-2261.438) (-2269.724) * (-2264.581) (-2269.673) (-2267.307) [-2264.046] -- 0:00:30
934000 -- (-2271.763) (-2268.393) [-2265.900] (-2272.303) * (-2264.396) [-2262.744] (-2264.204) (-2268.798) -- 0:00:29
934500 -- [-2266.423] (-2269.445) (-2267.086) (-2275.147) * (-2261.708) (-2268.237) [-2261.705] (-2264.559) -- 0:00:29
935000 -- [-2267.413] (-2268.983) (-2266.270) (-2274.906) * [-2265.187] (-2270.222) (-2263.010) (-2268.129) -- 0:00:29
Average standard deviation of split frequencies: 0.004617
935500 -- (-2269.165) (-2270.586) [-2260.730] (-2270.789) * (-2277.015) (-2262.216) [-2269.637] (-2270.847) -- 0:00:29
936000 -- (-2272.445) (-2276.804) [-2267.336] (-2262.748) * (-2267.665) (-2272.654) [-2264.063] (-2271.613) -- 0:00:29
936500 -- (-2265.884) (-2273.923) (-2271.752) [-2268.434] * (-2266.197) (-2268.543) (-2266.007) [-2266.620] -- 0:00:28
937000 -- (-2270.394) (-2264.812) [-2270.752] (-2269.486) * (-2263.866) [-2266.631] (-2268.306) (-2262.594) -- 0:00:28
937500 -- (-2261.100) [-2260.105] (-2269.038) (-2267.553) * [-2262.550] (-2266.827) (-2273.596) (-2270.897) -- 0:00:28
938000 -- (-2266.169) [-2261.062] (-2268.050) (-2265.435) * [-2268.637] (-2267.073) (-2272.650) (-2272.609) -- 0:00:28
938500 -- [-2271.343] (-2264.048) (-2269.628) (-2273.537) * (-2268.891) (-2266.803) [-2261.963] (-2273.005) -- 0:00:27
939000 -- [-2268.114] (-2269.798) (-2274.014) (-2270.970) * (-2267.092) (-2276.705) (-2271.571) [-2268.229] -- 0:00:27
939500 -- (-2268.483) (-2268.448) [-2264.207] (-2275.819) * (-2270.113) (-2270.351) (-2266.964) [-2262.856] -- 0:00:27
940000 -- (-2275.528) (-2271.614) (-2267.351) [-2266.267] * [-2263.058] (-2268.194) (-2263.507) (-2274.026) -- 0:00:27
Average standard deviation of split frequencies: 0.004343
940500 -- (-2263.298) (-2278.673) [-2263.568] (-2277.956) * (-2265.411) (-2275.424) [-2267.387] (-2270.695) -- 0:00:27
941000 -- (-2266.954) [-2269.194] (-2264.283) (-2270.742) * (-2272.578) (-2283.836) [-2258.292] (-2270.900) -- 0:00:26
941500 -- (-2269.870) (-2271.235) [-2259.992] (-2265.548) * (-2269.428) (-2273.932) [-2260.686] (-2270.918) -- 0:00:26
942000 -- [-2266.973] (-2274.560) (-2274.700) (-2263.298) * [-2274.128] (-2270.457) (-2269.056) (-2268.406) -- 0:00:26
942500 -- (-2268.860) (-2265.966) (-2265.304) [-2277.397] * (-2268.136) [-2268.093] (-2263.149) (-2268.275) -- 0:00:26
943000 -- (-2274.457) [-2260.889] (-2269.885) (-2263.351) * (-2276.808) [-2267.029] (-2264.260) (-2267.968) -- 0:00:25
943500 -- [-2262.057] (-2260.129) (-2275.552) (-2256.716) * (-2283.045) (-2263.156) [-2264.300] (-2265.368) -- 0:00:25
944000 -- (-2267.969) [-2257.185] (-2271.417) (-2265.700) * (-2275.730) (-2274.231) [-2262.370] (-2270.348) -- 0:00:25
944500 -- [-2271.256] (-2264.419) (-2262.277) (-2261.887) * [-2268.983] (-2276.956) (-2280.801) (-2269.156) -- 0:00:25
945000 -- (-2267.518) [-2262.167] (-2266.541) (-2267.267) * (-2280.649) [-2278.908] (-2269.893) (-2264.727) -- 0:00:24
Average standard deviation of split frequencies: 0.004485
945500 -- (-2266.466) (-2269.737) [-2258.664] (-2267.186) * (-2276.048) (-2271.790) [-2262.107] (-2275.338) -- 0:00:24
946000 -- (-2268.966) (-2269.351) [-2268.278] (-2268.577) * (-2268.848) (-2279.071) (-2273.758) [-2266.099] -- 0:00:24
946500 -- (-2265.474) (-2265.153) (-2268.882) [-2270.473] * [-2262.601] (-2274.647) (-2269.365) (-2271.849) -- 0:00:24
947000 -- [-2262.060] (-2265.644) (-2273.428) (-2272.901) * (-2266.938) [-2261.172] (-2276.752) (-2265.695) -- 0:00:24
947500 -- (-2264.574) (-2279.528) [-2267.080] (-2277.040) * [-2265.902] (-2261.059) (-2266.931) (-2276.434) -- 0:00:23
948000 -- (-2263.031) [-2265.876] (-2276.639) (-2283.507) * (-2267.352) (-2269.675) [-2269.594] (-2268.877) -- 0:00:23
948500 -- (-2268.591) (-2269.858) (-2276.426) [-2267.351] * [-2265.373] (-2265.161) (-2265.371) (-2263.844) -- 0:00:23
949000 -- [-2264.728] (-2271.620) (-2270.564) (-2264.438) * [-2271.639] (-2269.027) (-2266.580) (-2276.900) -- 0:00:23
949500 -- (-2268.215) (-2265.121) (-2282.080) [-2274.372] * (-2265.122) (-2271.556) (-2263.260) [-2268.968] -- 0:00:22
950000 -- (-2271.337) [-2265.940] (-2265.671) (-2275.440) * [-2261.904] (-2277.908) (-2272.970) (-2270.402) -- 0:00:22
Average standard deviation of split frequencies: 0.004339
950500 -- (-2272.157) (-2259.725) [-2272.113] (-2276.111) * (-2273.978) (-2262.275) (-2267.287) [-2271.282] -- 0:00:22
951000 -- [-2267.441] (-2281.874) (-2265.529) (-2268.970) * (-2265.675) (-2275.871) [-2265.855] (-2271.287) -- 0:00:22
951500 -- (-2282.554) (-2267.247) (-2271.717) [-2266.218] * (-2267.083) [-2273.113] (-2277.914) (-2270.388) -- 0:00:22
952000 -- (-2271.464) (-2267.249) (-2263.499) [-2265.721] * (-2263.190) [-2270.053] (-2269.131) (-2269.453) -- 0:00:21
952500 -- (-2273.212) (-2263.359) (-2264.417) [-2263.541] * (-2271.609) (-2269.836) (-2271.880) [-2266.526] -- 0:00:21
953000 -- [-2264.152] (-2272.038) (-2271.951) (-2268.317) * (-2277.181) [-2264.468] (-2271.326) (-2266.985) -- 0:00:21
953500 -- (-2267.925) [-2266.163] (-2268.861) (-2264.674) * (-2268.406) (-2273.447) (-2273.222) [-2267.952] -- 0:00:21
954000 -- (-2269.222) (-2285.736) [-2277.954] (-2266.279) * (-2264.516) (-2271.240) (-2268.872) [-2267.624] -- 0:00:20
954500 -- (-2265.569) (-2288.703) (-2274.320) [-2265.576] * (-2274.462) (-2269.486) [-2262.480] (-2265.465) -- 0:00:20
955000 -- (-2259.397) (-2276.615) [-2262.722] (-2275.241) * (-2268.584) (-2269.744) (-2261.084) [-2266.057] -- 0:00:20
Average standard deviation of split frequencies: 0.004027
955500 -- (-2273.359) [-2261.433] (-2275.157) (-2266.937) * (-2274.218) [-2270.100] (-2261.491) (-2272.079) -- 0:00:20
956000 -- (-2261.989) (-2260.541) (-2266.906) [-2263.605] * (-2265.948) [-2263.563] (-2275.215) (-2278.007) -- 0:00:19
956500 -- (-2262.506) (-2271.163) [-2264.637] (-2272.666) * (-2271.850) (-2262.443) [-2271.679] (-2269.383) -- 0:00:19
957000 -- (-2273.879) (-2269.018) [-2268.969] (-2263.930) * (-2272.556) (-2267.279) [-2279.724] (-2274.863) -- 0:00:19
957500 -- (-2276.852) (-2268.603) [-2269.057] (-2269.089) * (-2271.916) [-2265.991] (-2259.635) (-2267.858) -- 0:00:19
958000 -- (-2274.368) (-2272.772) (-2263.481) [-2260.101] * (-2271.829) [-2271.534] (-2263.333) (-2276.306) -- 0:00:19
958500 -- (-2272.731) (-2262.433) (-2268.933) [-2265.545] * (-2275.084) (-2269.462) (-2264.215) [-2266.435] -- 0:00:18
959000 -- [-2267.180] (-2280.435) (-2267.233) (-2264.941) * [-2263.767] (-2263.431) (-2269.222) (-2268.857) -- 0:00:18
959500 -- [-2275.143] (-2270.429) (-2266.568) (-2266.741) * (-2266.427) (-2266.353) (-2262.988) [-2266.386] -- 0:00:18
960000 -- (-2271.652) (-2265.588) [-2265.285] (-2281.418) * (-2267.789) (-2265.064) (-2273.459) [-2262.309] -- 0:00:18
Average standard deviation of split frequencies: 0.004335
960500 -- (-2274.850) [-2267.346] (-2278.582) (-2268.186) * [-2270.465] (-2275.290) (-2263.133) (-2266.334) -- 0:00:17
961000 -- (-2271.605) [-2264.486] (-2271.122) (-2285.029) * (-2271.811) [-2264.087] (-2262.918) (-2271.817) -- 0:00:17
961500 -- (-2268.497) [-2264.116] (-2261.108) (-2275.571) * [-2267.929] (-2269.438) (-2269.965) (-2272.635) -- 0:00:17
962000 -- (-2274.561) (-2279.490) [-2259.327] (-2264.781) * [-2268.979] (-2273.869) (-2267.559) (-2277.985) -- 0:00:17
962500 -- [-2276.516] (-2272.313) (-2265.183) (-2282.991) * [-2266.051] (-2276.312) (-2272.879) (-2267.066) -- 0:00:17
963000 -- (-2270.025) (-2264.311) (-2266.745) [-2261.262] * (-2262.373) (-2266.558) [-2267.874] (-2268.651) -- 0:00:16
963500 -- (-2268.819) [-2273.390] (-2263.753) (-2266.216) * (-2268.754) (-2262.712) (-2275.536) [-2265.466] -- 0:00:16
964000 -- (-2267.101) (-2268.726) [-2263.229] (-2273.830) * (-2270.833) [-2262.347] (-2272.531) (-2276.013) -- 0:00:16
964500 -- (-2276.393) (-2272.435) (-2279.671) [-2270.193] * (-2264.973) (-2266.275) (-2267.167) [-2268.763] -- 0:00:16
965000 -- (-2272.823) (-2273.340) [-2266.040] (-2265.344) * (-2266.895) (-2269.171) [-2268.101] (-2269.021) -- 0:00:15
Average standard deviation of split frequencies: 0.004555
965500 -- (-2270.123) (-2279.636) [-2262.259] (-2265.224) * (-2270.339) (-2267.735) [-2263.997] (-2267.783) -- 0:00:15
966000 -- [-2261.940] (-2275.106) (-2265.980) (-2265.326) * (-2273.622) (-2268.038) [-2273.457] (-2272.307) -- 0:00:15
966500 -- (-2269.268) (-2272.673) [-2269.141] (-2268.274) * (-2270.381) (-2269.860) (-2272.131) [-2267.671] -- 0:00:15
967000 -- (-2266.700) (-2268.646) (-2267.415) [-2263.753] * (-2277.013) (-2266.239) [-2267.007] (-2267.317) -- 0:00:14
967500 -- [-2262.334] (-2267.561) (-2258.408) (-2261.522) * (-2265.359) (-2277.489) (-2263.067) [-2270.578] -- 0:00:14
968000 -- [-2268.829] (-2269.403) (-2266.542) (-2265.819) * (-2272.728) [-2268.443] (-2270.471) (-2273.449) -- 0:00:14
968500 -- (-2270.550) (-2263.658) (-2266.394) [-2276.031] * [-2262.977] (-2267.391) (-2270.432) (-2271.070) -- 0:00:14
969000 -- [-2274.450] (-2269.852) (-2273.120) (-2270.688) * [-2265.073] (-2261.636) (-2263.819) (-2264.235) -- 0:00:14
969500 -- [-2268.739] (-2271.858) (-2264.551) (-2261.687) * (-2267.926) (-2266.343) (-2266.806) [-2277.572] -- 0:00:13
970000 -- (-2271.312) [-2266.985] (-2262.384) (-2266.887) * (-2268.631) (-2276.339) [-2269.106] (-2269.455) -- 0:00:13
Average standard deviation of split frequencies: 0.004695
970500 -- (-2270.763) (-2274.579) [-2265.480] (-2273.618) * (-2279.119) (-2273.452) (-2276.831) [-2269.326] -- 0:00:13
971000 -- (-2278.614) [-2261.229] (-2274.028) (-2269.073) * (-2264.051) (-2265.378) (-2270.015) [-2263.702] -- 0:00:13
971500 -- (-2268.567) (-2259.783) [-2263.904] (-2267.633) * (-2265.688) (-2270.446) [-2263.592] (-2261.176) -- 0:00:12
972000 -- (-2272.500) [-2271.618] (-2262.966) (-2274.969) * (-2267.937) (-2273.044) [-2261.497] (-2276.375) -- 0:00:12
972500 -- (-2271.381) (-2278.170) (-2272.317) [-2265.930] * (-2268.961) (-2258.782) (-2274.588) [-2263.744] -- 0:00:12
973000 -- [-2265.023] (-2267.119) (-2266.644) (-2267.396) * (-2270.273) (-2265.278) [-2270.444] (-2270.310) -- 0:00:12
973500 -- (-2270.076) (-2263.091) [-2263.890] (-2268.631) * (-2273.023) [-2265.267] (-2268.291) (-2273.226) -- 0:00:12
974000 -- (-2276.691) (-2272.828) [-2267.686] (-2268.597) * [-2267.257] (-2272.287) (-2270.109) (-2268.696) -- 0:00:11
974500 -- [-2272.052] (-2267.358) (-2267.658) (-2278.313) * (-2267.008) [-2268.098] (-2265.830) (-2278.355) -- 0:00:11
975000 -- (-2264.491) [-2260.650] (-2268.878) (-2270.862) * (-2262.095) (-2275.154) (-2264.636) [-2269.605] -- 0:00:11
Average standard deviation of split frequencies: 0.004790
975500 -- (-2268.104) [-2262.540] (-2262.342) (-2269.816) * (-2263.433) (-2276.435) (-2263.766) [-2264.314] -- 0:00:11
976000 -- [-2265.980] (-2271.964) (-2262.226) (-2265.562) * [-2266.246] (-2291.215) (-2260.202) (-2262.461) -- 0:00:10
976500 -- (-2262.994) (-2275.225) (-2267.094) [-2262.462] * (-2275.826) [-2274.520] (-2258.681) (-2273.486) -- 0:00:10
977000 -- (-2263.918) (-2265.395) [-2270.703] (-2266.775) * (-2271.388) (-2275.423) [-2264.492] (-2272.079) -- 0:00:10
977500 -- (-2262.384) (-2267.259) (-2273.742) [-2268.409] * (-2267.255) [-2271.292] (-2266.266) (-2284.366) -- 0:00:10
978000 -- (-2268.632) (-2266.355) (-2278.355) [-2263.788] * (-2267.709) (-2268.394) (-2261.340) [-2272.544] -- 0:00:09
978500 -- (-2267.855) (-2281.877) (-2269.239) [-2262.483] * (-2270.123) (-2274.574) [-2263.134] (-2271.008) -- 0:00:09
979000 -- [-2261.197] (-2269.282) (-2275.733) (-2265.479) * (-2275.164) (-2274.098) (-2279.869) [-2263.186] -- 0:00:09
979500 -- [-2261.326] (-2277.173) (-2268.388) (-2267.372) * (-2275.844) (-2271.005) (-2265.303) [-2273.222] -- 0:00:09
980000 -- (-2270.960) [-2277.017] (-2270.955) (-2275.915) * (-2263.358) [-2267.922] (-2268.026) (-2272.647) -- 0:00:09
Average standard deviation of split frequencies: 0.004887
980500 -- [-2263.880] (-2276.277) (-2266.597) (-2262.601) * (-2270.215) (-2269.570) (-2263.091) [-2266.743] -- 0:00:08
981000 -- (-2264.797) (-2273.683) (-2272.971) [-2273.017] * (-2264.837) (-2265.744) [-2266.726] (-2285.157) -- 0:00:08
981500 -- [-2266.730] (-2266.626) (-2267.571) (-2272.351) * (-2270.394) [-2263.883] (-2262.985) (-2272.623) -- 0:00:08
982000 -- (-2279.155) (-2274.585) [-2271.999] (-2267.637) * (-2268.880) (-2269.043) [-2267.834] (-2271.803) -- 0:00:08
982500 -- (-2269.171) (-2266.211) [-2261.218] (-2279.502) * [-2270.455] (-2274.417) (-2274.300) (-2267.388) -- 0:00:07
983000 -- (-2265.876) [-2267.425] (-2275.657) (-2271.517) * [-2270.280] (-2269.956) (-2268.544) (-2266.014) -- 0:00:07
983500 -- (-2261.098) (-2275.724) (-2269.659) [-2265.242] * [-2267.642] (-2268.428) (-2269.032) (-2268.437) -- 0:00:07
984000 -- (-2265.221) (-2266.975) [-2264.264] (-2263.335) * [-2265.566] (-2269.883) (-2267.386) (-2266.248) -- 0:00:07
984500 -- (-2274.772) (-2274.486) (-2264.616) [-2263.428] * [-2266.966] (-2273.534) (-2269.848) (-2261.173) -- 0:00:07
985000 -- [-2264.895] (-2275.774) (-2271.746) (-2261.728) * (-2272.949) [-2269.935] (-2281.348) (-2277.768) -- 0:00:06
Average standard deviation of split frequencies: 0.004821
985500 -- [-2264.297] (-2273.577) (-2268.177) (-2274.511) * (-2270.185) (-2271.375) (-2275.657) [-2266.148] -- 0:00:06
986000 -- (-2273.233) [-2263.129] (-2264.416) (-2264.158) * (-2262.258) (-2272.951) [-2272.271] (-2265.951) -- 0:00:06
986500 -- (-2274.485) [-2265.639] (-2269.166) (-2266.370) * [-2266.635] (-2281.788) (-2271.447) (-2270.661) -- 0:00:06
987000 -- (-2267.563) (-2260.704) [-2263.605] (-2269.637) * (-2272.116) (-2267.312) (-2265.543) [-2271.010] -- 0:00:05
987500 -- (-2273.446) [-2267.752] (-2271.821) (-2276.165) * (-2263.964) (-2269.756) [-2261.785] (-2268.140) -- 0:00:05
988000 -- (-2267.694) [-2257.663] (-2268.663) (-2272.596) * (-2265.941) [-2265.319] (-2264.687) (-2261.985) -- 0:00:05
988500 -- [-2259.570] (-2262.333) (-2262.634) (-2272.562) * [-2262.003] (-2269.742) (-2265.961) (-2271.794) -- 0:00:05
989000 -- (-2260.982) [-2266.160] (-2265.975) (-2271.108) * (-2271.114) [-2265.313] (-2266.503) (-2270.697) -- 0:00:04
989500 -- (-2276.273) (-2266.703) [-2260.018] (-2275.868) * (-2266.229) [-2268.148] (-2265.951) (-2266.255) -- 0:00:04
990000 -- (-2279.566) (-2273.906) [-2265.151] (-2269.653) * (-2266.737) (-2265.301) (-2270.099) [-2263.575] -- 0:00:04
Average standard deviation of split frequencies: 0.004679
990500 -- [-2264.256] (-2267.512) (-2274.123) (-2269.931) * [-2267.635] (-2268.332) (-2261.087) (-2259.535) -- 0:00:04
991000 -- (-2270.112) [-2265.587] (-2265.371) (-2282.240) * (-2272.637) [-2269.060] (-2277.316) (-2266.305) -- 0:00:04
991500 -- (-2272.199) (-2284.430) (-2267.330) [-2264.484] * [-2263.783] (-2264.213) (-2272.975) (-2268.617) -- 0:00:03
992000 -- (-2280.375) (-2278.937) (-2279.532) [-2275.696] * (-2262.482) (-2269.920) (-2271.885) [-2266.861] -- 0:00:03
992500 -- (-2269.125) [-2265.359] (-2267.466) (-2274.326) * [-2262.227] (-2271.516) (-2264.213) (-2272.182) -- 0:00:03
993000 -- (-2260.715) (-2273.294) [-2269.336] (-2262.777) * (-2265.911) (-2276.347) (-2265.546) [-2269.548] -- 0:00:03
993500 -- (-2271.553) [-2258.522] (-2265.331) (-2270.209) * (-2270.534) (-2275.693) [-2269.589] (-2267.343) -- 0:00:02
994000 -- (-2264.196) (-2262.033) (-2268.423) [-2269.206] * (-2261.625) (-2269.477) [-2266.165] (-2271.636) -- 0:00:02
994500 -- [-2279.272] (-2266.073) (-2284.253) (-2276.288) * [-2270.242] (-2273.423) (-2264.866) (-2261.090) -- 0:00:02
995000 -- (-2263.606) [-2264.537] (-2272.794) (-2276.089) * [-2275.292] (-2276.583) (-2273.816) (-2268.674) -- 0:00:02
Average standard deviation of split frequencies: 0.004654
995500 -- [-2265.217] (-2270.761) (-2268.808) (-2268.218) * (-2274.853) (-2264.675) [-2266.641] (-2264.242) -- 0:00:02
996000 -- (-2265.906) [-2262.265] (-2271.091) (-2266.022) * [-2266.290] (-2276.250) (-2266.181) (-2266.050) -- 0:00:01
996500 -- [-2266.173] (-2261.789) (-2272.320) (-2264.166) * (-2276.866) (-2265.199) [-2271.116] (-2264.976) -- 0:00:01
997000 -- [-2268.785] (-2264.926) (-2270.372) (-2262.924) * (-2265.474) (-2258.157) (-2261.105) [-2263.105] -- 0:00:01
997500 -- (-2263.594) (-2268.131) [-2273.920] (-2274.476) * (-2271.219) (-2269.526) [-2266.894] (-2265.460) -- 0:00:01
998000 -- (-2263.474) (-2265.108) [-2267.868] (-2273.673) * (-2265.102) (-2263.753) [-2260.920] (-2264.942) -- 0:00:00
998500 -- (-2278.862) (-2280.497) [-2263.100] (-2269.099) * (-2266.007) [-2267.235] (-2269.081) (-2273.888) -- 0:00:00
999000 -- (-2269.417) [-2271.886] (-2267.781) (-2271.699) * (-2263.664) (-2270.235) (-2277.351) [-2262.182] -- 0:00:00
999500 -- (-2270.154) [-2270.249] (-2272.750) (-2267.834) * (-2272.728) (-2271.223) [-2271.129] (-2267.670) -- 0:00:00
1000000 -- [-2268.342] (-2273.725) (-2274.482) (-2271.212) * (-2271.954) (-2273.327) [-2272.287] (-2273.612) -- 0:00:00
Average standard deviation of split frequencies: 0.004436
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2268.342286 -- 21.296574
Chain 1 -- -2268.342282 -- 21.296574
Chain 2 -- -2273.724634 -- 21.917701
Chain 2 -- -2273.724633 -- 21.917701
Chain 3 -- -2274.481812 -- 21.336075
Chain 3 -- -2274.481830 -- 21.336075
Chain 4 -- -2271.212331 -- 20.706297
Chain 4 -- -2271.212345 -- 20.706297
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2271.953798 -- 19.948051
Chain 1 -- -2271.953801 -- 19.948051
Chain 2 -- -2273.326572 -- 17.801855
Chain 2 -- -2273.326563 -- 17.801855
Chain 3 -- -2272.286629 -- 17.133318
Chain 3 -- -2272.286641 -- 17.133318
Chain 4 -- -2273.612327 -- 15.385839
Chain 4 -- -2273.612333 -- 15.385839
Analysis completed in 7 mins 34 seconds
Analysis used 454.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2254.35
Likelihood of best state for "cold" chain of run 2 was -2254.35
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
47.2 % ( 41 %) Dirichlet(Revmat{all})
62.2 % ( 41 %) Slider(Revmat{all})
25.6 % ( 29 %) Dirichlet(Pi{all})
27.4 % ( 23 %) Slider(Pi{all})
31.2 % ( 21 %) Multiplier(Alpha{1,2})
42.8 % ( 28 %) Multiplier(Alpha{3})
44.1 % ( 20 %) Slider(Pinvar{all})
10.6 % ( 7 %) ExtSPR(Tau{all},V{all})
3.9 % ( 4 %) ExtTBR(Tau{all},V{all})
12.2 % ( 13 %) NNI(Tau{all},V{all})
12.4 % ( 15 %) ParsSPR(Tau{all},V{all})
26.2 % ( 22 %) Multiplier(V{all})
39.1 % ( 42 %) Nodeslider(V{all})
25.3 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
46.1 % ( 45 %) Dirichlet(Revmat{all})
62.2 % ( 46 %) Slider(Revmat{all})
25.9 % ( 28 %) Dirichlet(Pi{all})
27.8 % ( 28 %) Slider(Pi{all})
31.8 % ( 26 %) Multiplier(Alpha{1,2})
43.6 % ( 22 %) Multiplier(Alpha{3})
44.9 % ( 29 %) Slider(Pinvar{all})
10.8 % ( 13 %) ExtSPR(Tau{all},V{all})
4.0 % ( 4 %) ExtTBR(Tau{all},V{all})
12.1 % ( 9 %) NNI(Tau{all},V{all})
12.6 % ( 14 %) ParsSPR(Tau{all},V{all})
26.4 % ( 23 %) Multiplier(V{all})
38.8 % ( 35 %) Nodeslider(V{all})
25.4 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.77 0.58 0.42
2 | 166593 0.79 0.60
3 | 167251 166311 0.80
4 | 166867 166367 166611
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.77 0.58 0.43
2 | 166924 0.79 0.61
3 | 166514 167219 0.80
4 | 165797 166957 166589
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2264.44
| 1 2 |
| 1 |
| 1 2 1 2 2 2 |
| 2 2 1 2 * 2 1 1 1 |
| 2 1 2 11 2 * * 1* |
| 1 22 2 2212 * 12 2 2 11 21 |
| 2 2 1 1 1 1 2 1 1 2 1 |
| 2 11 1 2 21* 2 2 2 *|
| 1 1 1 1 2 1 2 2 |
|1 2 1 1 2 2 * 1111 2 1 |
| 1 2 22 1 2 1 1 11 2 |
| 1 1 2 2 2 * |
| 2 2 2 |
| |
|2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2268.95
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2261.27 -2277.12
2 -2260.41 -2280.46
--------------------------------------
TOTAL -2260.75 -2279.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.841505 0.009048 0.660054 1.032162 0.836592 1241.14 1303.64 1.002
r(A<->C){all} 0.084631 0.000482 0.045773 0.131166 0.082463 830.31 984.92 1.002
r(A<->G){all} 0.196191 0.001352 0.130806 0.271519 0.194246 749.50 846.99 1.000
r(A<->T){all} 0.097399 0.000851 0.042826 0.153747 0.095438 880.82 964.53 1.000
r(C<->G){all} 0.082316 0.000351 0.047246 0.118439 0.080934 1023.84 1092.23 1.000
r(C<->T){all} 0.478794 0.002611 0.382009 0.582681 0.478413 624.22 773.61 1.001
r(G<->T){all} 0.060669 0.000499 0.018914 0.104192 0.059019 839.61 904.19 1.001
pi(A){all} 0.248869 0.000222 0.221265 0.279009 0.248833 767.94 841.68 1.000
pi(C){all} 0.312882 0.000240 0.280364 0.341419 0.313027 1063.88 1109.26 1.000
pi(G){all} 0.264497 0.000228 0.236056 0.294190 0.264093 1075.30 1125.39 1.000
pi(T){all} 0.173752 0.000152 0.149313 0.197112 0.173952 1253.27 1272.81 1.000
alpha{1,2} 0.108433 0.000455 0.066212 0.148127 0.107744 1048.59 1160.22 1.001
alpha{3} 2.684284 0.818886 1.121466 4.430236 2.533277 1139.69 1298.12 1.000
pinvar{all} 0.471626 0.002580 0.367389 0.564782 0.474267 1362.89 1431.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- .....*****
12 -- ...*******
13 -- .**.......
14 -- ...**.....
15 -- .....****.
16 -- .....**...
17 -- .....**.*.
18 -- ......*.*.
19 -- ........**
20 -- .....***..
21 -- .....**.**
22 -- .......**.
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 2996 0.998001 0.000000 0.998001 0.998001 2
13 2938 0.978681 0.000942 0.978015 0.979347 2
14 2882 0.960027 0.010364 0.952698 0.967355 2
15 2177 0.725183 0.005182 0.721519 0.728847 2
16 1913 0.637242 0.007066 0.632245 0.642239 2
17 1554 0.517655 0.005653 0.513658 0.521652 2
18 1059 0.352765 0.005182 0.349101 0.356429 2
19 624 0.207861 0.000942 0.207195 0.208528 2
20 507 0.168887 0.005182 0.165223 0.172552 2
21 375 0.124917 0.004240 0.121919 0.127915 2
22 302 0.100600 0.008480 0.094604 0.106596 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.049189 0.000186 0.024571 0.075962 0.047597 1.000 2
length{all}[2] 0.011016 0.000032 0.001806 0.022244 0.010044 1.000 2
length{all}[3] 0.008623 0.000025 0.000780 0.018435 0.007790 1.000 2
length{all}[4] 0.032768 0.000121 0.012736 0.054310 0.031183 1.000 2
length{all}[5] 0.033639 0.000120 0.014508 0.056271 0.032487 1.000 2
length{all}[6] 0.067670 0.000379 0.031589 0.104736 0.065710 1.001 2
length{all}[7] 0.071300 0.000466 0.029909 0.113232 0.070105 1.000 2
length{all}[8] 0.100542 0.000596 0.058114 0.150228 0.098331 1.001 2
length{all}[9] 0.149712 0.001139 0.092393 0.219384 0.146415 1.002 2
length{all}[10] 0.085677 0.000614 0.042311 0.134838 0.082697 1.001 2
length{all}[11] 0.100863 0.000694 0.051778 0.151425 0.098435 1.001 2
length{all}[12] 0.024910 0.000121 0.005704 0.045774 0.023440 1.000 2
length{all}[13] 0.011710 0.000042 0.000821 0.024182 0.010589 1.000 2
length{all}[14] 0.019509 0.000105 0.002017 0.039712 0.018068 1.000 2
length{all}[15] 0.029416 0.000240 0.000303 0.057084 0.027097 1.000 2
length{all}[16] 0.030252 0.000232 0.003949 0.058906 0.027901 0.999 2
length{all}[17] 0.020559 0.000206 0.000022 0.046143 0.017786 1.000 2
length{all}[18] 0.033535 0.000267 0.005978 0.065030 0.030744 1.002 2
length{all}[19] 0.024811 0.000201 0.001655 0.052079 0.022826 0.999 2
length{all}[20] 0.012131 0.000096 0.000007 0.030918 0.009881 0.999 2
length{all}[21] 0.016161 0.000144 0.000055 0.038347 0.014131 1.000 2
length{all}[22] 0.011770 0.000110 0.000003 0.033536 0.008899 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004436
Maximum standard deviation of split frequencies = 0.010364
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /------------ C4 (4)
| /----------------------96---------------------+
| | \------------ C5 (5)
| |
| | /------------ C6 (6)
| | /----64----+
|----100----+ | \------------ C7 (7)
+ | /-----52----+
| | | \----------------------- C9 (9)
| | /-----73----+
| | | \----------------------------------- C8 (8)
| \----100---+
| \----------------------------------------------- C10 (10)
|
| /------------ C2 (2)
\----------------------------98---------------------------+
\------------ C3 (3)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
| /------- C4 (4)
| /----+
| | \------- C5 (5)
| |
| | /--------------- C6 (6)
| | /------+
|----+ | \---------------- C7 (7)
+ | /---+
| | | \---------------------------------- C9 (9)
| | /-----+
| | | \----------------------- C8 (8)
| \----------------------+
| \------------------- C10 (10)
|
| /--- C2 (2)
\-+
\-- C3 (3)
|----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (91 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 12 trees
95 % credible set contains 22 trees
99 % credible set contains 61 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 780
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
57 ambiguity characters in seq. 1
57 ambiguity characters in seq. 2
57 ambiguity characters in seq. 3
51 ambiguity characters in seq. 4
57 ambiguity characters in seq. 5
42 ambiguity characters in seq. 6
48 ambiguity characters in seq. 7
48 ambiguity characters in seq. 8
39 ambiguity characters in seq. 9
63 ambiguity characters in seq. 10
21 sites are removed. 59 60 61 65 66 67 68 137 155 156 167 169 170 253 254 255 256 257 258 259 260
Sequences read..
Counting site patterns.. 0:00
155 patterns at 239 / 239 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
151280 bytes for conP
21080 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
605120 bytes for conP, adjusted
0.080275 0.039687 0.021113 0.052551 0.050325 0.119617 0.008148 0.018895 0.022024 0.089566 0.081608 0.157425 0.141972 0.122599 0.009904 0.010952 0.014440 0.300000 1.300000
ntime & nrate & np: 17 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 19
lnL0 = -2507.372434
Iterating by ming2
Initial: fx= 2507.372434
x= 0.08027 0.03969 0.02111 0.05255 0.05032 0.11962 0.00815 0.01890 0.02202 0.08957 0.08161 0.15743 0.14197 0.12260 0.00990 0.01095 0.01444 0.30000 1.30000
1 h-m-p 0.0000 0.0003 620.1787 ++CYC 2488.419939 2 0.0002 29 | 0/19
2 h-m-p 0.0001 0.0005 504.9753 +CYYCCCCC 2456.852095 7 0.0004 64 | 0/19
3 h-m-p 0.0000 0.0001 2504.8733 +YYYCCC 2443.655294 5 0.0001 94 | 0/19
4 h-m-p 0.0001 0.0005 1167.7819 +YYYCCC 2402.371137 5 0.0004 124 | 0/19
5 h-m-p 0.0000 0.0002 805.2601 ++ 2374.935115 m 0.0002 146 | 0/19
6 h-m-p 0.0000 0.0000 1995.4675 +YYCCCC 2362.927033 5 0.0000 177 | 0/19
7 h-m-p 0.0001 0.0004 866.1879 ++ 2325.510003 m 0.0004 199 | 0/19
8 h-m-p 0.0000 0.0000 7645.7047 ++ 2298.688794 m 0.0000 221 | 0/19
9 h-m-p -0.0000 -0.0000 79162.9119
h-m-p: -9.59021144e-22 -4.79510572e-21 7.91629119e+04 2298.688794
.. | 0/19
10 h-m-p 0.0000 0.0003 3124.4397 +CYCCC 2269.115972 4 0.0000 270 | 0/19
11 h-m-p 0.0000 0.0002 518.3162 +CYYCYCCC 2222.061788 7 0.0002 304 | 0/19
12 h-m-p 0.0000 0.0000 2224.0655 ++ 2213.435796 m 0.0000 326 | 0/19
13 h-m-p 0.0000 0.0000 5704.4319 +YYYYCC 2208.777036 5 0.0000 355 | 0/19
14 h-m-p 0.0000 0.0000 6816.6503 +CYYYYYYC 2136.171088 7 0.0000 386 | 0/19
15 h-m-p 0.0000 0.0000 1558.6739 +CCCC 2123.290147 3 0.0000 415 | 0/19
16 h-m-p 0.0000 0.0001 533.9410 CCCCC 2120.990971 4 0.0000 445 | 0/19
17 h-m-p 0.0001 0.0007 80.4646 CCC 2120.348071 2 0.0002 471 | 0/19
18 h-m-p 0.0002 0.0016 108.9699 YCC 2119.574380 2 0.0003 496 | 0/19
19 h-m-p 0.0008 0.0158 34.9058 CC 2119.183353 1 0.0008 520 | 0/19
20 h-m-p 0.0007 0.0102 39.7013 YC 2118.448731 1 0.0018 543 | 0/19
21 h-m-p 0.0004 0.0026 159.9763 CYC 2117.850664 2 0.0004 568 | 0/19
22 h-m-p 0.0004 0.0165 140.2216 +YCCC 2114.268034 3 0.0029 596 | 0/19
23 h-m-p 0.0007 0.0033 314.0793 CCCC 2111.954377 3 0.0009 624 | 0/19
24 h-m-p 0.0021 0.0103 42.8236 CYC 2111.772407 2 0.0006 649 | 0/19
25 h-m-p 0.0089 0.0547 2.7164 CC 2111.722886 1 0.0033 673 | 0/19
26 h-m-p 0.0052 0.1565 1.7255 ++YCCC 2108.998953 3 0.0571 702 | 0/19
27 h-m-p 0.0005 0.0023 77.7662 +YCCCC 2106.356257 4 0.0012 732 | 0/19
28 h-m-p 0.0009 0.0046 36.7701 YCC 2106.073308 2 0.0005 757 | 0/19
29 h-m-p 0.0050 0.0512 4.0330 YC 2106.064068 1 0.0010 780 | 0/19
30 h-m-p 0.0962 5.8194 0.0402 ++YCCC 2104.132644 3 1.0112 809 | 0/19
31 h-m-p 1.6000 8.0000 0.0245 CCC 2102.975067 2 2.3691 854 | 0/19
32 h-m-p 1.6000 8.0000 0.0261 YCCC 2102.057953 3 2.7679 900 | 0/19
33 h-m-p 0.7443 3.7213 0.0197 YCCC 2101.403490 3 1.4415 946 | 0/19
34 h-m-p 1.4711 8.0000 0.0193 CCCC 2101.079500 3 1.7085 993 | 0/19
35 h-m-p 1.6000 8.0000 0.0077 CCC 2100.979969 2 1.7113 1038 | 0/19
36 h-m-p 1.6000 8.0000 0.0074 YC 2100.940863 1 1.1651 1080 | 0/19
37 h-m-p 1.2801 8.0000 0.0067 YC 2100.925441 1 1.0468 1122 | 0/19
38 h-m-p 1.6000 8.0000 0.0031 YC 2100.923537 1 1.1832 1164 | 0/19
39 h-m-p 1.6000 8.0000 0.0008 YC 2100.922533 1 3.2060 1206 | 0/19
40 h-m-p 1.6000 8.0000 0.0005 CC 2100.921660 1 2.1490 1249 | 0/19
41 h-m-p 0.8662 8.0000 0.0012 C 2100.921495 0 1.2984 1290 | 0/19
42 h-m-p 1.6000 8.0000 0.0002 C 2100.921374 0 2.3389 1331 | 0/19
43 h-m-p 1.0728 8.0000 0.0005 Y 2100.921293 0 2.1381 1372 | 0/19
44 h-m-p 1.6000 8.0000 0.0001 C 2100.921269 0 1.9365 1413 | 0/19
45 h-m-p 0.7699 8.0000 0.0002 Y 2100.921263 0 1.8133 1454 | 0/19
46 h-m-p 1.6000 8.0000 0.0000 ++ 2100.921248 m 8.0000 1495 | 0/19
47 h-m-p 1.6000 8.0000 0.0001 C 2100.921240 0 1.8779 1536 | 0/19
48 h-m-p 1.6000 8.0000 0.0001 Y 2100.921239 0 1.2002 1577 | 0/19
49 h-m-p 1.6000 8.0000 0.0000 C 2100.921239 0 1.6000 1618 | 0/19
50 h-m-p 0.9266 8.0000 0.0000 C 2100.921239 0 1.3366 1659 | 0/19
51 h-m-p 1.6000 8.0000 0.0000 ------C 2100.921239 0 0.0001 1706
Out..
lnL = -2100.921239
1707 lfun, 1707 eigenQcodon, 29019 P(t)
Time used: 0:11
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
0.080275 0.039687 0.021113 0.052551 0.050325 0.119617 0.008148 0.018895 0.022024 0.089566 0.081608 0.157425 0.141972 0.122599 0.009904 0.010952 0.014440 2.117719 0.718247 0.265678
ntime & nrate & np: 17 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.154044
np = 20
lnL0 = -2209.732672
Iterating by ming2
Initial: fx= 2209.732672
x= 0.08027 0.03969 0.02111 0.05255 0.05032 0.11962 0.00815 0.01890 0.02202 0.08957 0.08161 0.15743 0.14197 0.12260 0.00990 0.01095 0.01444 2.11772 0.71825 0.26568
1 h-m-p 0.0000 0.0007 570.5539 ++++ 2146.957822 m 0.0007 27 | 0/20
2 h-m-p 0.0000 0.0000 4980.2117 +YYYCCCC 2130.315884 6 0.0000 60 | 0/20
3 h-m-p 0.0000 0.0001 422.3416 CYCCC 2128.633671 4 0.0000 90 | 0/20
4 h-m-p 0.0001 0.0013 133.9376 ++YYCYCCC 2119.584158 6 0.0009 124 | 0/20
5 h-m-p 0.0001 0.0006 133.3259 +YYCCCC 2117.267730 5 0.0004 156 | 0/20
6 h-m-p 0.0001 0.0003 322.3634 +YCYCCC 2114.927779 5 0.0002 188 | 0/20
7 h-m-p 0.0003 0.0015 45.3747 +CYC 2113.948052 2 0.0012 215 | 0/20
8 h-m-p 0.0002 0.0012 44.1285 +YCCC 2113.558563 3 0.0007 244 | 0/20
9 h-m-p 0.0014 0.0076 22.2383 YC 2113.459499 1 0.0006 268 | 0/20
10 h-m-p 0.0019 0.0602 6.8906 CCC 2113.414405 2 0.0017 295 | 0/20
11 h-m-p 0.0008 0.0040 9.6175 YC 2113.366378 1 0.0014 319 | 0/20
12 h-m-p 0.0003 0.0016 21.3266 +CC 2113.281918 1 0.0011 345 | 0/20
13 h-m-p 0.0010 0.0174 23.9763 YCCC 2113.112760 3 0.0018 373 | 0/20
14 h-m-p 0.0014 0.0148 30.3732 YCCC 2112.728630 3 0.0032 401 | 0/20
15 h-m-p 0.0010 0.0156 97.5660 YC 2111.863874 1 0.0022 425 | 0/20
16 h-m-p 0.0014 0.0158 158.0635 YCCC 2110.446514 3 0.0024 453 | 0/20
17 h-m-p 0.0005 0.0026 149.5291 +YCCC 2109.520407 3 0.0015 482 | 0/20
18 h-m-p 0.0001 0.0006 127.4892 ++ 2109.093214 m 0.0006 505 | 1/20
19 h-m-p 0.0046 0.0232 8.6410 YCCC 2108.933993 3 0.0025 533 | 1/20
20 h-m-p 0.0120 0.0916 1.8362 YCCCC 2108.185918 4 0.0219 563 | 1/20
21 h-m-p 0.0018 0.0139 21.8836 ++ 2097.376224 m 0.0139 586 | 0/20
22 h-m-p 0.0000 0.0000 4.2102
h-m-p: 2.69892047e-20 1.34946024e-19 4.21016546e+00 2097.376224
.. | 0/20
23 h-m-p 0.0000 0.0007 12479.3625 CYYCYCCC 2091.389270 7 0.0000 640 | 0/20
24 h-m-p 0.0001 0.0003 190.2500 +YYCYCC 2086.533026 5 0.0002 671 | 0/20
25 h-m-p 0.0000 0.0002 338.4135 +YCYCCC 2084.212444 5 0.0001 703 | 0/20
26 h-m-p 0.0001 0.0004 546.8495 YCCC 2079.979684 3 0.0001 731 | 0/20
27 h-m-p 0.0000 0.0002 708.2810 YCCCC 2076.110920 4 0.0001 761 | 0/20
28 h-m-p 0.0001 0.0003 300.0607 YCYCCC 2073.767015 5 0.0001 792 | 0/20
29 h-m-p 0.0001 0.0007 79.9530 CCC 2073.457305 2 0.0001 819 | 0/20
30 h-m-p 0.0010 0.0063 11.5298 YC 2073.426043 1 0.0005 843 | 0/20
31 h-m-p 0.0003 0.0106 15.6163 CC 2073.395239 1 0.0005 868 | 0/20
32 h-m-p 0.0005 0.0311 15.2001 YC 2073.340313 1 0.0011 892 | 0/20
33 h-m-p 0.0005 0.0226 31.2191 YCC 2073.243838 2 0.0010 918 | 0/20
34 h-m-p 0.0004 0.0076 87.5100 +CCC 2072.752665 2 0.0018 946 | 0/20
35 h-m-p 0.0007 0.0033 203.6094 CCC 2072.336856 2 0.0006 973 | 0/20
36 h-m-p 0.0005 0.0051 259.9502 YCCC 2071.422417 3 0.0011 1001 | 0/20
37 h-m-p 0.0006 0.0047 495.4762 YCC 2070.751415 2 0.0004 1027 | 0/20
38 h-m-p 0.0016 0.0084 140.1319 CCC 2070.535172 2 0.0005 1054 | 0/20
39 h-m-p 0.0028 0.0201 26.1066 CC 2070.476316 1 0.0008 1079 | 0/20
40 h-m-p 0.0070 0.0671 3.0171 CC 2070.465910 1 0.0015 1104 | 0/20
41 h-m-p 0.0076 0.2201 0.6049 +YC 2070.083620 1 0.0708 1129 | 0/20
42 h-m-p 0.0014 0.0173 31.1693 +YCCC 2068.921643 3 0.0038 1178 | 0/20
43 h-m-p 0.0022 0.0108 24.1255 YCC 2068.770250 2 0.0009 1204 | 0/20
44 h-m-p 0.9771 8.0000 0.0222 CCC 2068.576633 2 0.8953 1231 | 0/20
45 h-m-p 1.6000 8.0000 0.0091 YC 2068.558492 1 1.1382 1275 | 0/20
46 h-m-p 1.6000 8.0000 0.0013 YC 2068.556634 1 1.1115 1319 | 0/20
47 h-m-p 1.6000 8.0000 0.0005 YC 2068.555634 1 3.2217 1363 | 0/20
48 h-m-p 1.6000 8.0000 0.0006 ++ 2068.551191 m 8.0000 1406 | 0/20
49 h-m-p 1.6000 8.0000 0.0019 CC 2068.546095 1 2.1414 1451 | 0/20
50 h-m-p 1.6000 8.0000 0.0008 YC 2068.545324 1 1.0967 1495 | 0/20
51 h-m-p 1.0384 8.0000 0.0009 C 2068.545252 0 0.8341 1538 | 0/20
52 h-m-p 1.6000 8.0000 0.0002 Y 2068.545247 0 1.0354 1581 | 0/20
53 h-m-p 1.6000 8.0000 0.0000 Y 2068.545247 0 1.1906 1624 | 0/20
54 h-m-p 1.6000 8.0000 0.0000 Y 2068.545247 0 1.0659 1667 | 0/20
55 h-m-p 1.6000 8.0000 0.0000 Y 2068.545247 0 0.6865 1710 | 0/20
56 h-m-p 1.6000 8.0000 0.0000 Y 2068.545247 0 0.4000 1753 | 0/20
57 h-m-p 0.5992 8.0000 0.0000 C 2068.545247 0 0.1498 1796 | 0/20
58 h-m-p 0.1917 8.0000 0.0000 Y 2068.545247 0 0.1917 1839 | 0/20
59 h-m-p 0.1680 8.0000 0.0000 C 2068.545247 0 0.1680 1882 | 0/20
60 h-m-p 0.3911 8.0000 0.0000 ------C 2068.545247 0 0.0000 1931
Out..
lnL = -2068.545247
1932 lfun, 5796 eigenQcodon, 65688 P(t)
Time used: 0:37
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
initial w for M2:NSpselection reset.
0.080275 0.039687 0.021113 0.052551 0.050325 0.119617 0.008148 0.018895 0.022024 0.089566 0.081608 0.157425 0.141972 0.122599 0.009904 0.010952 0.014440 2.166221 1.659473 0.574115 0.238709 2.403915
ntime & nrate & np: 17 3 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.551201
np = 22
lnL0 = -2229.820216
Iterating by ming2
Initial: fx= 2229.820216
x= 0.08027 0.03969 0.02111 0.05255 0.05032 0.11962 0.00815 0.01890 0.02202 0.08957 0.08161 0.15743 0.14197 0.12260 0.00990 0.01095 0.01444 2.16622 1.65947 0.57412 0.23871 2.40392
1 h-m-p 0.0000 0.0011 620.2799 ++++ 2173.713999 m 0.0011 29 | 0/22
2 h-m-p 0.0005 0.0027 1062.4134 -YYCYCCC 2171.043386 6 0.0000 64 | 0/22
3 h-m-p 0.0001 0.0014 137.4325 ++ 2156.446829 m 0.0014 89 | 0/22
4 h-m-p 0.0000 0.0001 4021.8105 +YYYCCC 2148.540455 5 0.0000 122 | 0/22
5 h-m-p 0.0005 0.0027 100.8571 +YCCCC 2143.781780 4 0.0016 155 | 0/22
6 h-m-p 0.0006 0.0031 71.8566 +YYCCC 2139.354541 4 0.0023 187 | 0/22
7 h-m-p 0.0001 0.0007 184.6155 ++ 2135.652275 m 0.0007 212 | 1/22
8 h-m-p 0.0007 0.0035 91.8131 YCCCCC 2133.343820 5 0.0015 246 | 1/22
9 h-m-p 0.0024 0.0118 52.4146 CCCC 2131.065363 3 0.0032 277 | 1/22
10 h-m-p 0.0020 0.0100 53.9680 YCCCCC 2127.430960 5 0.0042 311 | 1/22
11 h-m-p 0.0013 0.0065 89.3588 CCCCC 2125.417189 4 0.0015 344 | 1/22
12 h-m-p 0.0011 0.0053 41.2526 +YCCCC 2122.936966 4 0.0033 377 | 1/22
13 h-m-p 0.0011 0.0054 38.5033 +YCCC 2121.193141 3 0.0029 408 | 1/22
14 h-m-p 0.0063 0.0443 18.1106 YCCC 2120.809917 3 0.0031 438 | 1/22
15 h-m-p 0.0017 0.0409 32.9848 +CCCC 2118.604270 3 0.0096 470 | 1/22
16 h-m-p 0.0023 0.0129 137.9387 +YCCC 2112.872183 3 0.0059 501 | 1/22
17 h-m-p 0.0049 0.0245 113.8710 YCYC 2106.904996 3 0.0081 530 | 1/22
18 h-m-p 0.0040 0.0200 90.4352 CCC 2104.211253 2 0.0045 559 | 1/22
19 h-m-p 0.0040 0.0199 40.4015 CCCC 2103.053218 3 0.0045 590 | 0/22
20 h-m-p 0.0017 0.0086 100.3382 YCYCCC 2102.075097 5 0.0009 623 | 0/22
21 h-m-p 0.0035 0.0779 25.1523 ++YYCCC 2094.318928 4 0.0496 656 | 0/22
22 h-m-p 0.0027 0.0134 170.5803 YCCCC 2088.294291 4 0.0062 688 | 0/22
23 h-m-p 0.0295 0.1476 5.5534 YCCCC 2086.461865 4 0.0674 720 | 0/22
24 h-m-p 0.1789 0.8944 0.4919 +YYYCCC 2080.529438 5 0.6321 753 | 0/22
25 h-m-p 0.1352 0.6759 1.0411 +YCYCCC 2077.806422 5 0.3815 809 | 0/22
26 h-m-p 0.1047 0.5236 0.9183 YCCC 2076.113808 3 0.2119 839 | 0/22
27 h-m-p 0.1365 0.6823 0.5684 CCCC 2074.980002 3 0.2115 892 | 0/22
28 h-m-p 0.1484 5.9888 0.8099 +CCC 2073.909791 2 0.5669 944 | 0/22
29 h-m-p 0.3132 1.5693 1.4663 YYYC 2073.068548 3 0.2947 994 | 0/22
30 h-m-p 0.2657 2.3956 1.6259 YCCC 2071.838499 3 0.5925 1024 | 0/22
31 h-m-p 0.4690 2.3452 1.5260 CCCCC 2070.837953 4 0.6083 1057 | 0/22
32 h-m-p 0.8119 5.1279 1.1433 CCC 2070.315655 2 0.6377 1086 | 0/22
33 h-m-p 0.7798 4.7216 0.9350 YCCC 2070.047725 3 0.5284 1116 | 0/22
34 h-m-p 0.3754 4.7282 1.3159 CCC 2069.808554 2 0.4986 1167 | 0/22
35 h-m-p 0.7427 6.5493 0.8835 CC 2069.642441 1 0.7368 1194 | 0/22
36 h-m-p 0.8087 7.3025 0.8049 CYC 2069.500670 2 0.7901 1244 | 0/22
37 h-m-p 1.0787 8.0000 0.5896 CCC 2069.370645 2 0.9629 1295 | 0/22
38 h-m-p 0.5666 7.8107 1.0019 CCCC 2069.237578 3 0.7693 1348 | 0/22
39 h-m-p 0.6371 7.6310 1.2097 CCC 2069.060892 2 0.9031 1377 | 0/22
40 h-m-p 0.8208 5.2160 1.3310 CCC 2068.870732 2 0.8963 1406 | 0/22
41 h-m-p 1.3576 6.7880 0.6367 YC 2068.795115 1 0.5463 1432 | 0/22
42 h-m-p 0.7306 8.0000 0.4761 CC 2068.749559 1 0.6724 1481 | 0/22
43 h-m-p 1.6000 8.0000 0.1956 YC 2068.714668 1 1.0720 1529 | 0/22
44 h-m-p 0.4793 8.0000 0.4375 +CCC 2068.647620 2 1.7081 1581 | 0/22
45 h-m-p 1.3177 8.0000 0.5671 YC 2068.622372 1 0.6506 1629 | 0/22
46 h-m-p 0.5985 8.0000 0.6166 CC 2068.606455 1 0.7560 1678 | 0/22
47 h-m-p 1.6000 8.0000 0.1867 YC 2068.601503 1 0.7925 1726 | 0/22
48 h-m-p 0.3093 8.0000 0.4783 +CC 2068.590641 1 1.6986 1776 | 0/22
49 h-m-p 1.0939 8.0000 0.7427 +YC 2068.567297 1 3.0718 1825 | 0/22
50 h-m-p 1.6000 8.0000 1.1721 YC 2068.558899 1 0.8688 1873 | 0/22
51 h-m-p 1.2508 8.0000 0.8142 CY 2068.554957 1 1.3887 1900 | 0/22
52 h-m-p 1.3136 8.0000 0.8607 C 2068.552742 0 1.3136 1947 | 0/22
53 h-m-p 0.7374 8.0000 1.5333 CC 2068.550185 1 1.0584 1996 | 0/22
54 h-m-p 1.4631 8.0000 1.1092 CC 2068.548393 1 1.2280 2023 | 0/22
55 h-m-p 0.9759 8.0000 1.3958 YC 2068.546361 1 1.6821 2049 | 0/22
56 h-m-p 1.6000 8.0000 1.0862 YC 2068.545712 1 1.2472 2075 | 0/22
57 h-m-p 1.6000 8.0000 0.6214 YC 2068.545598 1 0.9072 2101 | 0/22
58 h-m-p 0.9666 8.0000 0.5832 C 2068.545535 0 1.5324 2148 | 0/22
59 h-m-p 1.5395 8.0000 0.5805 YC 2068.545407 1 3.8447 2196 | 0/22
60 h-m-p 1.6000 8.0000 1.0436 C 2068.545310 0 1.8074 2243 | 0/22
61 h-m-p 1.6000 8.0000 0.1104 Y 2068.545300 0 0.8340 2268 | 0/22
62 h-m-p 0.1152 8.0000 0.7995 +Y 2068.545293 0 0.8545 2316 | 0/22
63 h-m-p 1.3336 8.0000 0.5123 +Y 2068.545265 0 6.2793 2364 | 0/22
64 h-m-p 1.6000 8.0000 1.1934 C 2068.545255 0 1.3302 2411 | 0/22
65 h-m-p 0.9704 8.0000 1.6359 ---------C 2068.545255 0 0.0000 2445 | 0/22
66 h-m-p 0.0160 8.0000 0.0024 ++Y 2068.545254 0 0.6133 2472 | 0/22
67 h-m-p 1.6000 8.0000 0.0000 Y 2068.545254 0 0.8723 2519 | 0/22
68 h-m-p 1.6000 8.0000 0.0000 Y 2068.545254 0 0.7815 2566 | 0/22
69 h-m-p 0.4064 8.0000 0.0000 --------------Y 2068.545254 0 0.0000 2627
Out..
lnL = -2068.545254
2628 lfun, 10512 eigenQcodon, 134028 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2089.259438 S = -2028.003680 -52.925837
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 155 patterns 1:29
did 20 / 155 patterns 1:29
did 30 / 155 patterns 1:29
did 40 / 155 patterns 1:29
did 50 / 155 patterns 1:29
did 60 / 155 patterns 1:29
did 70 / 155 patterns 1:29
did 80 / 155 patterns 1:29
did 90 / 155 patterns 1:29
did 100 / 155 patterns 1:29
did 110 / 155 patterns 1:29
did 120 / 155 patterns 1:29
did 130 / 155 patterns 1:29
did 140 / 155 patterns 1:29
did 150 / 155 patterns 1:29
did 155 / 155 patterns 1:30
Time used: 1:30
Model 3: discrete
TREE # 1
(1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
0.080275 0.039687 0.021113 0.052551 0.050325 0.119617 0.008148 0.018895 0.022024 0.089566 0.081608 0.157425 0.141972 0.122599 0.009904 0.010952 0.014440 2.166217 0.339697 0.499728 0.023125 0.048622 0.094617
ntime & nrate & np: 17 4 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.242541
np = 23
lnL0 = -2100.828350
Iterating by ming2
Initial: fx= 2100.828350
x= 0.08027 0.03969 0.02111 0.05255 0.05032 0.11962 0.00815 0.01890 0.02202 0.08957 0.08161 0.15743 0.14197 0.12260 0.00990 0.01095 0.01444 2.16622 0.33970 0.49973 0.02313 0.04862 0.09462
1 h-m-p 0.0000 0.0001 441.7981 ++ 2088.200339 m 0.0001 28 | 1/23
2 h-m-p 0.0000 0.0002 257.6130 ++ 2080.675231 m 0.0002 54 | 2/23
3 h-m-p 0.0000 0.0002 336.5309 +YYCCCC 2078.146790 5 0.0001 89 | 2/23
4 h-m-p 0.0001 0.0007 285.3621 CCCC 2076.678365 3 0.0001 121 | 2/23
5 h-m-p 0.0003 0.0015 44.0234 YCC 2076.487636 2 0.0002 150 | 2/23
6 h-m-p 0.0005 0.0042 21.3342 CCC 2076.411264 2 0.0004 180 | 2/23
7 h-m-p 0.0008 0.0215 11.2137 CC 2076.375493 1 0.0007 208 | 2/23
8 h-m-p 0.0004 0.0071 19.5364 YC 2076.317970 1 0.0008 235 | 2/23
9 h-m-p 0.0004 0.0262 35.7748 +YC 2075.976658 1 0.0030 263 | 2/23
10 h-m-p 0.0005 0.0047 203.4824 YCCC 2075.192459 3 0.0012 294 | 2/23
11 h-m-p 0.0009 0.0096 273.0707 YCCC 2073.567004 3 0.0018 325 | 2/23
12 h-m-p 0.0005 0.0027 385.4874 CCC 2072.829603 2 0.0006 355 | 2/23
13 h-m-p 0.0019 0.0093 88.1901 CCC 2072.695238 2 0.0005 385 | 1/23
14 h-m-p 0.0001 0.0021 412.0709 CYC 2072.525248 2 0.0000 414 | 1/23
15 h-m-p 0.0008 0.0145 15.5112 YCC 2072.494440 2 0.0006 443 | 1/23
16 h-m-p 0.0024 0.0685 4.1653 CC 2072.486985 1 0.0009 471 | 1/23
17 h-m-p 0.0009 0.0254 4.2970 C 2072.480413 0 0.0009 497 | 1/23
18 h-m-p 0.0007 0.2123 5.9100 ++YC 2072.201921 1 0.0262 526 | 1/23
19 h-m-p 0.0009 0.0045 146.1264 CCC 2071.997866 2 0.0008 556 | 1/23
20 h-m-p 0.0011 0.0089 107.8596 CCC 2071.773145 2 0.0011 586 | 1/23
21 h-m-p 0.0354 0.1769 1.0662 YCC 2071.755241 2 0.0066 615 | 1/23
22 h-m-p 0.0012 0.1084 5.7185 ++YCCCC 2070.965767 4 0.0371 650 | 1/23
23 h-m-p 0.1692 1.0058 1.2519 CC 2070.654709 1 0.1705 678 | 1/23
24 h-m-p 0.6445 3.2225 0.3103 YCCC 2069.193765 3 1.2936 709 | 1/23
25 h-m-p 1.0419 5.2096 0.3070 CCCC 2068.440269 3 1.2672 763 | 1/23
26 h-m-p 1.5831 7.9156 0.0624 CYC 2068.043903 2 1.5512 814 | 0/23
27 h-m-p 0.0062 0.0311 13.6345 YCC 2068.035292 2 0.0009 865 | 0/23
28 h-m-p 0.0952 8.0000 0.1288 ++CCC 2067.883265 2 1.4805 897 | 0/23
29 h-m-p 0.3918 1.9590 0.0268 +C 2067.851951 0 1.5672 947 | 0/23
30 h-m-p 0.0352 0.1761 0.0232 ++ 2067.844580 m 0.1761 996 | 1/23
31 h-m-p 0.0359 7.2788 0.1079 +YC 2067.843503 1 0.0940 1047 | 0/23
32 h-m-p 0.0000 0.0006 1249.7093 --Y 2067.843502 0 0.0000 1097 | 0/23
33 h-m-p 0.0470 8.0000 0.0076 -------------C 2067.843502 0 0.0000 1136 | 1/23
34 h-m-p 0.0093 4.6724 0.0379 ++YC 2067.818296 1 0.3155 1188 | 1/23
35 h-m-p 0.5797 8.0000 0.0206 YC 2067.811815 1 1.0211 1237 | 1/23
36 h-m-p 1.6000 8.0000 0.0048 YC 2067.811595 1 1.0139 1286 | 1/23
37 h-m-p 1.6000 8.0000 0.0015 Y 2067.811563 0 2.9686 1334 | 1/23
38 h-m-p 1.2523 8.0000 0.0035 ++ 2067.811427 m 8.0000 1382 | 1/23
39 h-m-p 1.6000 8.0000 0.0089 C 2067.811331 0 1.7534 1430 | 1/23
40 h-m-p 1.6000 8.0000 0.0033 Y 2067.811322 0 1.1124 1478 | 1/23
41 h-m-p 1.6000 8.0000 0.0001 Y 2067.811322 0 1.0159 1526 | 1/23
42 h-m-p 1.6000 8.0000 0.0000 +C 2067.811322 0 5.5267 1575 | 1/23
43 h-m-p 1.6000 8.0000 0.0000 ++ 2067.811322 m 8.0000 1623 | 1/23
44 h-m-p 0.2122 8.0000 0.0002 ++Y 2067.811321 0 2.3864 1673 | 1/23
45 h-m-p 1.6000 8.0000 0.0000 ++ 2067.811311 m 8.0000 1721 | 1/23
46 h-m-p 0.0160 8.0000 0.0405 +++YC 2067.807410 1 2.2274 1773 | 1/23
47 h-m-p 1.6000 8.0000 0.0483 ++ 2067.782172 m 8.0000 1821 | 0/23
48 h-m-p 0.0045 1.1605 86.7553 -C 2067.781952 0 0.0003 1870 | 0/23
49 h-m-p 0.0185 0.0925 0.1342 ++ 2067.773337 m 0.0925 1896 | 1/23
50 h-m-p 0.0031 0.5837 4.0055 +YCCC 2067.715632 3 0.0211 1951 | 1/23
51 h-m-p 0.1060 8.0000 0.7968 +YCCCCC 2067.655653 5 0.4622 1987 | 1/23
52 h-m-p 1.6000 8.0000 0.1651 YCCC 2067.635018 3 1.0194 2040 | 1/23
53 h-m-p 1.2302 8.0000 0.1368 YCCC 2067.501289 3 2.3421 2093 | 0/23
54 h-m-p 0.0071 0.1849 45.2239 ---YC 2067.500458 1 0.0000 2145 | 0/23
55 h-m-p 0.0784 0.3919 0.0156 ++ 2067.472201 m 0.3919 2171 | 1/23
56 h-m-p 0.0163 3.1535 0.3732 ++CYC 2067.235708 2 0.2366 2225 | 1/23
57 h-m-p 0.0471 3.0493 1.8760 +CCCCC 2066.723153 4 0.2585 2282 | 1/23
58 h-m-p 1.3407 8.0000 0.3618 YCCC 2066.457623 3 0.9014 2313 | 0/23
59 h-m-p 0.0001 0.0024 4468.6111 YCC 2066.366034 2 0.0000 2364 | 0/23
60 h-m-p 0.2617 1.3083 0.3306 ++ 2065.112072 m 1.3083 2390 | 1/23
61 h-m-p 0.3648 6.6865 1.1855 YCCC 2064.735508 3 0.2566 2444 | 1/23
62 h-m-p 0.4650 8.0000 0.6541 YCCC 2064.459436 3 0.8608 2475 | 1/23
63 h-m-p 1.6000 8.0000 0.0215 CC 2064.415294 1 1.7357 2525 | 1/23
64 h-m-p 1.4337 8.0000 0.0261 CC 2064.401451 1 2.2430 2575 | 1/23
65 h-m-p 1.6000 8.0000 0.0318 YC 2064.383912 1 3.3189 2624 | 1/23
66 h-m-p 1.6000 8.0000 0.0246 YC 2064.380896 1 1.1831 2673 | 1/23
67 h-m-p 1.6000 8.0000 0.0045 Y 2064.380865 0 1.1690 2721 | 1/23
68 h-m-p 1.6000 8.0000 0.0004 C 2064.380864 0 2.0196 2769 | 1/23
69 h-m-p 1.6000 8.0000 0.0002 ++ 2064.380860 m 8.0000 2817 | 1/23
70 h-m-p 1.6000 8.0000 0.0004 Y 2064.380859 0 1.1177 2865 | 1/23
71 h-m-p 1.6000 8.0000 0.0000 Y 2064.380859 0 1.1406 2913 | 1/23
72 h-m-p 1.6000 8.0000 0.0000 Y 2064.380859 0 0.4000 2961 | 1/23
73 h-m-p 0.4635 8.0000 0.0000 Y 2064.380859 0 0.4635 3009 | 1/23
74 h-m-p 0.8680 8.0000 0.0000 ----C 2064.380859 0 0.0008 3061
Out..
lnL = -2064.380859
3062 lfun, 12248 eigenQcodon, 156162 P(t)
Time used: 2:29
Model 7: beta
TREE # 1
(1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
0.080275 0.039687 0.021113 0.052551 0.050325 0.119617 0.008148 0.018895 0.022024 0.089566 0.081608 0.157425 0.141972 0.122599 0.009904 0.010952 0.014440 2.108246 0.309823 1.349954
ntime & nrate & np: 17 1 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.698105
np = 20
lnL0 = -2114.961859
Iterating by ming2
Initial: fx= 2114.961859
x= 0.08027 0.03969 0.02111 0.05255 0.05032 0.11962 0.00815 0.01890 0.02202 0.08957 0.08161 0.15743 0.14197 0.12260 0.00990 0.01095 0.01444 2.10825 0.30982 1.34995
1 h-m-p 0.0000 0.0008 473.5543 ++YYCCC 2101.851173 4 0.0002 33 | 0/20
2 h-m-p 0.0001 0.0006 256.5609 +YYCYCCC 2083.979930 6 0.0005 66 | 0/20
3 h-m-p 0.0000 0.0001 1210.7597 +YYCCC 2077.818414 4 0.0001 96 | 0/20
4 h-m-p 0.0000 0.0002 611.2288 CYCCC 2075.310133 4 0.0001 126 | 0/20
5 h-m-p 0.0001 0.0003 80.0485 CYCCC 2074.934873 4 0.0001 156 | 0/20
6 h-m-p 0.0002 0.0014 53.8682 YCCC 2074.570526 3 0.0004 184 | 0/20
7 h-m-p 0.0009 0.0055 20.5293 YCC 2074.448766 2 0.0007 210 | 0/20
8 h-m-p 0.0006 0.0038 26.1272 YCC 2074.373824 2 0.0005 236 | 0/20
9 h-m-p 0.0009 0.0141 13.0330 CC 2074.326843 1 0.0009 261 | 0/20
10 h-m-p 0.0006 0.0278 20.2995 +CCC 2074.145788 2 0.0025 289 | 0/20
11 h-m-p 0.0011 0.0091 47.1733 CCC 2073.866248 2 0.0017 316 | 0/20
12 h-m-p 0.0007 0.0091 117.3945 CCCC 2073.416926 3 0.0011 345 | 0/20
13 h-m-p 0.0009 0.0043 61.2520 YCC 2073.287377 2 0.0007 371 | 0/20
14 h-m-p 0.0072 0.0519 5.6550 -YC 2073.276960 1 0.0009 396 | 0/20
15 h-m-p 0.0014 0.0631 3.5709 YC 2073.273046 1 0.0007 420 | 0/20
16 h-m-p 0.0041 0.0899 0.6233 CC 2073.263129 1 0.0061 445 | 0/20
17 h-m-p 0.0006 0.0917 6.0802 ++YC 2073.113160 1 0.0066 491 | 0/20
18 h-m-p 0.0008 0.0217 48.6137 +CCCC 2071.923335 3 0.0058 521 | 0/20
19 h-m-p 0.0024 0.0119 30.0368 CC 2071.829399 1 0.0008 546 | 0/20
20 h-m-p 0.0075 0.0812 3.1438 YC 2071.782676 1 0.0035 570 | 0/20
21 h-m-p 0.0013 0.0633 8.8657 ++CCCCC 2070.792587 4 0.0248 603 | 0/20
22 h-m-p 0.7256 5.3517 0.3029 YCCC 2069.613159 3 1.8304 631 | 0/20
23 h-m-p 0.3992 1.9959 0.5228 CCCCC 2069.135767 4 0.5651 682 | 0/20
24 h-m-p 1.1747 5.8737 0.1221 YCC 2068.937146 2 0.8158 728 | 0/20
25 h-m-p 1.4241 8.0000 0.0699 YCC 2068.911261 2 0.8207 774 | 0/20
26 h-m-p 1.6000 8.0000 0.0164 YC 2068.903206 1 0.9516 818 | 0/20
27 h-m-p 1.6000 8.0000 0.0045 YC 2068.902113 1 1.2160 862 | 0/20
28 h-m-p 1.6000 8.0000 0.0018 YC 2068.902023 1 0.9180 906 | 0/20
29 h-m-p 1.6000 8.0000 0.0007 Y 2068.902008 0 0.9486 949 | 0/20
30 h-m-p 1.6000 8.0000 0.0002 C 2068.902002 0 1.3566 992 | 0/20
31 h-m-p 1.6000 8.0000 0.0000 Y 2068.902002 0 0.9288 1035 | 0/20
32 h-m-p 1.6000 8.0000 0.0000 Y 2068.902002 0 0.8276 1078 | 0/20
33 h-m-p 1.6000 8.0000 0.0000 C 2068.902002 0 0.4000 1121 | 0/20
34 h-m-p 1.0332 8.0000 0.0000 Y 2068.902002 0 0.5604 1164 | 0/20
35 h-m-p 1.2422 8.0000 0.0000 Y 2068.902002 0 0.3106 1207 | 0/20
36 h-m-p 0.5149 8.0000 0.0000 --------------Y 2068.902002 0 0.0000 1264
Out..
lnL = -2068.902002
1265 lfun, 13915 eigenQcodon, 215050 P(t)
Time used: 3:52
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
initial w for M8:NSbetaw>1 reset.
0.080275 0.039687 0.021113 0.052551 0.050325 0.119617 0.008148 0.018895 0.022024 0.089566 0.081608 0.157425 0.141972 0.122599 0.009904 0.010952 0.014440 2.113176 0.900000 0.966220 1.075304 2.140227
ntime & nrate & np: 17 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.849983
np = 22
lnL0 = -2233.596593
Iterating by ming2
Initial: fx= 2233.596593
x= 0.08027 0.03969 0.02111 0.05255 0.05032 0.11962 0.00815 0.01890 0.02202 0.08957 0.08161 0.15743 0.14197 0.12260 0.00990 0.01095 0.01444 2.11318 0.90000 0.96622 1.07530 2.14023
1 h-m-p 0.0000 0.0004 600.1204 ++YYCCC 2213.718324 4 0.0002 35 | 0/22
2 h-m-p 0.0000 0.0002 276.8598 ++ 2203.144690 m 0.0002 60 | 0/22
3 h-m-p 0.0002 0.0011 168.1300 +YCYCCC 2191.566503 5 0.0009 94 | 0/22
4 h-m-p 0.0001 0.0003 1393.0295 ++ 2149.637811 m 0.0003 119 | 0/22
5 h-m-p 0.0000 0.0000 32369.2328
h-m-p: 1.02604660e-22 5.13023298e-22 3.23692328e+04 2149.637811
.. | 0/22
6 h-m-p 0.0000 0.0004 303.5079 ++YCYC 2139.899808 3 0.0003 173 | 0/22
7 h-m-p 0.0002 0.0009 330.4159 +CYCCC 2111.809731 4 0.0008 207 | 0/22
8 h-m-p 0.0001 0.0003 753.7699 +YYCYCCC 2087.070299 6 0.0003 242 | 0/22
9 h-m-p 0.0000 0.0001 2089.0549 CYCCC 2083.967983 4 0.0000 274 | 0/22
10 h-m-p 0.0000 0.0002 406.6826 CCCCC 2082.563695 4 0.0000 307 | 0/22
11 h-m-p 0.0001 0.0006 56.7331 CCCC 2082.251375 3 0.0002 338 | 0/22
12 h-m-p 0.0001 0.0006 120.8847 +YCCC 2081.399440 3 0.0003 369 | 0/22
13 h-m-p 0.0002 0.0011 225.8403 YC 2080.933959 1 0.0001 395 | 0/22
14 h-m-p 0.0003 0.0026 96.5519 CCC 2080.436623 2 0.0003 424 | 0/22
15 h-m-p 0.0004 0.0041 78.0183 CCC 2079.753420 2 0.0007 453 | 0/22
16 h-m-p 0.0004 0.0022 82.2060 CCCC 2079.046535 3 0.0007 484 | 0/22
17 h-m-p 0.0002 0.0020 373.4515 +CYC 2076.592157 2 0.0006 513 | 0/22
18 h-m-p 0.0009 0.0044 251.7636 CCCC 2073.113604 3 0.0013 544 | 0/22
19 h-m-p 0.0004 0.0018 151.2966 CCC 2072.523016 2 0.0004 573 | 0/22
20 h-m-p 0.0020 0.0101 19.2289 CC 2072.464533 1 0.0005 600 | 0/22
21 h-m-p 0.0013 0.0160 6.9496 YC 2072.448680 1 0.0006 626 | 0/22
22 h-m-p 0.0013 0.0482 3.1494 YC 2072.402449 1 0.0032 652 | 0/22
23 h-m-p 0.0008 0.0209 12.9351 +CCC 2072.091595 2 0.0039 682 | 0/22
24 h-m-p 0.0006 0.0032 82.4556 +YCYCCC 2071.026915 5 0.0017 716 | 0/22
25 h-m-p 0.0008 0.0042 109.3825 CCC 2070.392108 2 0.0009 745 | 0/22
26 h-m-p 0.0077 0.0386 5.6875 CCC 2070.351404 2 0.0017 774 | 0/22
27 h-m-p 0.0068 0.2939 1.4278 ++YCYCCC 2065.927319 5 0.2019 809 | 0/22
28 h-m-p 0.2990 2.5385 0.9642 YCCC 2065.679160 3 0.2129 839 | 0/22
29 h-m-p 0.3473 1.7363 0.5825 CCCC 2064.953198 3 0.5411 892 | 0/22
30 h-m-p 1.0985 5.4925 0.0858 CC 2064.786970 1 1.1380 941 | 0/22
31 h-m-p 1.2562 8.0000 0.0777 YCC 2064.737216 2 0.8771 991 | 0/22
32 h-m-p 1.2061 8.0000 0.0565 YC 2064.717377 1 0.8811 1039 | 0/22
33 h-m-p 1.6000 8.0000 0.0271 YC 2064.702211 1 1.1122 1087 | 0/22
34 h-m-p 0.8661 8.0000 0.0348 YC 2064.689949 1 2.0912 1135 | 0/22
35 h-m-p 1.6000 8.0000 0.0286 YC 2064.677341 1 3.6890 1183 | 0/22
36 h-m-p 1.4170 8.0000 0.0745 YC 2064.656105 1 2.7934 1231 | 0/22
37 h-m-p 1.6000 8.0000 0.0650 CCC 2064.638740 2 2.4192 1282 | 0/22
38 h-m-p 1.6000 8.0000 0.0369 YC 2064.623395 1 2.7188 1330 | 0/22
39 h-m-p 1.6000 8.0000 0.0353 YC 2064.620992 1 1.2537 1378 | 0/22
40 h-m-p 1.6000 8.0000 0.0179 YC 2064.620715 1 0.9033 1426 | 0/22
41 h-m-p 1.6000 8.0000 0.0057 Y 2064.620654 0 1.1736 1473 | 0/22
42 h-m-p 1.6000 8.0000 0.0009 Y 2064.620651 0 1.2107 1520 | 0/22
43 h-m-p 1.6000 8.0000 0.0001 C 2064.620651 0 1.3705 1567 | 0/22
44 h-m-p 1.6000 8.0000 0.0000 C 2064.620651 0 1.4679 1614 | 0/22
45 h-m-p 1.6000 8.0000 0.0000 C 2064.620651 0 1.5296 1661 | 0/22
46 h-m-p 1.6000 8.0000 0.0000 C 2064.620651 0 1.2921 1708 | 0/22
47 h-m-p 1.6000 8.0000 0.0000 C 2064.620651 0 0.3460 1755 | 0/22
48 h-m-p 1.6000 8.0000 0.0000 ---------------Y 2064.620651 0 0.0000 1817
Out..
lnL = -2064.620651
1818 lfun, 21816 eigenQcodon, 339966 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2097.167613 S = -2028.943723 -60.019010
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 155 patterns 6:03
did 20 / 155 patterns 6:03
did 30 / 155 patterns 6:03
did 40 / 155 patterns 6:03
did 50 / 155 patterns 6:03
did 60 / 155 patterns 6:04
did 70 / 155 patterns 6:04
did 80 / 155 patterns 6:04
did 90 / 155 patterns 6:04
did 100 / 155 patterns 6:04
did 110 / 155 patterns 6:05
did 120 / 155 patterns 6:05
did 130 / 155 patterns 6:05
did 140 / 155 patterns 6:05
did 150 / 155 patterns 6:05
did 155 / 155 patterns 6:06
Time used: 6:06
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=260
D_melanogaster_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_sechellia_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_simulans_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_yakuba_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_erecta_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_takahashii_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_biarmipes_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_eugracilis_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_ficusphila_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
D_elegans_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS
**************************************************
D_melanogaster_CG13024-PC PSNTSSIH---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_sechellia_CG13024-PC PSNSGSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_simulans_CG13024-PC PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_yakuba_CG13024-PC PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_erecta_CG13024-PC PSNSSNIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_takahashii_CG13024-PC PSNSSHMN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_biarmipes_CG13024-PC PSNSSSSHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_eugracilis_CG13024-PC PSNSSNANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_ficusphila_CG13024-PC PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
D_elegans_CG13024-PC PSNSSNTN---NNN----TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN
***:. : **. ********************************
D_melanogaster_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
D_sechellia_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLS
D_simulans_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA
D_yakuba_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
D_erecta_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLT
D_takahashii_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLT
D_biarmipes_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLT
D_eugracilis_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
D_ficusphila_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLT
D_elegans_CG13024-PC STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT
************************************ .:*::*******:
D_melanogaster_CG13024-PC IGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_sechellia_CG13024-PC LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_simulans_CG13024-PC LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_yakuba_CG13024-PC LASG--KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_erecta_CG13024-PC LASG--KDAVIAIEGQQP--GDVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_takahashii_CG13024-PC LATSGNKDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVN
D_biarmipes_CG13024-PC LASG--KDAVIAIEGQPP--AEVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_eugracilis_CG13024-PC LASG--KDAVIAIEGQQP--NEVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_ficusphila_CG13024-PC LATG--QDAVITIDGQQP--SEVDPNLQYVKTKDLDTVSIASSMHFTMVN
D_elegans_CG13024-PC LASG--KDAVIAIEGQ-P--EDVDPNLQYVKTKDLDTVSIASSMHFTMVN
:.:. :****:*:** ::***************************
D_melanogaster_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_sechellia_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_simulans_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_yakuba_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_erecta_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_takahashii_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_biarmipes_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_eugracilis_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_ficusphila_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
D_elegans_CG13024-PC GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP
**************************************************
D_melanogaster_CG13024-PC KSoooooo--
D_sechellia_CG13024-PC KSoooooo--
D_simulans_CG13024-PC KSoooooo--
D_yakuba_CG13024-PC KSoooo----
D_erecta_CG13024-PC KSoooooo--
D_takahashii_CG13024-PC KSo-------
D_biarmipes_CG13024-PC KSooo-----
D_eugracilis_CG13024-PC KSooo-----
D_ficusphila_CG13024-PC KS--------
D_elegans_CG13024-PC KSoooooooo
**
>D_melanogaster_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC GCTGGCATCCTCCTCGAGCTCGGCCATTAGTTCGGCCAGCTCGTCCAAGT CCTCGAACAAATCGCACTCCAATCCACCTACCCTAAACCAACGCAGTTCG CCCAGTAACACTAGCAGCATTCAC---------AATAACAATAAT----- ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCCGCTGTTCTGGCGG CTGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGACACAACAAGATGC TGATGCCC---AGTAATCCCTCCTCGTCAAACTATAATGCCAACCTGGCC ATCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA GCCA------GCCGACGTCGATCCCAACTTGCAGTATGTGAAAACCAAAG ACCTGGATACCGTATCCATCGCTAGCTCTATGCACTTCACGATGGTCAAT GGAGAGGGTGGTCCACCGAAGAAACCGAAGCGCGGTCTATGCGATCGGGG GCGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC AAGAGC------------------------ >D_sechellia_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT CCTCGAACAAATCGCACTCGAATCCGCCTACCCTAAACCAGCGCAGTTCG CCCAGTAACAGTGGCAGCATTAAC---------AATAACAATAAT----- ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCGG CAGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC TGATGCCC---AGCAATCCCTCCTCGTCCAACTATAATGCCAACCTGTCC CTCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA GCCG------GCCGACGTCGATCCCAATTTGCAGTATGTGAAAACCAAAG ACCTGGATACCGTATCCATCGCTAGCTCCATGCACTTCACGATGGTCAAT GGAGAGGGTGGTCCGCCAAAGAAACCGAAGCGTGGTCTATGCGATCGCGG ACGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC AAGAGC------------------------ >D_simulans_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT CCTCGAACAAATCGCACTCGAATCCGCCTACCCTAAACCAGCGCAGTTCG CCCAGTAACAGTAGCAGCATTAAC---------AATAACAATAAT----- ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCGG CAGCCAAGAGGGGATCGAGGAGCTCCCAGGGCTCCAGCGACAGTAACAAC AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC TGATGCCC---AGCAATCCCTCCTCGTCAAACTATAATGCTAACCTGGCC CTCGGCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGTCAGCA GCCG------GCCGACGTCGATCCCAATTTGCAGTATGTGAAAACCAAAG ACCTGGATACCGTATCCATCGCTAGCTCCATGCACTTCACGATGGTCAAT GGAGAGGGTGGTCCGCCAAAGAAACCGAAGCGTGGTCTATGCGATCGCGG ACGCCAGGTCACCGTGTTGATTGTCAGCATGAGTACCATCTTCATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_yakuba_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTACTGGCACATTCCCCGCGCCTC GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT CCTCCAACAAATCGCATTCGAATCCGCCTACCCTGAACCAGCGCAGTTCG CCCAGTAACAGTAGCAGCATTAAC---------AATAACAACAAT----- ----ACAAGTGCTGCTGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCTG CTGCCAAGAGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGTAACAAC AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC TGATGCCC---AGCAATCCCTCCTCCTCAAACTACAACGCCAACCTGACC CTCGCTAGCGGC------AAGGATGCAGTTATCGCCATCGAGGGTCAGCA GTCGTCAGCGGCCGACGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG ACCTGGATACCGTATCCATTGCTAGCTCCATGCACTTCACGATGGTCAAT GGAGAGGGTGGTCCGCCGAAGAAGCCGAAGCGCGGTCTCTGCGATCGGGG ACGCCAGGTCACCGTATTGATAGTCAGCATGAGTACCATCTTCATGCTGC TCATCATGGGCATGGTCTATGCGCTAGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_erecta_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC GCTGGCATCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCCAAGT CCTCAAACAAATCGCATTCGAATCCGCCCACACTGAACCAGCGCAGTTCG CCCAGTAACAGTAGCAACATTAAC---------AATAACAATAAT----- ----ACAAGTGCTGCAGTAACTGCGGCAGCAGCGGCGGCTGTTCTGGCTG CTGCCAAGAGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGTAACAAC AGCACGCGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC TGATGCCC---AGCAATCCCTCCACTTCAAACTACAACGCCAACCTGACT CTCGCCAGTGGC------AAGGATGCGGTTATTGCCATCGAGGGTCAGCA GCCG------GGTGACGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG ACCTGGATACCGTATCCATTGCTAGCTCCATGCATTTTACGATGGTCAAT GGAGAGGGTGGTCCGCCGAAGAAACCGAAGCGTGGTCTCTGCGATCGGGG ACGCCAGGTCACCGTGTTGATAGTCAGCATGAGTACCATCTTCATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_takahashii_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCACGCGCCTC GCTGGCCTCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT CCTCGAACAAATCGCACTCGAATCCACCCACCCTCAACCAGCGCAGTTCG CCCAGCAACAGTAGCCATATGAAT---------AACAACAATAAT----- ----ACAAGTGCTGCTGTTACGGCGGCGGCGGCGGCTGCGGTTCTGGCGG CCGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGCAACAAC AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTAACGGCAGCGAATCT GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC TGATGCCGCCCAGCAATCCCTCGTCGTCCAACTACAATGCCAACCTGACG CTGGCAACGAGCGGCAACAAGGATGCGGTAATCGCCATCGAGGGCCAGCA GCAGCCGGCGGCCGAGATGGATCCCAATTTGCAGTATGTGAAAACCAAAG ACCTGGACACCGTGTCCATCGCTAGCTCCATGCACTTTACGATGGTCAAC GGAGAGGGCGGTCCGCCCAAGAAACCGAAGCGCGGCCTCTGCGATCGGGG ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTTATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_biarmipes_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCACGCGCCTC GCTGGCCTCCTCGTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCGAAGT CCTCGAACAAATCGCACTCGAATCCGCCCACCCTTAACCAGCGCAGTTCG CCCAGCAACAGTAGCAGCAGCCATATTACCAACAATAATAGCAAT----- ----ACCAGTGCTGCTGTTACGGCGGCGGCAGCGGCGGCGGTTCTGGCGG CCGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGCAACAAC AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC TGATGCCC---GGCCATCCCACGTCGTCCAACTACAATGCCAACCTGACG CTGGCCAGCGGC------AAGGATGCGGTCATCGCCATCGAGGGCCAGCC GCCG------GCCGAGGTGGATCCCAATTTGCAGTACGTGAAAACCAAAG ACCTGGACACCGTGTCCATCGCCAGCTCCATGCACTTTACGATGGTCAAC GGCGAGGGTGGTCCGCCCAAGAAGCCCAAGCGCGGCCTCTGCGATCGGGG ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTCATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_eugracilis_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTACTGGCACATTCCCCGCGCCTC TCTGGCCTCATCCTCAAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT CCTCGAACAAATCGCACTCGAATCCGCCCACCCTCAACCAGCGGAGTTCG CCCAGCAACAGCAGCAATGCAAATAATAATAATAATAATAATAAT----- ----ACAAGTGCTGCTGTTACGGCGGCGGCTGCGGCAGCGGTACTGGCTG CTGCCAAGCGGGGATCGAGGAGTTCGCAGGGCTCCAGCGACAGTAACAAC AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGCCACAACAAGATGC TGATGCCC---AGTAATCCTTCGTCGTCCAACTACAATGCCAATCTGACG CTAGCCAGCGGC------AAGGATGCGGTTATCGCCATCGAGGGCCAACA GCCG------AACGAAGTGGATCCCAATTTGCAGTACGTGAAAACCAAAG ACCTGGACACCGTATCCATTGCGAGCTCTATGCACTTCACGATGGTCAAT GGAGAAGGTGGTCCCCCGAAGAAACCGAAGCGTGGTCTCTGCGATCGTGG ACGCCAGGTCACCGTGTTGATAGTGAGCATGAGCACCATCTTTATGCTGC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_ficusphila_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC GCTGGCCTCCTCCTCGAGCTCGGCCATCAGTTCGGCCAGCTCCTCAAAGT CCTCAAACAAGTCGCACTCGAATCCGCCCACCCTCAACCAGCGCAGTTCC CCAAGCAACAGTAGCAATGTTAATAATGTTAACAACAACAGCAACAACAA TAATACAAGTGCTGCTGTGACAGCGGCGGCAGCGGCAGCGGTACTAGCAG CTGCCAAGCGGGGATCGAGGAGTTCCCAGGGCTCCAGCGACAGCAACAAC AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGCTGACGGCAGCGAATCT GGAACGCTTCGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC TGATGCCC---GGCCATCCATCTTCGTCCAACTACAATGCCAACCTAACG CTCGCCACTGGC------CAGGATGCGGTGATCACCATCGATGGCCAGCA GCCA------TCGGAAGTGGATCCCAACTTGCAGTATGTGAAAACCAAAG ACCTGGACACCGTATCCATTGCCAGCTCGATGCACTTTACGATGGTCAAC GGCGAGGGTGGTCCGCCCAAGAAGCCCAAGCGCGGTCTCTGCGATCGAGG ACGCCAGGTCACCGTGTTGATTGTGAGCATGAGTACCATCTTCATGCTCC TCATCATGGGCATGGTCTATGCGCTGGAGATGCGCGCCCGCGACATGCCC AAGAGC------------------------ >D_elegans_CG13024-PC ATGGATGCGCCCAAGCAGATGCAGGACTATTGGCACATTCCCCGCGCCTC GCTGGCCTCTTCCTCGAGCTCGGCCATCAGTTCGGCGAGCTCCTCCAAGT CCTCGAACAAATCACACTCGAATCCGCCCACCCTGAACCAACGTAGTTCG CCCAGCAACAGTAGCAATACTAAC---------AACAATAAT-------- ----ACAAGTGCCGCAGTGACGGCCGCAGCAGCGGCAGCAGTACTGGCGG CCGCCAAGCGGGGATCGAGAAGTTCGCAGGGCTCCAGCGACAGCAACAAC AGCACACGGAGCGCTGCTTCCGGCTCACTGCTGTTGACGGCAGCGAATCT GGAACGCTTTGCGGAGATCCACAAGAAGCAGGAGCGGCACAACAAGATGC TGATGCCC---AGCAATCCCTCGTCGTCCAACTACAATGCCAACCTAACG CTCGCCAGCGGC------AAGGATGCGGTGATCGCCATCGAGGGCCAG-- -CCG------GAAGATGTTGATCCCAATTTGCAGTATGTGAAAACCAAAG ACCTGGACACCGTATCCATCGCCAGCTCCATGCACTTCACGATGGTCAAT GGGGAGGGTGGTCCGCCCAAGAAACCGAAGCGCGGTCTCTGCGATCGGGG ACGCCAGGTCACCGTGTTGATTGTGAGCATGAGCACCATCTTTATGCTGC TCATTATGGGAATGGTCTATGCGCTGGAGATGCGCGCCCGTGACATGCCC AAGAGC------------------------
>D_melanogaster_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNTSSIH---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA IGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_sechellia_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSGSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLS LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_simulans_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLA LGSG--KDAVIAIEGQQP--ADVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_yakuba_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSSIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT LASG--KDAVIAIEGQQSSAADVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_erecta_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSNIN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSTSNYNANLT LASG--KDAVIAIEGQQP--GDVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_takahashii_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSHMN---NNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMPPSNPSSSNYNANLT LATSGNKDAVIAIEGQQQPAAEMDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_biarmipes_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSSSHITNNNSN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPTSSNYNANLT LASG--KDAVIAIEGQPP--AEVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_eugracilis_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSNANNNNNNNN---TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT LASG--KDAVIAIEGQQP--NEVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_ficusphila_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSNVNNVNNNSNNNNTSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-GHPSSSNYNANLT LATG--QDAVITIDGQQP--SEVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS >D_elegans_CG13024-PC MDAPKQMQDYWHIPRASLASSSSSAISSASSSKSSNKSHSNPPTLNQRSS PSNSSNTN---NNN----TSAAVTAAAAAAVLAAAKRGSRSSQGSSDSNN STRSAASGSLLLTAANLERFAEIHKKQERHNKMLMP-SNPSSSNYNANLT LASG--KDAVIAIEGQ-P--EDVDPNLQYVKTKDLDTVSIASSMHFTMVN GEGGPPKKPKRGLCDRGRQVTVLIVSMSTIFMLLIMGMVYALEMRARDMP KS
#NEXUS
[ID: 4572354064]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_CG13024-PC
D_sechellia_CG13024-PC
D_simulans_CG13024-PC
D_yakuba_CG13024-PC
D_erecta_CG13024-PC
D_takahashii_CG13024-PC
D_biarmipes_CG13024-PC
D_eugracilis_CG13024-PC
D_ficusphila_CG13024-PC
D_elegans_CG13024-PC
;
end;
begin trees;
translate
1 D_melanogaster_CG13024-PC,
2 D_sechellia_CG13024-PC,
3 D_simulans_CG13024-PC,
4 D_yakuba_CG13024-PC,
5 D_erecta_CG13024-PC,
6 D_takahashii_CG13024-PC,
7 D_biarmipes_CG13024-PC,
8 D_eugracilis_CG13024-PC,
9 D_ficusphila_CG13024-PC,
10 D_elegans_CG13024-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.047597,((4:0.03118278,5:0.03248682)0.960:0.01806843,((((6:0.06570971,7:0.07010481)0.637:0.02790133,9:0.1464149)0.518:0.01778607,8:0.09833114)0.725:0.02709723,10:0.08269704)1.000:0.09843492)0.998:0.02344004,(2:0.01004372,3:0.00779021)0.979:0.01058887);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.047597,((4:0.03118278,5:0.03248682):0.01806843,((((6:0.06570971,7:0.07010481):0.02790133,9:0.1464149):0.01778607,8:0.09833114):0.02709723,10:0.08269704):0.09843492):0.02344004,(2:0.01004372,3:0.00779021):0.01058887);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2261.27 -2277.12
2 -2260.41 -2280.46
--------------------------------------
TOTAL -2260.75 -2279.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/59/CG13024-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.841505 0.009048 0.660054 1.032162 0.836592 1241.14 1303.64 1.002
r(A<->C){all} 0.084631 0.000482 0.045773 0.131166 0.082463 830.31 984.92 1.002
r(A<->G){all} 0.196191 0.001352 0.130806 0.271519 0.194246 749.50 846.99 1.000
r(A<->T){all} 0.097399 0.000851 0.042826 0.153747 0.095438 880.82 964.53 1.000
r(C<->G){all} 0.082316 0.000351 0.047246 0.118439 0.080934 1023.84 1092.23 1.000
r(C<->T){all} 0.478794 0.002611 0.382009 0.582681 0.478413 624.22 773.61 1.001
r(G<->T){all} 0.060669 0.000499 0.018914 0.104192 0.059019 839.61 904.19 1.001
pi(A){all} 0.248869 0.000222 0.221265 0.279009 0.248833 767.94 841.68 1.000
pi(C){all} 0.312882 0.000240 0.280364 0.341419 0.313027 1063.88 1109.26 1.000
pi(G){all} 0.264497 0.000228 0.236056 0.294190 0.264093 1075.30 1125.39 1.000
pi(T){all} 0.173752 0.000152 0.149313 0.197112 0.173952 1253.27 1272.81 1.000
alpha{1,2} 0.108433 0.000455 0.066212 0.148127 0.107744 1048.59 1160.22 1.001
alpha{3} 2.684284 0.818886 1.121466 4.430236 2.533277 1139.69 1298.12 1.000
pinvar{all} 0.471626 0.002580 0.367389 0.564782 0.474267 1362.89 1431.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/59/CG13024-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 239
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 2 2 | Ser TCT 1 0 0 0 0 0 | Tyr TAT 4 4 4 2 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 1 1 | TCC 10 13 11 13 11 9 | TAC 0 0 0 2 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 2 1 2 2 3 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 2 | TCG 10 10 10 9 8 12 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 0 0 | His CAT 0 0 0 1 2 1 | Arg CGT 1 2 1 0 1 0
CTC 1 2 2 3 3 3 | CCC 7 7 7 7 8 7 | CAC 6 5 5 4 3 5 | CGC 6 7 8 8 7 8
CTA 2 2 2 1 0 1 | CCA 3 1 1 0 0 2 | Gln CAA 1 0 0 0 0 0 | CGA 1 0 0 0 0 0
CTG 10 10 10 10 11 11 | CCG 2 4 4 4 5 3 | CAG 7 8 8 8 8 9 | CGG 2 1 1 2 2 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 3 3 4 1 | Thr ACT 2 1 1 1 3 0 | Asn AAT 7 8 8 5 6 7 | Ser AGT 7 7 7 8 9 5
ATC 7 7 7 6 5 7 | ACC 5 5 5 6 4 5 | AAC 10 10 10 13 13 11 | AGC 12 12 13 12 10 14
ATA 1 1 0 1 1 1 | ACA 1 1 1 1 2 2 | Lys AAA 4 4 4 3 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 12 12 12 12 12 14 | ACG 3 3 3 3 3 5 | AAG 10 10 10 11 10 10 | AGG 2 2 2 2 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 5 6 9 7 6 | Asp GAT 5 5 5 5 5 4 | Gly GGT 4 4 4 4 5 1
GTC 5 5 5 4 4 3 | GCC 10 8 8 8 8 10 | GAC 5 5 5 5 5 5 | GGC 5 6 5 4 4 6
GTA 2 2 2 3 2 1 | GCA 5 6 6 5 5 2 | Glu GAA 1 1 1 1 1 1 | GGA 2 3 3 3 3 3
GTG 2 2 2 2 3 4 | GCG 8 9 9 7 8 11 | GAG 5 5 5 5 5 6 | GGG 1 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 2 1 1 2 | Ser TCT 0 2 1 1 | Tyr TAT 2 1 3 3 | Cys TGT 0 0 0 0
TTC 1 2 2 1 | TCC 8 7 10 9 | TAC 2 3 1 1 | TGC 1 1 1 1
Leu TTA 0 0 0 0 | TCA 1 4 3 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 3 2 3 | TCG 13 10 10 11 | TAG 0 0 0 0 | Trp TGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 | Pro CCT 0 1 0 0 | His CAT 2 0 1 0 | Arg CGT 0 2 0 2
CTC 2 3 5 3 | CCC 9 8 8 9 | CAC 5 5 5 5 | CGC 7 6 7 5
CTA 0 1 2 1 | CCA 1 0 3 0 | Gln CAA 0 1 0 1 | CGA 0 0 1 0
CTG 12 10 8 10 | CCG 3 4 2 4 | CAG 8 7 9 7 | CGG 4 3 3 4
------------------------------------------------------------------------------------------------------
Ile ATT 1 2 3 3 | Thr ACT 0 0 1 1 | Asn AAT 6 12 5 9 | Ser AGT 5 6 6 5
ATC 7 6 6 6 | ACC 6 5 6 5 | AAC 9 8 12 10 | AGC 16 13 12 14
ATA 1 1 0 0 | ACA 1 2 3 2 | Lys AAA 3 4 2 4 | Arg AGA 0 0 0 1
Met ATG 12 12 12 12 | ACG 5 4 3 4 | AAG 11 10 11 10 | AGG 1 1 1 0
------------------------------------------------------------------------------------------------------
Val GTT 2 2 1 1 | Ala GCT 4 7 5 2 | Asp GAT 4 4 5 5 | Gly GGT 2 3 3 3
GTC 4 3 3 3 | GCC 12 9 9 12 | GAC 5 5 5 5 | GGC 8 5 7 4
GTA 0 2 2 2 | GCA 2 3 4 6 | Glu GAA 1 3 2 2 | GGA 2 3 2 3
GTG 5 4 6 5 | GCG 11 10 9 8 | GAG 6 4 4 5 | GGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG13024-PC
position 1: T:0.14644 C:0.20921 A:0.35983 G:0.28452
position 2: T:0.22176 C:0.31799 A:0.27197 G:0.18828
position 3: T:0.18410 C:0.38494 A:0.10460 G:0.32636
Average T:0.18410 C:0.30404 A:0.24547 G:0.26639
#2: D_sechellia_CG13024-PC
position 1: T:0.15063 C:0.20921 A:0.35565 G:0.28452
position 2: T:0.22176 C:0.31381 A:0.27197 G:0.19247
position 3: T:0.17573 C:0.39749 A:0.09205 G:0.33473
Average T:0.18271 C:0.30683 A:0.23989 G:0.27057
#3: D_simulans_CG13024-PC
position 1: T:0.14644 C:0.20921 A:0.35983 G:0.28452
position 2: T:0.22176 C:0.31381 A:0.27197 G:0.19247
position 3: T:0.17992 C:0.39331 A:0.09205 G:0.33473
Average T:0.18271 C:0.30544 A:0.24128 G:0.27057
#4: D_yakuba_CG13024-PC
position 1: T:0.15063 C:0.20502 A:0.36402 G:0.28033
position 2: T:0.22176 C:0.31799 A:0.27197 G:0.18828
position 3: T:0.17573 C:0.41004 A:0.08368 G:0.33054
Average T:0.18271 C:0.31102 A:0.23989 G:0.26639
#5: D_erecta_CG13024-PC
position 1: T:0.14226 C:0.20921 A:0.36820 G:0.28033
position 2: T:0.22176 C:0.31381 A:0.27615 G:0.18828
position 3: T:0.20502 C:0.36820 A:0.08787 G:0.33891
Average T:0.18968 C:0.29707 A:0.24407 G:0.26918
#6: D_takahashii_CG13024-PC
position 1: T:0.14226 C:0.22176 A:0.36402 G:0.27197
position 2: T:0.22176 C:0.31799 A:0.28033 G:0.17992
position 3: T:0.13389 C:0.40167 A:0.07950 G:0.38494
Average T:0.16597 C:0.31381 A:0.24128 G:0.27894
#7: D_biarmipes_CG13024-PC
position 1: T:0.13808 C:0.22594 A:0.35146 G:0.28452
position 2: T:0.21757 C:0.31799 A:0.26778 G:0.19665
position 3: T:0.12971 C:0.42678 A:0.05021 G:0.39331
Average T:0.16179 C:0.32357 A:0.22315 G:0.29149
#8: D_eugracilis_CG13024-PC
position 1: T:0.14644 C:0.21339 A:0.35983 G:0.28033
position 2: T:0.21757 C:0.31799 A:0.28033 G:0.18410
position 3: T:0.17992 C:0.37238 A:0.10042 G:0.34728
Average T:0.18131 C:0.30126 A:0.24686 G:0.27057
#9: D_ficusphila_CG13024-PC
position 1: T:0.14644 C:0.22594 A:0.34728 G:0.28033
position 2: T:0.22176 C:0.32218 A:0.27197 G:0.18410
position 3: T:0.14644 C:0.41423 A:0.10042 G:0.33891
Average T:0.17155 C:0.32078 A:0.23989 G:0.26778
#10: D_elegans_CG13024-PC
position 1: T:0.14644 C:0.21339 A:0.35983 G:0.28033
position 2: T:0.21757 C:0.31799 A:0.28033 G:0.18410
position 3: T:0.15481 C:0.38912 A:0.10042 G:0.35565
Average T:0.17294 C:0.30683 A:0.24686 G:0.27336
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 14 | Ser S TCT 5 | Tyr Y TAT 29 | Cys C TGT 0
TTC 16 | TCC 101 | TAC 11 | TGC 10
Leu L TTA 0 | TCA 22 | *** * TAA 0 | *** * TGA 0
TTG 27 | TCG 103 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 5 | His H CAT 7 | Arg R CGT 9
CTC 27 | CCC 77 | CAC 48 | CGC 69
CTA 12 | CCA 11 | Gln Q CAA 3 | CGA 2
CTG 102 | CCG 35 | CAG 79 | CGG 25
------------------------------------------------------------------------------
Ile I ATT 25 | Thr T ACT 10 | Asn N AAT 73 | Ser S AGT 65
ATC 64 | ACC 52 | AAC 106 | AGC 128
ATA 7 | ACA 16 | Lys K AAA 36 | Arg R AGA 1
Met M ATG 122 | ACG 36 | AAG 103 | AGG 14
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 57 | Asp D GAT 47 | Gly G GGT 33
GTC 39 | GCC 94 | GAC 50 | GGC 54
GTA 18 | GCA 44 | Glu E GAA 14 | GGA 27
GTG 35 | GCG 90 | GAG 50 | GGG 2
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14561 C:0.21423 A:0.35900 G:0.28117
position 2: T:0.22050 C:0.31715 A:0.27448 G:0.18787
position 3: T:0.16653 C:0.39582 A:0.08912 G:0.34854
Average T:0.17755 C:0.30907 A:0.24086 G:0.27252
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG13024-PC
D_sechellia_CG13024-PC 0.0815 (0.0092 0.1131)
D_simulans_CG13024-PC 0.0434 (0.0055 0.1270) 0.1544 (0.0037 0.0238)
D_yakuba_CG13024-PC 0.0515 (0.0111 0.2150) 0.0433 (0.0074 0.1700) 0.0324 (0.0055 0.1703)
D_erecta_CG13024-PC 0.0664 (0.0148 0.2228) 0.0680 (0.0111 0.1627) 0.0565 (0.0092 0.1630) 0.0610 (0.0074 0.1205)
D_takahashii_CG13024-PC 0.0605 (0.0270 0.4468) 0.0615 (0.0223 0.3623) 0.0534 (0.0204 0.3823) 0.0411 (0.0176 0.4277) 0.0432 (0.0176 0.4071)
D_biarmipes_CG13024-PC 0.0422 (0.0195 0.4630) 0.0518 (0.0186 0.3584) 0.0441 (0.0167 0.3782) 0.0382 (0.0148 0.3880) 0.0455 (0.0186 0.4077) 0.1586 (0.0252 0.1587)
D_eugracilis_CG13024-PC 0.0424 (0.0204 0.4819) 0.0408 (0.0167 0.4089) 0.0344 (0.0148 0.4302) 0.0301 (0.0129 0.4303) 0.0257 (0.0111 0.4302) 0.0608 (0.0182 0.2997) 0.0586 (0.0192 0.3275)
D_ficusphila_CG13024-PC 0.0586 (0.0300 0.5115) 0.0572 (0.0262 0.4572) 0.0529 (0.0242 0.4581) 0.0524 (0.0224 0.4268) 0.0560 (0.0227 0.4048) 0.0732 (0.0233 0.3180) 0.0654 (0.0186 0.2846) 0.0497 (0.0191 0.3832)
D_elegans_CG13024-PC 0.0363 (0.0158 0.4333) 0.0338 (0.0120 0.3552) 0.0271 (0.0101 0.3749) 0.0177 (0.0083 0.4672) 0.0148 (0.0064 0.4351) 0.0604 (0.0185 0.3068) 0.0589 (0.0176 0.2994) 0.0205 (0.0074 0.3596) 0.0644 (0.0224 0.3476)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
lnL(ntime: 17 np: 19): -2100.921239 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..16 16..17 17..6 17..7 16..9 15..8 14..10 11..18 18..2 18..3
0.077278 0.041327 0.021788 0.052864 0.058984 0.134696 0.038333 0.018761 0.039617 0.092526 0.110176 0.200167 0.140456 0.121449 0.016404 0.015363 0.011186 2.117719 0.046251
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.19138
(1: 0.077278, ((4: 0.052864, 5: 0.058984): 0.021788, ((((6: 0.092526, 7: 0.110176): 0.039617, 9: 0.200167): 0.018761, 8: 0.140456): 0.038333, 10: 0.121449): 0.134696): 0.041327, (2: 0.015363, 3: 0.011186): 0.016404);
(D_melanogaster_CG13024-PC: 0.077278, ((D_yakuba_CG13024-PC: 0.052864, D_erecta_CG13024-PC: 0.058984): 0.021788, ((((D_takahashii_CG13024-PC: 0.092526, D_biarmipes_CG13024-PC: 0.110176): 0.039617, D_ficusphila_CG13024-PC: 0.200167): 0.018761, D_eugracilis_CG13024-PC: 0.140456): 0.038333, D_elegans_CG13024-PC: 0.121449): 0.134696): 0.041327, (D_sechellia_CG13024-PC: 0.015363, D_simulans_CG13024-PC: 0.011186): 0.016404);
Detailed output identifying parameters
kappa (ts/tv) = 2.11772
omega (dN/dS) = 0.04625
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.077 563.2 153.8 0.0463 0.0048 0.1027 2.7 15.8
11..12 0.041 563.2 153.8 0.0463 0.0025 0.0549 1.4 8.4
12..13 0.022 563.2 153.8 0.0463 0.0013 0.0290 0.8 4.5
13..4 0.053 563.2 153.8 0.0463 0.0032 0.0703 1.8 10.8
13..5 0.059 563.2 153.8 0.0463 0.0036 0.0784 2.0 12.1
12..14 0.135 563.2 153.8 0.0463 0.0083 0.1790 4.7 27.5
14..15 0.038 563.2 153.8 0.0463 0.0024 0.0510 1.3 7.8
15..16 0.019 563.2 153.8 0.0463 0.0012 0.0249 0.6 3.8
16..17 0.040 563.2 153.8 0.0463 0.0024 0.0527 1.4 8.1
17..6 0.093 563.2 153.8 0.0463 0.0057 0.1230 3.2 18.9
17..7 0.110 563.2 153.8 0.0463 0.0068 0.1464 3.8 22.5
16..9 0.200 563.2 153.8 0.0463 0.0123 0.2661 6.9 40.9
15..8 0.140 563.2 153.8 0.0463 0.0086 0.1867 4.9 28.7
14..10 0.121 563.2 153.8 0.0463 0.0075 0.1614 4.2 24.8
11..18 0.016 563.2 153.8 0.0463 0.0010 0.0218 0.6 3.4
18..2 0.015 563.2 153.8 0.0463 0.0009 0.0204 0.5 3.1
18..3 0.011 563.2 153.8 0.0463 0.0007 0.0149 0.4 2.3
tree length for dN: 0.0732
tree length for dS: 1.5836
Time used: 0:11
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
lnL(ntime: 17 np: 20): -2068.545247 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..16 16..17 17..6 17..7 16..9 15..8 14..10 11..18 18..2 18..3
0.077317 0.039665 0.022639 0.051898 0.058966 0.137336 0.037988 0.019663 0.041860 0.093121 0.111548 0.208064 0.141069 0.120949 0.016474 0.015055 0.011180 2.166221 0.955631 0.015778
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.20479
(1: 0.077317, ((4: 0.051898, 5: 0.058966): 0.022639, ((((6: 0.093121, 7: 0.111548): 0.041860, 9: 0.208064): 0.019663, 8: 0.141069): 0.037988, 10: 0.120949): 0.137336): 0.039665, (2: 0.015055, 3: 0.011180): 0.016474);
(D_melanogaster_CG13024-PC: 0.077317, ((D_yakuba_CG13024-PC: 0.051898, D_erecta_CG13024-PC: 0.058966): 0.022639, ((((D_takahashii_CG13024-PC: 0.093121, D_biarmipes_CG13024-PC: 0.111548): 0.041860, D_ficusphila_CG13024-PC: 0.208064): 0.019663, D_eugracilis_CG13024-PC: 0.141069): 0.037988, D_elegans_CG13024-PC: 0.120949): 0.137336): 0.039665, (D_sechellia_CG13024-PC: 0.015055, D_simulans_CG13024-PC: 0.011180): 0.016474);
Detailed output identifying parameters
kappa (ts/tv) = 2.16622
dN/dS (w) for site classes (K=2)
p: 0.95563 0.04437
w: 0.01578 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.077 563.0 154.0 0.0594 0.0059 0.0986 3.3 15.2
11..12 0.040 563.0 154.0 0.0594 0.0030 0.0506 1.7 7.8
12..13 0.023 563.0 154.0 0.0594 0.0017 0.0289 1.0 4.4
13..4 0.052 563.0 154.0 0.0594 0.0039 0.0662 2.2 10.2
13..5 0.059 563.0 154.0 0.0594 0.0045 0.0752 2.5 11.6
12..14 0.137 563.0 154.0 0.0594 0.0104 0.1751 5.9 27.0
14..15 0.038 563.0 154.0 0.0594 0.0029 0.0484 1.6 7.5
15..16 0.020 563.0 154.0 0.0594 0.0015 0.0251 0.8 3.9
16..17 0.042 563.0 154.0 0.0594 0.0032 0.0534 1.8 8.2
17..6 0.093 563.0 154.0 0.0594 0.0071 0.1187 4.0 18.3
17..7 0.112 563.0 154.0 0.0594 0.0085 0.1422 4.8 21.9
16..9 0.208 563.0 154.0 0.0594 0.0158 0.2652 8.9 40.9
15..8 0.141 563.0 154.0 0.0594 0.0107 0.1798 6.0 27.7
14..10 0.121 563.0 154.0 0.0594 0.0092 0.1542 5.2 23.7
11..18 0.016 563.0 154.0 0.0594 0.0012 0.0210 0.7 3.2
18..2 0.015 563.0 154.0 0.0594 0.0011 0.0192 0.6 3.0
18..3 0.011 563.0 154.0 0.0594 0.0008 0.0143 0.5 2.2
Time used: 0:37
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
lnL(ntime: 17 np: 22): -2068.545254 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..16 16..17 17..6 17..7 16..9 15..8 14..10 11..18 18..2 18..3
0.077317 0.039665 0.022639 0.051898 0.058966 0.137336 0.037989 0.019663 0.041860 0.093122 0.111548 0.208065 0.141070 0.120950 0.016474 0.015055 0.011180 2.166217 0.955631 0.044369 0.015778 37.513779
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.20480
(1: 0.077317, ((4: 0.051898, 5: 0.058966): 0.022639, ((((6: 0.093122, 7: 0.111548): 0.041860, 9: 0.208065): 0.019663, 8: 0.141070): 0.037989, 10: 0.120950): 0.137336): 0.039665, (2: 0.015055, 3: 0.011180): 0.016474);
(D_melanogaster_CG13024-PC: 0.077317, ((D_yakuba_CG13024-PC: 0.051898, D_erecta_CG13024-PC: 0.058966): 0.022639, ((((D_takahashii_CG13024-PC: 0.093122, D_biarmipes_CG13024-PC: 0.111548): 0.041860, D_ficusphila_CG13024-PC: 0.208065): 0.019663, D_eugracilis_CG13024-PC: 0.141070): 0.037989, D_elegans_CG13024-PC: 0.120950): 0.137336): 0.039665, (D_sechellia_CG13024-PC: 0.015055, D_simulans_CG13024-PC: 0.011180): 0.016474);
Detailed output identifying parameters
kappa (ts/tv) = 2.16622
dN/dS (w) for site classes (K=3)
p: 0.95563 0.04437 0.00000
w: 0.01578 1.00000 37.51378
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.077 563.0 154.0 0.0594 0.0059 0.0986 3.3 15.2
11..12 0.040 563.0 154.0 0.0594 0.0030 0.0506 1.7 7.8
12..13 0.023 563.0 154.0 0.0594 0.0017 0.0289 1.0 4.4
13..4 0.052 563.0 154.0 0.0594 0.0039 0.0662 2.2 10.2
13..5 0.059 563.0 154.0 0.0594 0.0045 0.0752 2.5 11.6
12..14 0.137 563.0 154.0 0.0594 0.0104 0.1751 5.9 27.0
14..15 0.038 563.0 154.0 0.0594 0.0029 0.0484 1.6 7.5
15..16 0.020 563.0 154.0 0.0594 0.0015 0.0251 0.8 3.9
16..17 0.042 563.0 154.0 0.0594 0.0032 0.0534 1.8 8.2
17..6 0.093 563.0 154.0 0.0594 0.0071 0.1187 4.0 18.3
17..7 0.112 563.0 154.0 0.0594 0.0085 0.1422 4.8 21.9
16..9 0.208 563.0 154.0 0.0594 0.0158 0.2652 8.9 40.9
15..8 0.141 563.0 154.0 0.0594 0.0107 0.1798 6.0 27.7
14..10 0.121 563.0 154.0 0.0594 0.0092 0.1542 5.2 23.7
11..18 0.016 563.0 154.0 0.0594 0.0012 0.0210 0.7 3.2
18..2 0.015 563.0 154.0 0.0594 0.0011 0.0192 0.6 3.0
18..3 0.011 563.0 154.0 0.0594 0.0008 0.0143 0.5 2.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
57 I 0.845 2.526 +- 1.575
158 A 0.649 2.063 +- 1.407
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.415 0.255 0.143 0.080 0.044 0.025 0.015 0.010 0.007 0.006
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:30
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
lnL(ntime: 17 np: 23): -2064.380859 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..16 16..17 17..6 17..7 16..9 15..8 14..10 11..18 18..2 18..3
0.077175 0.041049 0.022252 0.053022 0.059006 0.140615 0.038611 0.020383 0.043211 0.092754 0.112831 0.209988 0.140049 0.122218 0.016386 0.015158 0.011114 2.108246 0.829897 0.157544 0.000001 0.197992 1.927432
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.21582
(1: 0.077175, ((4: 0.053022, 5: 0.059006): 0.022252, ((((6: 0.092754, 7: 0.112831): 0.043211, 9: 0.209988): 0.020383, 8: 0.140049): 0.038611, 10: 0.122218): 0.140615): 0.041049, (2: 0.015158, 3: 0.011114): 0.016386);
(D_melanogaster_CG13024-PC: 0.077175, ((D_yakuba_CG13024-PC: 0.053022, D_erecta_CG13024-PC: 0.059006): 0.022252, ((((D_takahashii_CG13024-PC: 0.092754, D_biarmipes_CG13024-PC: 0.112831): 0.043211, D_ficusphila_CG13024-PC: 0.209988): 0.020383, D_eugracilis_CG13024-PC: 0.140049): 0.038611, D_elegans_CG13024-PC: 0.122218): 0.140615): 0.041049, (D_sechellia_CG13024-PC: 0.015158, D_simulans_CG13024-PC: 0.011114): 0.016386);
Detailed output identifying parameters
kappa (ts/tv) = 2.10825
dN/dS (w) for site classes (K=3)
p: 0.82990 0.15754 0.01256
w: 0.00000 0.19799 1.92743
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.077 563.3 153.7 0.0554 0.0055 0.0998 3.1 15.3
11..12 0.041 563.3 153.7 0.0554 0.0029 0.0531 1.7 8.2
12..13 0.022 563.3 153.7 0.0554 0.0016 0.0288 0.9 4.4
13..4 0.053 563.3 153.7 0.0554 0.0038 0.0685 2.1 10.5
13..5 0.059 563.3 153.7 0.0554 0.0042 0.0763 2.4 11.7
12..14 0.141 563.3 153.7 0.0554 0.0101 0.1818 5.7 27.9
14..15 0.039 563.3 153.7 0.0554 0.0028 0.0499 1.6 7.7
15..16 0.020 563.3 153.7 0.0554 0.0015 0.0263 0.8 4.0
16..17 0.043 563.3 153.7 0.0554 0.0031 0.0559 1.7 8.6
17..6 0.093 563.3 153.7 0.0554 0.0066 0.1199 3.7 18.4
17..7 0.113 563.3 153.7 0.0554 0.0081 0.1458 4.6 22.4
16..9 0.210 563.3 153.7 0.0554 0.0150 0.2714 8.5 41.7
15..8 0.140 563.3 153.7 0.0554 0.0100 0.1810 5.6 27.8
14..10 0.122 563.3 153.7 0.0554 0.0088 0.1580 4.9 24.3
11..18 0.016 563.3 153.7 0.0554 0.0012 0.0212 0.7 3.3
18..2 0.015 563.3 153.7 0.0554 0.0011 0.0196 0.6 3.0
18..3 0.011 563.3 153.7 0.0554 0.0008 0.0144 0.4 2.2
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.709 1.425
57 I 0.999** 1.926
158 A 0.990* 1.910
Time used: 2:29
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
lnL(ntime: 17 np: 20): -2068.902002 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..16 16..17 17..6 17..7 16..9 15..8 14..10 11..18 18..2 18..3
0.078774 0.041065 0.022678 0.053295 0.060031 0.139843 0.037049 0.020352 0.041608 0.094904 0.113550 0.210108 0.143841 0.124597 0.016778 0.015487 0.011380 2.113176 0.051060 0.766037
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.22534
(1: 0.078774, ((4: 0.053295, 5: 0.060031): 0.022678, ((((6: 0.094904, 7: 0.113550): 0.041608, 9: 0.210108): 0.020352, 8: 0.143841): 0.037049, 10: 0.124597): 0.139843): 0.041065, (2: 0.015487, 3: 0.011380): 0.016778);
(D_melanogaster_CG13024-PC: 0.078774, ((D_yakuba_CG13024-PC: 0.053295, D_erecta_CG13024-PC: 0.060031): 0.022678, ((((D_takahashii_CG13024-PC: 0.094904, D_biarmipes_CG13024-PC: 0.113550): 0.041608, D_ficusphila_CG13024-PC: 0.210108): 0.020352, D_eugracilis_CG13024-PC: 0.143841): 0.037049, D_elegans_CG13024-PC: 0.124597): 0.139843): 0.041065, (D_sechellia_CG13024-PC: 0.015487, D_simulans_CG13024-PC: 0.011380): 0.016778);
Detailed output identifying parameters
kappa (ts/tv) = 2.11318
Parameters in M7 (beta):
p = 0.05106 q = 0.76604
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00034 0.00559 0.06402 0.50108
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.079 563.3 153.7 0.0571 0.0058 0.1013 3.3 15.6
11..12 0.041 563.3 153.7 0.0571 0.0030 0.0528 1.7 8.1
12..13 0.023 563.3 153.7 0.0571 0.0017 0.0292 0.9 4.5
13..4 0.053 563.3 153.7 0.0571 0.0039 0.0685 2.2 10.5
13..5 0.060 563.3 153.7 0.0571 0.0044 0.0772 2.5 11.9
12..14 0.140 563.3 153.7 0.0571 0.0103 0.1798 5.8 27.6
14..15 0.037 563.3 153.7 0.0571 0.0027 0.0476 1.5 7.3
15..16 0.020 563.3 153.7 0.0571 0.0015 0.0262 0.8 4.0
16..17 0.042 563.3 153.7 0.0571 0.0031 0.0535 1.7 8.2
17..6 0.095 563.3 153.7 0.0571 0.0070 0.1220 3.9 18.8
17..7 0.114 563.3 153.7 0.0571 0.0083 0.1460 4.7 22.4
16..9 0.210 563.3 153.7 0.0571 0.0154 0.2701 8.7 41.5
15..8 0.144 563.3 153.7 0.0571 0.0106 0.1849 5.9 28.4
14..10 0.125 563.3 153.7 0.0571 0.0091 0.1602 5.2 24.6
11..18 0.017 563.3 153.7 0.0571 0.0012 0.0216 0.7 3.3
18..2 0.015 563.3 153.7 0.0571 0.0011 0.0199 0.6 3.1
18..3 0.011 563.3 153.7 0.0571 0.0008 0.0146 0.5 2.2
Time used: 3:52
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), ((((6, 7), 9), 8), 10)), (2, 3)); MP score: 226
lnL(ntime: 17 np: 22): -2064.620651 +0.000000
11..1 11..12 12..13 13..4 13..5 12..14 14..15 15..16 16..17 17..6 17..7 16..9 15..8 14..10 11..18 18..2 18..3
0.077183 0.040989 0.022268 0.052976 0.058991 0.140597 0.038643 0.020250 0.043253 0.092655 0.112794 0.209980 0.139861 0.121934 0.016379 0.015140 0.011115 2.110970 0.988220 0.072369 1.791713 1.996561
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.21501
(1: 0.077183, ((4: 0.052976, 5: 0.058991): 0.022268, ((((6: 0.092655, 7: 0.112794): 0.043253, 9: 0.209980): 0.020250, 8: 0.139861): 0.038643, 10: 0.121934): 0.140597): 0.040989, (2: 0.015140, 3: 0.011115): 0.016379);
(D_melanogaster_CG13024-PC: 0.077183, ((D_yakuba_CG13024-PC: 0.052976, D_erecta_CG13024-PC: 0.058991): 0.022268, ((((D_takahashii_CG13024-PC: 0.092655, D_biarmipes_CG13024-PC: 0.112794): 0.043253, D_ficusphila_CG13024-PC: 0.209980): 0.020250, D_eugracilis_CG13024-PC: 0.139861): 0.038643, D_elegans_CG13024-PC: 0.121934): 0.140597): 0.040989, (D_sechellia_CG13024-PC: 0.015140, D_simulans_CG13024-PC: 0.011115): 0.016379);
Detailed output identifying parameters
kappa (ts/tv) = 2.11097
Parameters in M8 (beta&w>1):
p0 = 0.98822 p = 0.07237 q = 1.79171
(p1 = 0.01178) w = 1.99656
dN/dS (w) for site classes (K=11)
p: 0.09882 0.09882 0.09882 0.09882 0.09882 0.09882 0.09882 0.09882 0.09882 0.09882 0.01178
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00011 0.00114 0.00828 0.04807 0.26315 1.99656
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.077 563.3 153.7 0.0552 0.0055 0.0998 3.1 15.3
11..12 0.041 563.3 153.7 0.0552 0.0029 0.0530 1.6 8.1
12..13 0.022 563.3 153.7 0.0552 0.0016 0.0288 0.9 4.4
13..4 0.053 563.3 153.7 0.0552 0.0038 0.0685 2.1 10.5
13..5 0.059 563.3 153.7 0.0552 0.0042 0.0763 2.4 11.7
12..14 0.141 563.3 153.7 0.0552 0.0100 0.1818 5.7 27.9
14..15 0.039 563.3 153.7 0.0552 0.0028 0.0500 1.6 7.7
15..16 0.020 563.3 153.7 0.0552 0.0014 0.0262 0.8 4.0
16..17 0.043 563.3 153.7 0.0552 0.0031 0.0559 1.7 8.6
17..6 0.093 563.3 153.7 0.0552 0.0066 0.1198 3.7 18.4
17..7 0.113 563.3 153.7 0.0552 0.0081 0.1459 4.5 22.4
16..9 0.210 563.3 153.7 0.0552 0.0150 0.2715 8.4 41.7
15..8 0.140 563.3 153.7 0.0552 0.0100 0.1809 5.6 27.8
14..10 0.122 563.3 153.7 0.0552 0.0087 0.1577 4.9 24.2
11..18 0.016 563.3 153.7 0.0552 0.0012 0.0212 0.7 3.3
18..2 0.015 563.3 153.7 0.0552 0.0011 0.0196 0.6 3.0
18..3 0.011 563.3 153.7 0.0552 0.0008 0.0144 0.4 2.2
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.579 1.267
57 I 0.998** 1.993
158 A 0.975* 1.954
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.505 1.233 +- 0.802
57 I 0.978* 2.390 +- 1.270
158 A 0.909 2.234 +- 1.258
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.047 0.216 0.730
ws: 0.491 0.284 0.122 0.055 0.025 0.012 0.006 0.003 0.002 0.001
Time used: 6:06
Model 1: NearlyNeutral -2068.545247
Model 2: PositiveSelection -2068.545254
Model 0: one-ratio -2100.921239
Model 3: discrete -2064.380859
Model 7: beta -2068.902002
Model 8: beta&w>1 -2064.620651
Model 0 vs 1 64.75198399999954
Model 2 vs 1 1.4000000192027073E-5
Model 8 vs 7 8.562701999999263
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.579 1.267
57 I 0.998** 1.993
158 A 0.975* 1.954
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG13024-PC)
Pr(w>1) post mean +- SE for w
56 S 0.505 1.233 +- 0.802
57 I 0.978* 2.390 +- 1.270
158 A 0.909 2.234 +- 1.258
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
