>C1
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C2
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C3
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C4
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C5
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C6
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=286
C1 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C2 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C3 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C4 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C5 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C6 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
**************************************************
C1 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C2 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C3 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C4 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C5 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C6 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
**************************************************
C1 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C2 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C3 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C4 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C5 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C6 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
**************************************************
C1 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C2 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C3 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C4 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C5 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C6 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
**************************************************
C1 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C2 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C3 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C4 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C5 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C6 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
**************************************************
C1 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C2 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C3 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C4 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C5 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C6 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8580]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8580]--->[8580]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.845 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C2 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C3 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C4 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C5 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
C6 LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
**************************************************
C1 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C2 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C3 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C4 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C5 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
C6 PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
**************************************************
C1 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C2 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C3 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C4 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C5 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
C6 LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
**************************************************
C1 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C2 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C3 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C4 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C5 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
C6 KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
**************************************************
C1 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C2 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C3 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C4 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C5 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
C6 VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
**************************************************
C1 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C2 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C3 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C4 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C5 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
C6 GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
C2 TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
C3 TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
C4 TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
C5 TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
C6 TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
**************************************************
C1 GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
C2 GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
C3 GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
C4 GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
C5 GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
C6 GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
**************************************************
C1 CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
C2 CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
C3 CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
C4 CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
C5 CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
C6 CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
**************************************************
C1 CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
C2 CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
C3 CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
C4 CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
C5 CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
C6 CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
**************************************************
C1 GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
C2 GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
C3 GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
C4 GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
C5 GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
C6 GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
**************************************************
C1 GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
C2 GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
C3 GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
C4 GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
C5 GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
C6 GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
**************************************************
C1 CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
C2 CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
C3 CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
C4 CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
C5 CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
C6 CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
**************************************************
C1 GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
C2 GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
C3 GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
C4 GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
C5 GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
C6 GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
**************************************************
C1 CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
C2 CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
C3 CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
C4 CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
C5 CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
C6 CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
**************************************************
C1 AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
C2 AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
C3 AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
C4 AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
C5 AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
C6 AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
**************************************************
C1 TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
C2 TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
C3 TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
C4 TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
C5 TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
C6 TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
**************************************************
C1 TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
C2 TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
C3 TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
C4 TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
C5 TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
C6 TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
**************************************************
C1 GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
C2 GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
C3 GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
C4 GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
C5 GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
C6 GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
**************************************************
C1 CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
C2 CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
C3 CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
C4 CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
C5 CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
C6 CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
**************************************************
C1 TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
C2 TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
C3 TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
C4 TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
C5 TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
C6 TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
**************************************************
C1 GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
C2 GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
C3 GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
C4 GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
C5 GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
C6 GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
**************************************************
C1 CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
C2 CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
C3 CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
C4 CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
C5 CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
C6 CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
**************************************************
C1 TGGATTTG
C2 TGGATTTG
C3 TGGATTTG
C4 TGGATTTG
C5 TGGATTTG
C6 TGGATTTG
********
>C1
TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
TGGATTTG
>C2
TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
TGGATTTG
>C3
TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
TGGATTTG
>C4
TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
TGGATTTG
>C5
TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
TGGATTTG
>C6
TTGATAATGCTGTCCGACTGCGAATTCGATGCGGCGCGAGACACTATTCG
GCGCGCTCTGCATGAGGATCTACGGTACGGGCTCGACATCACTACGCAGG
CCACCGTGCCGGCTGGTACGGTCGTCACGGGGTCGATGGTGCCTCGCGAG
CCGGGTGTGATTGCCGGGGTGGATGTGGCGTTGCTGGTCCTCGATGAGGT
GTTCGGCGTCGACGGCTACCGGGTTCTCTATCGCGTTGAGGACGGTGCCC
GGTTGCAATCAGGTCAACCACTGCTGACCGTGCAGGCAGCAGCCCGAGGG
CTGTTGACGGCTGAGCGGACCATGTTGAACCTGGTCTGCCACATGTCCGG
GATAGCCACTGTGACGGTGGCCTGGGTTGACGCCGTACGTGGCACAAAAG
CCAAGATCCGAGATACCCGTAAGACGCTTCCTGGTCTGCGTGCGCTGCAG
AAGTACGCGGTGCGTGTCGGCGGCGGTGTCAACCATCGACTGGGGCTCGG
TGATACCGCCTTGATCAAGGACAACCATGTTGCCGCTGTAGGATCGGTGG
TTGACGCGCTGCGGGCAGTGAGGGCAGCTGCGCCTGAGCTTCCGTGCGAA
GTCGAAGTGGACTCACTCGAGCAGCTTGATGCCATGCTGGCTGAGGAGCC
CGAACTGATCCTGCTGGACAATTTCCCAGTGTGGCAGACACAAGTAGCGG
TGCAACGTCGAGACATCCGAGCACCTACCGTCCTGCTAGAATCATCCGGT
GGGCTGAGCCTCGAGAATGCGGCGATCTACGCGGGGACCGGCGTAGATTA
CCTCGCCGTCGGTGCGTTGACTCACTCGGTGCGAATTCTCGACATCGGCT
TGGATTTG
>C1
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C2
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C3
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C4
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C5
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
>C6
LIMLSDCEFDAARDTIRRALHEDLRYGLDITTQATVPAGTVVTGSMVPRE
PGVIAGVDVALLVLDEVFGVDGYRVLYRVEDGARLQSGQPLLTVQAAARG
LLTAERTMLNLVCHMSGIATVTVAWVDAVRGTKAKIRDTRKTLPGLRALQ
KYAVRVGGGVNHRLGLGDTALIKDNHVAAVGSVVDALRAVRAAAPELPCE
VEVDSLEQLDAMLAEEPELILLDNFPVWQTQVAVQRRDIRAPTVLLESSG
GLSLENAAIYAGTGVDYLAVGALTHSVRILDIGLDL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 858 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579784224
Setting output file names to "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1728451103
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9557725932
Seed = 981084450
Swapseed = 1579784224
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1920.245017 -- -24.965149
Chain 2 -- -1920.244837 -- -24.965149
Chain 3 -- -1920.245017 -- -24.965149
Chain 4 -- -1920.245017 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1920.245129 -- -24.965149
Chain 2 -- -1920.245129 -- -24.965149
Chain 3 -- -1920.245017 -- -24.965149
Chain 4 -- -1920.245129 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1920.245] (-1920.245) (-1920.245) (-1920.245) * [-1920.245] (-1920.245) (-1920.245) (-1920.245)
500 -- (-1175.627) (-1186.111) [-1174.838] (-1184.404) * (-1173.807) (-1185.795) [-1170.799] (-1192.312) -- 0:00:00
1000 -- [-1172.427] (-1180.443) (-1181.163) (-1181.756) * [-1171.123] (-1178.800) (-1177.707) (-1178.184) -- 0:00:00
1500 -- [-1171.952] (-1178.754) (-1168.389) (-1175.113) * (-1171.844) (-1170.860) (-1179.281) [-1173.531] -- 0:00:00
2000 -- (-1170.630) (-1181.400) [-1168.004] (-1170.055) * (-1172.276) (-1176.992) (-1176.530) [-1170.039] -- 0:00:00
2500 -- [-1175.484] (-1175.566) (-1170.625) (-1172.291) * (-1172.289) (-1178.185) [-1171.423] (-1173.897) -- 0:00:00
3000 -- (-1175.800) (-1176.187) [-1167.392] (-1170.956) * [-1178.262] (-1172.051) (-1179.836) (-1175.511) -- 0:00:00
3500 -- [-1170.913] (-1175.704) (-1173.040) (-1176.832) * [-1172.532] (-1175.200) (-1173.548) (-1175.557) -- 0:00:00
4000 -- (-1171.564) [-1176.574] (-1177.032) (-1175.493) * (-1185.000) (-1176.079) [-1167.472] (-1174.376) -- 0:00:00
4500 -- (-1172.669) (-1173.594) [-1173.282] (-1173.480) * (-1174.375) (-1174.596) [-1169.931] (-1172.369) -- 0:00:00
5000 -- (-1173.020) (-1174.143) [-1173.205] (-1176.332) * [-1169.674] (-1172.780) (-1170.740) (-1172.139) -- 0:00:00
Average standard deviation of split frequencies: 0.086424
5500 -- (-1173.004) (-1181.884) (-1172.360) [-1173.570] * (-1174.821) (-1169.986) (-1174.298) [-1168.552] -- 0:00:00
6000 -- (-1178.710) [-1175.192] (-1181.421) (-1173.616) * (-1185.189) [-1179.999] (-1178.303) (-1174.598) -- 0:02:45
6500 -- (-1176.092) (-1173.822) (-1174.759) [-1172.165] * (-1180.831) [-1168.309] (-1178.214) (-1168.603) -- 0:02:32
7000 -- [-1169.914] (-1173.437) (-1170.244) (-1178.371) * [-1171.577] (-1181.309) (-1172.521) (-1171.223) -- 0:02:21
7500 -- (-1175.483) (-1176.830) (-1176.024) [-1173.812] * (-1187.319) (-1178.396) [-1171.534] (-1170.783) -- 0:02:12
8000 -- (-1177.344) [-1171.580] (-1174.195) (-1176.492) * (-1176.261) [-1180.052] (-1177.887) (-1168.326) -- 0:02:04
8500 -- (-1171.992) (-1172.669) [-1174.937] (-1172.879) * (-1173.969) (-1171.934) (-1183.627) [-1169.757] -- 0:01:56
9000 -- (-1186.953) (-1177.229) [-1173.090] (-1177.919) * (-1172.217) (-1173.676) (-1178.481) [-1166.921] -- 0:01:50
9500 -- (-1175.717) (-1182.207) [-1177.890] (-1179.041) * (-1174.231) [-1175.635] (-1174.979) (-1164.069) -- 0:01:44
10000 -- (-1173.658) (-1180.847) (-1166.039) [-1170.573] * (-1177.934) [-1172.050] (-1172.186) (-1165.812) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- [-1175.349] (-1172.999) (-1164.953) (-1179.399) * (-1175.397) (-1174.758) [-1170.778] (-1165.764) -- 0:01:34
11000 -- [-1172.849] (-1174.480) (-1165.046) (-1177.693) * [-1173.226] (-1173.793) (-1178.452) (-1167.255) -- 0:01:29
11500 -- (-1172.191) (-1176.050) [-1164.851] (-1170.254) * [-1171.679] (-1172.022) (-1177.249) (-1167.315) -- 0:01:25
12000 -- [-1176.197] (-1175.919) (-1164.581) (-1178.125) * [-1173.095] (-1173.191) (-1169.746) (-1166.577) -- 0:01:22
12500 -- [-1171.760] (-1175.601) (-1166.815) (-1170.373) * (-1177.930) (-1179.322) [-1173.584] (-1167.944) -- 0:01:19
13000 -- [-1176.530] (-1171.614) (-1167.985) (-1171.291) * [-1174.849] (-1174.485) (-1169.681) (-1165.416) -- 0:01:15
13500 -- [-1172.347] (-1175.448) (-1171.866) (-1168.484) * (-1176.744) [-1175.615] (-1173.124) (-1163.662) -- 0:01:13
14000 -- (-1176.062) (-1174.460) (-1168.864) [-1169.844] * (-1177.319) [-1171.156] (-1175.987) (-1166.330) -- 0:01:10
14500 -- [-1172.251] (-1174.790) (-1167.783) (-1180.098) * (-1173.954) (-1182.208) [-1176.623] (-1167.998) -- 0:01:07
15000 -- (-1181.850) (-1171.112) [-1165.752] (-1172.568) * (-1170.111) (-1171.512) [-1174.363] (-1163.500) -- 0:01:05
Average standard deviation of split frequencies: 0.072020
15500 -- (-1177.817) (-1177.624) [-1166.376] (-1179.997) * (-1174.170) (-1184.197) (-1170.645) [-1166.827] -- 0:01:03
16000 -- [-1164.656] (-1171.919) (-1164.149) (-1178.672) * (-1181.873) (-1177.098) [-1171.520] (-1167.389) -- 0:01:01
16500 -- (-1165.375) (-1166.414) (-1165.335) [-1173.758] * [-1176.988] (-1182.015) (-1175.545) (-1166.066) -- 0:00:59
17000 -- (-1166.546) (-1166.442) (-1167.379) [-1169.671] * (-1181.676) [-1176.009] (-1172.547) (-1165.984) -- 0:00:57
17500 -- (-1168.907) (-1164.012) [-1166.314] (-1182.429) * (-1173.380) (-1178.123) [-1174.143] (-1164.158) -- 0:00:56
18000 -- (-1166.103) (-1165.404) [-1166.422] (-1176.371) * (-1180.276) (-1174.759) [-1173.081] (-1167.877) -- 0:00:54
18500 -- (-1165.660) (-1165.281) [-1165.507] (-1173.967) * (-1176.407) (-1175.931) [-1176.482] (-1168.620) -- 0:00:53
19000 -- (-1164.999) (-1166.778) [-1164.647] (-1174.401) * [-1175.606] (-1176.326) (-1178.545) (-1167.072) -- 0:00:51
19500 -- (-1167.778) (-1165.975) (-1166.922) [-1173.167] * [-1176.059] (-1177.816) (-1175.432) (-1165.690) -- 0:00:50
20000 -- [-1163.764] (-1167.374) (-1167.116) (-1174.494) * (-1175.424) [-1173.828] (-1185.652) (-1167.259) -- 0:00:49
Average standard deviation of split frequencies: 0.070964
20500 -- (-1165.211) [-1166.898] (-1165.719) (-1173.173) * (-1173.200) [-1172.648] (-1183.888) (-1166.174) -- 0:00:47
21000 -- (-1164.621) (-1164.027) (-1164.339) [-1184.048] * (-1174.246) [-1172.898] (-1175.432) (-1166.847) -- 0:00:46
21500 -- [-1163.904] (-1166.078) (-1164.648) (-1179.268) * (-1188.549) (-1172.422) (-1178.220) [-1165.009] -- 0:00:45
22000 -- (-1165.482) (-1166.809) (-1165.215) [-1174.411] * (-1174.253) (-1181.725) [-1173.664] (-1164.076) -- 0:01:28
22500 -- [-1163.725] (-1168.931) (-1164.261) (-1179.742) * [-1177.398] (-1177.702) (-1180.111) (-1164.361) -- 0:01:26
23000 -- (-1164.044) (-1164.452) (-1165.926) [-1168.346] * (-1177.541) (-1171.693) (-1174.064) [-1168.118] -- 0:01:24
23500 -- (-1165.789) [-1165.687] (-1170.257) (-1173.636) * [-1173.922] (-1173.849) (-1168.642) (-1167.746) -- 0:01:23
24000 -- [-1164.336] (-1164.586) (-1168.005) (-1176.749) * [-1171.208] (-1170.818) (-1172.745) (-1169.476) -- 0:01:21
24500 -- (-1165.805) [-1164.526] (-1167.180) (-1176.163) * [-1176.862] (-1169.463) (-1174.918) (-1164.358) -- 0:01:19
25000 -- (-1167.346) (-1166.598) [-1167.782] (-1175.059) * (-1176.973) (-1169.880) (-1175.042) [-1164.393] -- 0:01:18
Average standard deviation of split frequencies: 0.060436
25500 -- (-1166.347) [-1165.151] (-1167.199) (-1179.355) * (-1184.403) [-1171.301] (-1173.598) (-1165.746) -- 0:01:16
26000 -- [-1167.123] (-1166.425) (-1167.461) (-1185.645) * [-1176.746] (-1186.138) (-1176.610) (-1163.953) -- 0:01:14
26500 -- (-1165.140) (-1165.999) [-1164.969] (-1167.863) * (-1175.584) [-1168.402] (-1174.199) (-1165.904) -- 0:01:13
27000 -- (-1164.858) (-1166.784) [-1164.379] (-1167.370) * (-1177.582) (-1175.527) (-1176.751) [-1164.864] -- 0:01:12
27500 -- (-1165.733) [-1163.868] (-1164.622) (-1167.121) * (-1175.216) (-1177.798) (-1170.868) [-1164.054] -- 0:01:10
28000 -- (-1167.129) (-1163.706) [-1166.636] (-1165.109) * (-1180.304) (-1184.701) (-1178.258) [-1166.954] -- 0:01:09
28500 -- (-1167.808) (-1168.066) (-1164.269) [-1165.725] * [-1172.506] (-1176.169) (-1171.795) (-1165.491) -- 0:01:08
29000 -- (-1165.804) (-1164.115) [-1163.563] (-1165.189) * [-1171.600] (-1188.723) (-1178.240) (-1164.505) -- 0:01:06
29500 -- (-1167.056) (-1164.478) [-1164.892] (-1163.966) * [-1175.601] (-1166.500) (-1176.474) (-1164.700) -- 0:01:05
30000 -- [-1165.716] (-1164.106) (-1164.297) (-1164.484) * (-1196.363) [-1168.625] (-1178.295) (-1166.045) -- 0:01:04
Average standard deviation of split frequencies: 0.051705
30500 -- (-1168.872) (-1164.320) (-1164.563) [-1164.531] * (-1184.176) (-1166.657) [-1178.738] (-1166.818) -- 0:01:03
31000 -- (-1166.410) (-1165.402) (-1163.989) [-1164.016] * (-1164.365) (-1165.322) (-1181.396) [-1166.738] -- 0:01:02
31500 -- (-1167.053) (-1164.382) [-1167.520] (-1165.836) * (-1164.118) (-1166.413) [-1174.028] (-1164.993) -- 0:01:01
32000 -- (-1168.364) (-1164.453) (-1169.149) [-1163.743] * (-1166.450) [-1165.598] (-1179.868) (-1166.204) -- 0:01:00
32500 -- (-1165.553) (-1164.640) (-1168.059) [-1168.411] * [-1165.554] (-1167.222) (-1176.685) (-1167.696) -- 0:00:59
33000 -- (-1166.341) (-1166.177) [-1165.736] (-1167.553) * [-1163.784] (-1165.908) (-1171.901) (-1166.902) -- 0:00:58
33500 -- (-1167.157) (-1165.927) [-1165.708] (-1164.766) * (-1164.476) (-1164.348) [-1175.221] (-1168.165) -- 0:00:57
34000 -- (-1164.543) [-1163.784] (-1165.454) (-1163.513) * (-1166.649) [-1165.759] (-1174.117) (-1167.919) -- 0:00:56
34500 -- [-1164.180] (-1166.780) (-1164.849) (-1167.326) * (-1165.665) (-1164.460) (-1174.540) [-1165.133] -- 0:00:55
35000 -- (-1166.783) [-1164.886] (-1164.079) (-1168.615) * [-1164.296] (-1163.574) (-1177.588) (-1164.501) -- 0:00:55
Average standard deviation of split frequencies: 0.040531
35500 -- (-1166.223) (-1164.124) [-1164.195] (-1164.698) * (-1164.591) (-1165.066) [-1170.495] (-1167.489) -- 0:00:54
36000 -- (-1169.585) [-1164.328] (-1166.205) (-1163.523) * (-1166.180) (-1163.368) [-1172.933] (-1168.120) -- 0:00:53
36500 -- [-1164.696] (-1166.355) (-1163.478) (-1166.088) * (-1164.728) [-1163.578] (-1179.056) (-1168.306) -- 0:00:52
37000 -- (-1169.508) (-1166.388) [-1164.103] (-1166.109) * [-1165.278] (-1163.645) (-1164.060) (-1169.270) -- 0:00:52
37500 -- [-1164.254] (-1166.570) (-1163.557) (-1163.975) * [-1165.033] (-1163.420) (-1164.186) (-1167.192) -- 0:00:51
38000 -- (-1169.527) (-1165.548) (-1168.211) [-1168.241] * (-1165.277) [-1163.420] (-1163.506) (-1167.226) -- 0:01:15
38500 -- [-1166.146] (-1165.850) (-1166.843) (-1165.950) * [-1165.322] (-1163.752) (-1164.265) (-1166.958) -- 0:01:14
39000 -- [-1170.709] (-1171.537) (-1167.535) (-1166.208) * [-1166.033] (-1163.273) (-1163.987) (-1168.784) -- 0:01:13
39500 -- (-1170.363) (-1164.684) [-1167.548] (-1166.983) * (-1166.987) (-1163.804) (-1164.460) [-1163.788] -- 0:01:12
40000 -- (-1169.259) [-1164.353] (-1168.274) (-1170.222) * [-1166.734] (-1165.344) (-1164.572) (-1163.642) -- 0:01:12
Average standard deviation of split frequencies: 0.040267
40500 -- (-1169.801) [-1164.786] (-1166.352) (-1166.817) * (-1165.163) (-1165.519) [-1166.429] (-1164.444) -- 0:01:11
41000 -- [-1166.888] (-1167.083) (-1166.188) (-1169.677) * (-1166.654) [-1165.182] (-1164.166) (-1165.887) -- 0:01:10
41500 -- (-1170.944) [-1164.353] (-1165.920) (-1169.872) * (-1166.605) [-1165.068] (-1164.098) (-1166.754) -- 0:01:09
42000 -- (-1171.540) [-1165.500] (-1166.616) (-1166.374) * [-1163.916] (-1165.006) (-1164.483) (-1167.906) -- 0:01:08
42500 -- (-1165.860) (-1170.073) [-1166.051] (-1166.382) * (-1164.063) [-1164.195] (-1167.550) (-1167.140) -- 0:01:07
43000 -- (-1164.989) [-1164.116] (-1166.281) (-1164.389) * (-1170.077) [-1166.070] (-1167.016) (-1164.494) -- 0:01:06
43500 -- (-1167.080) [-1167.769] (-1167.004) (-1164.199) * (-1169.761) [-1164.323] (-1163.405) (-1164.406) -- 0:01:05
44000 -- [-1165.763] (-1167.719) (-1168.113) (-1168.127) * (-1168.354) (-1166.963) [-1164.525] (-1166.421) -- 0:01:05
44500 -- [-1164.457] (-1165.590) (-1167.421) (-1167.235) * (-1164.972) (-1169.314) [-1166.549] (-1164.944) -- 0:01:04
45000 -- [-1165.208] (-1164.734) (-1168.508) (-1164.744) * (-1167.436) (-1166.181) (-1166.383) [-1163.948] -- 0:01:03
Average standard deviation of split frequencies: 0.034470
45500 -- (-1168.404) (-1167.045) [-1165.451] (-1168.186) * (-1173.395) (-1166.180) [-1164.792] (-1164.948) -- 0:01:02
46000 -- (-1167.159) [-1164.777] (-1167.900) (-1166.520) * (-1168.516) (-1170.508) [-1165.250] (-1164.893) -- 0:01:02
46500 -- (-1166.659) (-1164.728) [-1164.865] (-1165.338) * (-1173.399) [-1166.729] (-1163.831) (-1164.876) -- 0:01:01
47000 -- [-1164.500] (-1165.455) (-1164.970) (-1165.218) * (-1165.563) (-1168.569) [-1167.327] (-1166.737) -- 0:01:00
47500 -- (-1164.452) (-1164.513) [-1164.970] (-1168.482) * (-1165.534) (-1167.074) [-1163.694] (-1165.146) -- 0:01:00
48000 -- [-1164.467] (-1165.935) (-1164.970) (-1169.277) * [-1165.971] (-1167.352) (-1164.836) (-1165.242) -- 0:00:59
48500 -- (-1164.366) [-1165.412] (-1167.421) (-1169.212) * (-1165.331) (-1164.594) (-1163.848) [-1164.850] -- 0:00:58
49000 -- [-1164.675] (-1166.926) (-1169.209) (-1163.984) * (-1163.601) (-1164.412) (-1163.721) [-1164.418] -- 0:00:58
49500 -- (-1166.982) (-1166.429) (-1166.738) [-1164.461] * (-1163.780) (-1166.803) (-1165.356) [-1164.977] -- 0:00:57
50000 -- (-1165.327) [-1163.789] (-1164.640) (-1171.548) * (-1165.081) (-1167.334) (-1164.839) [-1166.193] -- 0:00:57
Average standard deviation of split frequencies: 0.030450
50500 -- [-1165.183] (-1163.553) (-1164.210) (-1174.970) * (-1164.606) (-1166.286) (-1164.632) [-1166.297] -- 0:00:56
51000 -- (-1165.587) [-1164.084] (-1164.216) (-1169.760) * (-1164.931) (-1164.051) (-1164.967) [-1166.440] -- 0:00:55
51500 -- (-1165.587) (-1164.030) [-1163.891] (-1166.131) * [-1166.361] (-1164.619) (-1166.498) (-1166.043) -- 0:00:55
52000 -- (-1167.379) [-1164.020] (-1163.877) (-1165.367) * (-1172.186) (-1166.352) [-1163.630] (-1166.546) -- 0:00:54
52500 -- (-1164.641) (-1165.037) (-1165.512) [-1166.005] * (-1168.375) (-1167.513) (-1166.028) [-1165.455] -- 0:00:54
53000 -- (-1164.623) (-1165.307) [-1163.723] (-1166.160) * (-1167.087) [-1166.734] (-1165.028) (-1166.422) -- 0:00:53
53500 -- [-1166.297] (-1166.903) (-1163.977) (-1165.701) * (-1169.786) [-1164.686] (-1167.047) (-1167.045) -- 0:00:53
54000 -- [-1167.007] (-1166.802) (-1164.952) (-1163.961) * (-1165.958) (-1164.591) [-1166.322] (-1166.634) -- 0:00:52
54500 -- [-1165.031] (-1166.096) (-1166.377) (-1164.068) * (-1164.991) (-1164.296) [-1166.224] (-1166.541) -- 0:01:09
55000 -- (-1166.329) (-1166.570) [-1164.667] (-1163.780) * (-1166.256) [-1166.151] (-1167.787) (-1164.586) -- 0:01:08
Average standard deviation of split frequencies: 0.029884
55500 -- (-1168.223) (-1170.826) (-1163.834) [-1164.770] * (-1164.618) [-1164.256] (-1167.094) (-1165.408) -- 0:01:08
56000 -- (-1168.907) (-1172.697) [-1164.361] (-1165.256) * (-1164.438) (-1164.555) [-1166.293] (-1166.865) -- 0:01:07
56500 -- (-1165.723) [-1167.673] (-1167.006) (-1164.887) * (-1164.641) (-1164.754) [-1165.776] (-1169.227) -- 0:01:06
57000 -- (-1166.400) (-1166.887) (-1163.944) [-1166.399] * (-1164.287) [-1164.082] (-1165.414) (-1169.053) -- 0:01:06
57500 -- (-1164.894) (-1165.626) (-1164.360) [-1164.344] * (-1165.503) (-1164.670) [-1165.246] (-1168.378) -- 0:01:05
58000 -- (-1164.503) (-1165.842) (-1164.573) [-1163.686] * (-1166.317) (-1167.031) (-1167.241) [-1165.539] -- 0:01:04
58500 -- [-1166.156] (-1167.432) (-1164.143) (-1163.548) * (-1165.499) (-1167.054) (-1167.241) [-1165.542] -- 0:01:04
59000 -- (-1164.708) (-1166.206) (-1165.881) [-1166.319] * (-1168.117) [-1165.004] (-1164.370) (-1165.386) -- 0:01:03
59500 -- (-1165.988) [-1164.736] (-1164.886) (-1168.852) * [-1168.095] (-1166.750) (-1165.723) (-1164.920) -- 0:01:03
60000 -- (-1165.218) (-1166.451) (-1164.486) [-1165.003] * [-1164.542] (-1169.093) (-1165.085) (-1165.216) -- 0:01:02
Average standard deviation of split frequencies: 0.026031
60500 -- (-1164.017) (-1166.441) [-1165.945] (-1168.593) * (-1167.751) (-1167.489) (-1164.271) [-1164.473] -- 0:01:02
61000 -- [-1164.088] (-1167.227) (-1163.598) (-1168.041) * (-1165.034) (-1165.557) [-1166.146] (-1163.568) -- 0:01:01
61500 -- (-1167.174) (-1169.305) [-1166.560] (-1166.344) * [-1164.826] (-1167.405) (-1164.921) (-1166.130) -- 0:01:01
62000 -- (-1167.148) (-1166.868) (-1169.485) [-1166.185] * (-1165.899) [-1167.248] (-1165.288) (-1166.811) -- 0:01:00
62500 -- (-1167.646) [-1165.552] (-1167.074) (-1164.141) * (-1164.517) (-1167.007) [-1166.025] (-1166.596) -- 0:01:00
63000 -- (-1165.898) (-1168.193) [-1169.659] (-1166.089) * (-1164.835) (-1164.298) [-1164.312] (-1167.020) -- 0:00:59
63500 -- [-1164.742] (-1165.665) (-1181.753) (-1165.731) * [-1164.175] (-1163.830) (-1164.540) (-1167.571) -- 0:00:58
64000 -- [-1163.847] (-1163.679) (-1178.037) (-1167.061) * [-1165.131] (-1163.221) (-1163.774) (-1166.947) -- 0:00:58
64500 -- (-1165.364) (-1163.832) (-1167.616) [-1165.973] * (-1168.485) (-1164.066) (-1164.967) [-1166.664] -- 0:00:58
65000 -- (-1165.030) [-1164.745] (-1167.291) (-1165.934) * (-1168.329) [-1164.886] (-1166.679) (-1169.328) -- 0:00:57
Average standard deviation of split frequencies: 0.025509
65500 -- (-1168.794) (-1164.428) (-1168.270) [-1168.097] * (-1166.585) [-1163.741] (-1165.666) (-1166.935) -- 0:00:57
66000 -- [-1165.479] (-1164.666) (-1170.589) (-1166.467) * (-1166.756) [-1165.496] (-1164.629) (-1168.524) -- 0:00:56
66500 -- (-1165.299) [-1164.050] (-1166.774) (-1165.863) * (-1164.938) [-1163.685] (-1163.919) (-1166.154) -- 0:00:56
67000 -- [-1167.114] (-1167.739) (-1165.430) (-1169.392) * [-1164.877] (-1167.171) (-1164.532) (-1165.022) -- 0:00:55
67500 -- [-1164.296] (-1164.439) (-1168.102) (-1169.499) * (-1165.947) (-1167.736) [-1164.002] (-1165.854) -- 0:00:55
68000 -- (-1164.372) (-1164.390) [-1167.209] (-1171.207) * (-1168.909) (-1166.051) [-1163.903] (-1165.472) -- 0:00:54
68500 -- [-1164.377] (-1164.195) (-1164.221) (-1165.275) * (-1166.214) [-1163.925] (-1166.580) (-1169.089) -- 0:00:54
69000 -- [-1167.137] (-1164.872) (-1165.102) (-1165.365) * (-1165.474) (-1168.313) [-1165.637] (-1171.051) -- 0:00:53
69500 -- [-1164.862] (-1164.264) (-1168.533) (-1165.154) * (-1165.781) (-1166.165) [-1164.350] (-1164.855) -- 0:00:53
70000 -- (-1168.233) (-1166.645) [-1167.708] (-1170.826) * (-1164.036) [-1164.362] (-1165.694) (-1167.600) -- 0:00:53
Average standard deviation of split frequencies: 0.023681
70500 -- [-1165.314] (-1167.253) (-1171.837) (-1169.212) * [-1164.374] (-1165.147) (-1166.028) (-1164.165) -- 0:01:05
71000 -- (-1165.246) (-1167.754) [-1170.090] (-1167.632) * [-1165.101] (-1165.611) (-1167.857) (-1165.425) -- 0:01:05
71500 -- [-1165.927] (-1164.496) (-1169.251) (-1167.630) * (-1168.526) [-1165.812] (-1166.925) (-1165.715) -- 0:01:04
72000 -- (-1166.402) (-1166.834) [-1167.186] (-1166.690) * (-1171.883) [-1171.650] (-1167.037) (-1165.886) -- 0:01:04
72500 -- (-1167.053) [-1163.820] (-1165.447) (-1165.434) * [-1165.308] (-1170.224) (-1167.633) (-1164.684) -- 0:01:03
73000 -- (-1168.556) (-1164.143) [-1164.364] (-1166.077) * [-1164.692] (-1168.498) (-1167.973) (-1166.476) -- 0:01:03
73500 -- (-1165.880) (-1164.710) [-1165.394] (-1169.321) * (-1166.209) [-1165.859] (-1165.397) (-1166.267) -- 0:01:03
74000 -- (-1165.701) (-1163.997) [-1163.543] (-1167.430) * (-1166.485) (-1163.931) [-1166.841] (-1168.627) -- 0:01:02
74500 -- (-1165.788) (-1164.237) [-1163.645] (-1166.116) * (-1165.210) [-1164.922] (-1167.412) (-1173.119) -- 0:01:02
75000 -- (-1163.435) (-1166.621) [-1165.189] (-1166.142) * (-1163.703) (-1163.970) [-1165.443] (-1164.335) -- 0:01:01
Average standard deviation of split frequencies: 0.023260
75500 -- (-1164.284) (-1164.762) [-1163.851] (-1166.022) * (-1163.889) (-1165.489) (-1167.984) [-1164.693] -- 0:01:01
76000 -- (-1163.820) (-1165.733) [-1163.786] (-1166.610) * (-1167.854) (-1164.009) (-1166.497) [-1164.187] -- 0:01:00
76500 -- [-1164.112] (-1166.042) (-1163.525) (-1163.876) * [-1163.462] (-1165.406) (-1166.409) (-1165.985) -- 0:01:00
77000 -- (-1163.698) (-1167.201) [-1163.767] (-1168.817) * (-1164.143) (-1165.896) [-1166.004] (-1164.132) -- 0:00:59
77500 -- (-1164.023) (-1166.377) (-1163.767) [-1164.498] * (-1168.405) (-1165.742) [-1168.858] (-1163.757) -- 0:00:59
78000 -- (-1164.534) (-1165.961) (-1163.982) [-1164.970] * [-1167.142] (-1165.395) (-1166.725) (-1163.793) -- 0:00:59
78500 -- (-1165.722) (-1168.380) [-1163.990] (-1170.186) * [-1163.828] (-1165.383) (-1164.455) (-1167.830) -- 0:00:58
79000 -- (-1164.904) (-1165.652) (-1167.599) [-1166.556] * [-1164.784] (-1164.926) (-1166.093) (-1170.386) -- 0:00:58
79500 -- (-1164.239) [-1164.953] (-1167.114) (-1166.940) * [-1168.154] (-1166.698) (-1169.249) (-1171.604) -- 0:00:57
80000 -- (-1164.759) (-1163.629) [-1167.667] (-1166.707) * [-1168.902] (-1167.262) (-1169.522) (-1165.900) -- 0:00:57
Average standard deviation of split frequencies: 0.023719
80500 -- (-1167.004) (-1165.670) [-1163.569] (-1167.080) * (-1164.662) [-1168.384] (-1170.233) (-1164.415) -- 0:00:57
81000 -- (-1164.445) (-1164.579) [-1164.383] (-1164.865) * (-1168.069) (-1167.165) [-1169.029] (-1164.837) -- 0:00:56
81500 -- [-1165.224] (-1166.251) (-1163.981) (-1165.042) * (-1168.953) [-1164.544] (-1165.717) (-1167.144) -- 0:00:56
82000 -- (-1164.037) (-1165.991) [-1166.308] (-1167.875) * (-1168.065) [-1165.116] (-1164.502) (-1165.211) -- 0:00:55
82500 -- (-1164.287) (-1165.921) (-1165.414) [-1164.021] * (-1166.569) [-1164.896] (-1166.787) (-1165.078) -- 0:00:55
83000 -- (-1165.971) [-1166.756] (-1165.066) (-1163.826) * (-1168.120) (-1166.805) (-1166.432) [-1169.414] -- 0:00:55
83500 -- (-1165.266) [-1167.395] (-1164.053) (-1163.824) * (-1165.438) (-1169.217) [-1165.136] (-1166.759) -- 0:00:54
84000 -- (-1164.499) (-1168.006) [-1163.731] (-1163.854) * (-1166.058) [-1168.375] (-1166.148) (-1165.046) -- 0:00:54
84500 -- (-1165.572) (-1171.316) (-1164.154) [-1164.009] * (-1165.737) [-1165.140] (-1169.975) (-1164.979) -- 0:00:54
85000 -- (-1165.510) (-1167.978) (-1166.073) [-1166.561] * (-1166.940) [-1164.759] (-1167.235) (-1165.468) -- 0:00:53
Average standard deviation of split frequencies: 0.022200
85500 -- (-1165.681) (-1165.499) [-1163.831] (-1164.216) * (-1165.897) (-1165.158) [-1165.299] (-1164.979) -- 0:00:53
86000 -- (-1164.855) [-1165.887] (-1165.751) (-1168.078) * (-1164.453) [-1164.856] (-1165.291) (-1166.442) -- 0:00:53
86500 -- [-1165.273] (-1167.812) (-1165.343) (-1164.726) * (-1165.336) [-1165.306] (-1165.100) (-1163.756) -- 0:00:52
87000 -- (-1163.721) (-1165.697) (-1166.166) [-1163.607] * (-1164.855) [-1165.259] (-1168.767) (-1164.567) -- 0:01:02
87500 -- [-1168.330] (-1163.797) (-1168.871) (-1166.353) * (-1164.364) (-1165.528) (-1169.445) [-1165.569] -- 0:01:02
88000 -- (-1164.817) (-1165.677) [-1170.769] (-1163.840) * (-1165.101) (-1164.182) (-1165.286) [-1170.582] -- 0:01:02
88500 -- (-1168.013) (-1165.574) [-1164.381] (-1169.557) * (-1167.504) (-1166.285) (-1164.601) [-1165.660] -- 0:01:01
89000 -- (-1170.391) (-1164.301) [-1164.408] (-1165.966) * (-1168.743) [-1165.045] (-1165.357) (-1165.474) -- 0:01:01
89500 -- (-1166.056) (-1164.749) [-1165.055] (-1167.904) * (-1170.077) (-1164.042) (-1167.090) [-1165.949] -- 0:01:01
90000 -- (-1169.052) (-1164.729) [-1167.167] (-1165.600) * (-1167.138) (-1164.090) [-1166.432] (-1166.793) -- 0:01:00
Average standard deviation of split frequencies: 0.018061
90500 -- (-1165.768) (-1166.862) [-1166.203] (-1166.695) * (-1171.368) (-1164.171) [-1166.962] (-1166.473) -- 0:01:00
91000 -- (-1165.253) (-1165.408) [-1167.724] (-1167.120) * (-1170.493) [-1165.457] (-1166.637) (-1164.989) -- 0:00:59
91500 -- (-1164.596) (-1164.309) [-1166.242] (-1166.033) * (-1167.925) (-1163.645) (-1164.854) [-1163.917] -- 0:00:59
92000 -- (-1164.985) (-1167.246) (-1167.892) [-1166.748] * (-1167.257) (-1163.949) (-1163.854) [-1165.276] -- 0:00:59
92500 -- (-1166.719) (-1166.893) [-1167.599] (-1167.425) * [-1166.293] (-1165.843) (-1163.655) (-1163.829) -- 0:00:58
93000 -- (-1169.609) [-1170.263] (-1165.506) (-1169.391) * (-1169.667) [-1171.483] (-1167.995) (-1164.523) -- 0:00:58
93500 -- (-1168.401) (-1171.155) (-1166.468) [-1169.487] * [-1163.938] (-1168.763) (-1166.951) (-1164.949) -- 0:00:58
94000 -- (-1167.715) [-1167.633] (-1165.611) (-1167.373) * (-1165.166) [-1167.882] (-1164.550) (-1166.483) -- 0:00:57
94500 -- (-1164.202) (-1166.247) [-1165.160] (-1165.816) * [-1164.885] (-1165.785) (-1164.985) (-1170.292) -- 0:00:57
95000 -- [-1167.224] (-1166.277) (-1164.789) (-1164.244) * (-1165.442) (-1166.097) (-1165.308) [-1164.419] -- 0:00:57
Average standard deviation of split frequencies: 0.019887
95500 -- (-1165.679) [-1164.745] (-1167.774) (-1164.643) * [-1164.521] (-1165.169) (-1166.167) (-1165.427) -- 0:00:56
96000 -- (-1166.423) [-1164.517] (-1164.358) (-1164.721) * (-1164.649) [-1165.044] (-1167.031) (-1167.011) -- 0:00:56
96500 -- (-1165.503) (-1164.119) (-1164.649) [-1165.738] * (-1165.218) [-1167.398] (-1167.472) (-1164.757) -- 0:00:56
97000 -- (-1164.552) (-1165.432) [-1164.968] (-1166.629) * [-1165.375] (-1164.783) (-1166.267) (-1166.715) -- 0:00:55
97500 -- (-1165.714) (-1165.282) (-1165.219) [-1166.951] * [-1165.382] (-1164.985) (-1166.262) (-1168.283) -- 0:00:55
98000 -- (-1165.472) [-1163.562] (-1165.546) (-1167.609) * (-1163.673) (-1166.251) [-1165.335] (-1166.851) -- 0:00:55
98500 -- [-1166.872] (-1163.497) (-1164.148) (-1165.835) * (-1163.584) (-1167.477) (-1164.911) [-1165.573] -- 0:00:54
99000 -- (-1164.399) (-1168.327) [-1164.747] (-1167.519) * (-1164.071) [-1164.016] (-1168.755) (-1164.382) -- 0:00:54
99500 -- [-1168.447] (-1167.120) (-1165.293) (-1164.504) * [-1165.187] (-1164.350) (-1168.114) (-1166.877) -- 0:00:54
100000 -- (-1170.720) (-1167.089) (-1165.800) [-1165.161] * (-1164.122) [-1164.781] (-1166.092) (-1164.191) -- 0:00:54
Average standard deviation of split frequencies: 0.017691
100500 -- (-1167.306) (-1166.917) [-1170.558] (-1163.919) * [-1164.867] (-1164.825) (-1165.453) (-1165.627) -- 0:00:53
101000 -- [-1165.510] (-1165.997) (-1165.861) (-1164.838) * [-1163.848] (-1164.666) (-1164.997) (-1165.271) -- 0:00:53
101500 -- (-1170.069) (-1164.135) [-1163.543] (-1167.364) * [-1164.284] (-1168.542) (-1164.466) (-1166.385) -- 0:00:53
102000 -- (-1164.851) (-1167.255) [-1165.466] (-1165.867) * (-1167.085) [-1166.562] (-1164.330) (-1166.474) -- 0:00:52
102500 -- (-1164.460) (-1165.505) [-1164.493] (-1168.583) * (-1167.203) (-1166.213) [-1166.366] (-1166.731) -- 0:00:52
103000 -- (-1165.089) [-1164.554] (-1164.079) (-1168.483) * (-1166.932) (-1166.587) [-1166.523] (-1165.037) -- 0:01:00
103500 -- (-1165.558) [-1163.442] (-1167.518) (-1165.815) * (-1166.544) (-1166.314) (-1164.032) [-1164.822] -- 0:01:00
104000 -- [-1165.587] (-1163.848) (-1166.525) (-1165.133) * (-1166.204) (-1168.636) [-1166.079] (-1164.893) -- 0:01:00
104500 -- (-1165.886) (-1163.673) [-1165.428] (-1166.328) * (-1165.684) [-1165.464] (-1164.936) (-1168.814) -- 0:00:59
105000 -- (-1167.193) (-1167.937) (-1165.672) [-1164.085] * (-1165.180) [-1163.434] (-1167.658) (-1167.971) -- 0:00:59
Average standard deviation of split frequencies: 0.020598
105500 -- (-1166.066) (-1166.389) (-1165.979) [-1164.234] * (-1164.377) (-1165.127) (-1168.289) [-1166.518] -- 0:00:59
106000 -- (-1164.918) (-1165.879) (-1164.142) [-1164.955] * (-1164.868) (-1166.654) [-1167.851] (-1167.175) -- 0:00:59
106500 -- (-1164.881) (-1168.273) (-1168.052) [-1165.260] * (-1166.434) (-1164.018) [-1167.447] (-1165.160) -- 0:00:58
107000 -- (-1166.739) (-1167.040) [-1166.408] (-1167.096) * (-1168.756) (-1165.682) (-1164.237) [-1165.449] -- 0:00:58
107500 -- (-1172.320) (-1165.225) [-1166.670] (-1164.687) * (-1165.824) (-1168.229) (-1166.364) [-1166.508] -- 0:00:58
108000 -- [-1165.153] (-1166.469) (-1167.756) (-1165.665) * (-1164.696) (-1165.222) [-1164.872] (-1167.986) -- 0:00:57
108500 -- [-1165.432] (-1167.238) (-1167.339) (-1164.810) * [-1163.616] (-1166.928) (-1166.261) (-1165.725) -- 0:00:57
109000 -- (-1165.479) (-1163.917) [-1169.377] (-1168.855) * (-1165.055) (-1167.095) [-1164.158] (-1165.073) -- 0:00:57
109500 -- [-1164.088] (-1166.577) (-1165.144) (-1166.843) * [-1165.606] (-1167.668) (-1163.804) (-1163.926) -- 0:00:56
110000 -- [-1164.601] (-1164.296) (-1166.839) (-1166.641) * [-1164.811] (-1166.327) (-1165.883) (-1164.661) -- 0:00:56
Average standard deviation of split frequencies: 0.019879
110500 -- [-1166.839] (-1164.296) (-1167.187) (-1166.111) * (-1164.646) [-1163.526] (-1165.255) (-1165.246) -- 0:00:56
111000 -- (-1168.001) [-1165.034] (-1165.751) (-1167.497) * [-1166.057] (-1163.739) (-1163.846) (-1164.543) -- 0:00:56
111500 -- (-1168.680) (-1170.036) (-1165.806) [-1166.028] * (-1166.413) (-1164.290) [-1164.594] (-1166.109) -- 0:00:55
112000 -- (-1167.303) (-1166.076) [-1163.341] (-1164.592) * (-1165.613) (-1163.687) [-1164.624] (-1173.108) -- 0:00:55
112500 -- (-1163.835) (-1163.633) [-1163.715] (-1165.039) * (-1170.394) [-1163.875] (-1164.591) (-1172.714) -- 0:00:55
113000 -- (-1164.945) (-1164.192) [-1165.691] (-1165.692) * (-1165.459) [-1163.342] (-1166.368) (-1171.874) -- 0:00:54
113500 -- (-1165.035) (-1163.810) [-1164.329] (-1165.984) * (-1166.298) [-1165.267] (-1166.879) (-1168.012) -- 0:00:54
114000 -- (-1165.570) [-1164.519] (-1166.935) (-1166.126) * (-1167.227) (-1166.122) [-1167.159] (-1170.051) -- 0:00:54
114500 -- [-1164.278] (-1167.338) (-1166.225) (-1164.454) * [-1170.219] (-1166.122) (-1165.703) (-1166.349) -- 0:00:54
115000 -- (-1164.437) [-1164.653] (-1168.147) (-1165.457) * [-1165.416] (-1163.355) (-1167.321) (-1166.218) -- 0:00:53
Average standard deviation of split frequencies: 0.019891
115500 -- (-1168.037) (-1164.653) (-1164.853) [-1166.778] * (-1164.608) (-1164.593) (-1168.051) [-1167.532] -- 0:00:53
116000 -- (-1168.529) [-1164.652] (-1165.333) (-1165.810) * (-1164.471) [-1165.161] (-1164.023) (-1166.029) -- 0:00:53
116500 -- (-1168.058) [-1164.989] (-1166.712) (-1167.507) * (-1167.361) (-1165.228) (-1167.626) [-1166.842] -- 0:00:53
117000 -- (-1164.999) [-1165.379] (-1167.843) (-1169.843) * (-1165.283) (-1167.585) (-1170.885) [-1165.250] -- 0:00:52
117500 -- (-1164.194) (-1164.528) [-1165.651] (-1165.071) * [-1164.534] (-1166.622) (-1168.199) (-1164.717) -- 0:00:52
118000 -- (-1167.284) [-1165.100] (-1166.987) (-1164.073) * [-1165.192] (-1166.749) (-1167.333) (-1164.738) -- 0:00:52
118500 -- (-1167.531) (-1165.049) (-1166.331) [-1164.365] * (-1166.031) (-1166.491) [-1168.437] (-1166.274) -- 0:00:52
119000 -- (-1163.548) [-1163.958] (-1164.058) (-1164.176) * (-1166.200) (-1163.571) (-1168.744) [-1166.921] -- 0:00:51
119500 -- [-1164.438] (-1163.787) (-1167.383) (-1168.706) * (-1165.237) (-1164.405) (-1168.053) [-1164.855] -- 0:00:58
120000 -- (-1166.173) (-1169.233) [-1164.951] (-1167.950) * (-1165.420) (-1164.406) (-1164.144) [-1164.515] -- 0:00:58
Average standard deviation of split frequencies: 0.018665
120500 -- [-1164.409] (-1166.511) (-1165.196) (-1168.989) * (-1164.916) (-1164.640) (-1169.776) [-1163.938] -- 0:00:58
121000 -- [-1165.779] (-1164.828) (-1167.368) (-1168.340) * (-1167.265) [-1166.564] (-1169.765) (-1164.744) -- 0:00:58
121500 -- [-1165.516] (-1166.380) (-1166.238) (-1164.769) * (-1167.215) (-1166.308) (-1166.422) [-1166.096] -- 0:00:57
122000 -- [-1167.900] (-1165.425) (-1166.016) (-1168.869) * (-1167.082) [-1165.828] (-1165.745) (-1165.691) -- 0:00:57
122500 -- (-1166.502) (-1165.100) [-1167.240] (-1167.724) * (-1166.979) [-1164.762] (-1167.861) (-1164.930) -- 0:00:57
123000 -- (-1166.450) [-1166.919] (-1165.845) (-1166.281) * (-1166.587) (-1168.788) (-1165.072) [-1164.090] -- 0:00:57
123500 -- [-1165.920] (-1165.194) (-1164.815) (-1166.772) * (-1164.715) (-1163.959) [-1164.776] (-1163.871) -- 0:00:56
124000 -- [-1164.604] (-1167.862) (-1169.000) (-1171.025) * (-1163.781) (-1164.406) (-1163.579) [-1163.870] -- 0:00:56
124500 -- [-1164.293] (-1163.932) (-1166.124) (-1170.497) * (-1163.857) (-1169.347) [-1165.134] (-1164.551) -- 0:00:56
125000 -- [-1164.282] (-1165.058) (-1166.538) (-1165.032) * [-1164.600] (-1167.422) (-1164.726) (-1165.011) -- 0:00:56
Average standard deviation of split frequencies: 0.019100
125500 -- (-1166.294) [-1169.215] (-1164.601) (-1163.369) * (-1164.025) (-1166.706) [-1168.479] (-1165.094) -- 0:00:55
126000 -- (-1166.406) (-1166.607) [-1164.023] (-1164.671) * (-1165.323) (-1165.886) (-1163.726) [-1164.282] -- 0:00:55
126500 -- (-1166.839) (-1166.039) (-1166.487) [-1166.546] * (-1164.120) [-1165.189] (-1170.484) (-1167.098) -- 0:00:55
127000 -- (-1168.545) (-1165.827) (-1166.848) [-1166.419] * (-1167.950) (-1164.760) [-1165.078] (-1165.470) -- 0:00:54
127500 -- [-1165.111] (-1166.141) (-1166.906) (-1165.064) * (-1168.622) [-1165.142] (-1165.195) (-1164.710) -- 0:00:54
128000 -- (-1166.333) (-1170.210) [-1166.138] (-1164.842) * (-1167.476) (-1163.930) (-1166.383) [-1165.731] -- 0:00:54
128500 -- (-1165.147) (-1166.640) (-1168.831) [-1165.228] * (-1167.981) (-1163.890) [-1166.788] (-1171.437) -- 0:00:54
129000 -- [-1164.970] (-1164.530) (-1164.526) (-1165.567) * [-1164.782] (-1171.536) (-1167.090) (-1166.284) -- 0:00:54
129500 -- (-1166.899) [-1165.704] (-1164.292) (-1166.334) * [-1165.291] (-1168.188) (-1163.836) (-1166.122) -- 0:00:53
130000 -- (-1164.051) (-1166.563) [-1163.924] (-1168.144) * (-1166.969) [-1167.078] (-1166.442) (-1168.630) -- 0:00:53
Average standard deviation of split frequencies: 0.019842
130500 -- (-1165.675) (-1166.295) [-1163.816] (-1165.234) * [-1166.522] (-1166.460) (-1166.168) (-1167.932) -- 0:00:53
131000 -- [-1166.389] (-1166.611) (-1165.182) (-1165.890) * (-1168.206) (-1166.542) [-1168.746] (-1168.085) -- 0:00:53
131500 -- [-1165.753] (-1164.465) (-1166.593) (-1168.481) * (-1166.882) [-1164.981] (-1166.456) (-1165.772) -- 0:00:52
132000 -- (-1165.107) (-1165.250) [-1169.329] (-1165.185) * [-1163.898] (-1164.297) (-1165.979) (-1164.225) -- 0:00:52
132500 -- [-1166.637] (-1167.790) (-1163.680) (-1168.275) * [-1165.305] (-1163.804) (-1168.019) (-1167.733) -- 0:00:52
133000 -- (-1167.132) [-1164.894] (-1166.670) (-1165.184) * (-1170.599) (-1163.607) (-1167.576) [-1165.405] -- 0:00:52
133500 -- (-1166.271) (-1163.851) (-1166.440) [-1163.811] * [-1166.084] (-1168.013) (-1164.200) (-1172.012) -- 0:00:51
134000 -- (-1166.020) [-1167.842] (-1167.517) (-1165.788) * (-1165.792) (-1166.474) [-1166.075] (-1167.402) -- 0:00:51
134500 -- (-1166.431) [-1164.082] (-1164.777) (-1167.987) * (-1165.582) [-1165.744] (-1168.746) (-1167.360) -- 0:00:51
135000 -- [-1166.329] (-1165.085) (-1168.753) (-1165.965) * (-1163.894) (-1164.946) [-1168.377] (-1168.039) -- 0:00:51
Average standard deviation of split frequencies: 0.020797
135500 -- (-1166.382) (-1165.462) [-1163.644] (-1165.750) * (-1164.024) (-1165.004) [-1165.013] (-1164.726) -- 0:00:57
136000 -- (-1165.006) [-1167.905] (-1163.660) (-1165.916) * (-1164.354) (-1165.195) [-1167.191] (-1167.609) -- 0:00:57
136500 -- [-1164.777] (-1164.782) (-1164.293) (-1164.669) * (-1164.995) (-1164.985) (-1167.771) [-1166.511] -- 0:00:56
137000 -- (-1164.324) (-1169.041) (-1166.941) [-1166.677] * (-1170.395) (-1163.966) [-1165.850] (-1166.828) -- 0:00:56
137500 -- [-1165.347] (-1165.093) (-1167.609) (-1166.343) * (-1167.084) (-1165.505) (-1165.146) [-1165.198] -- 0:00:56
138000 -- (-1165.570) [-1167.282] (-1163.441) (-1164.558) * (-1167.491) [-1164.734] (-1165.481) (-1168.118) -- 0:00:56
138500 -- (-1166.697) [-1164.580] (-1166.563) (-1164.280) * (-1165.469) [-1165.062] (-1164.893) (-1166.428) -- 0:00:55
139000 -- (-1168.897) (-1164.565) (-1170.134) [-1164.254] * (-1166.854) [-1164.971] (-1165.037) (-1168.954) -- 0:00:55
139500 -- (-1167.306) [-1166.326] (-1165.892) (-1166.479) * (-1164.935) [-1166.520] (-1163.224) (-1171.014) -- 0:00:55
140000 -- (-1167.044) (-1168.546) [-1165.948] (-1165.600) * (-1166.025) [-1166.338] (-1163.759) (-1169.444) -- 0:00:55
Average standard deviation of split frequencies: 0.020699
140500 -- (-1167.173) (-1169.980) (-1166.710) [-1165.659] * (-1166.813) [-1164.393] (-1165.057) (-1170.231) -- 0:00:55
141000 -- (-1166.006) [-1166.602] (-1165.557) (-1166.423) * (-1165.327) (-1164.598) [-1166.427] (-1165.342) -- 0:00:54
141500 -- (-1171.313) [-1165.877] (-1165.434) (-1165.775) * (-1165.632) (-1167.406) (-1165.225) [-1164.572] -- 0:00:54
142000 -- (-1171.169) (-1165.251) (-1165.482) [-1165.692] * (-1165.207) [-1168.283] (-1165.532) (-1169.502) -- 0:00:54
142500 -- [-1168.450] (-1166.267) (-1164.913) (-1169.319) * (-1164.219) (-1168.093) (-1168.150) [-1164.989] -- 0:00:54
143000 -- (-1168.009) [-1166.469] (-1166.363) (-1165.472) * [-1165.562] (-1167.056) (-1165.593) (-1167.845) -- 0:00:53
143500 -- (-1167.394) [-1166.069] (-1166.194) (-1165.149) * [-1163.736] (-1165.316) (-1164.114) (-1168.677) -- 0:00:53
144000 -- (-1170.461) (-1167.833) (-1170.038) [-1166.182] * (-1165.359) [-1167.353] (-1163.953) (-1165.851) -- 0:00:53
144500 -- (-1168.833) [-1166.140] (-1168.129) (-1165.291) * (-1164.756) (-1164.107) [-1165.552] (-1164.511) -- 0:00:53
145000 -- [-1167.047] (-1164.369) (-1166.144) (-1164.484) * (-1164.564) (-1165.724) [-1166.390] (-1166.221) -- 0:00:53
Average standard deviation of split frequencies: 0.018523
145500 -- (-1165.470) [-1164.237] (-1166.144) (-1167.969) * [-1163.588] (-1165.108) (-1165.323) (-1165.109) -- 0:00:52
146000 -- [-1163.794] (-1167.797) (-1165.759) (-1166.666) * (-1165.192) (-1165.874) (-1164.439) [-1164.882] -- 0:00:52
146500 -- (-1164.391) [-1165.207] (-1163.531) (-1167.056) * [-1163.581] (-1167.552) (-1166.053) (-1165.468) -- 0:00:52
147000 -- (-1168.358) (-1165.198) (-1164.664) [-1164.813] * [-1163.560] (-1166.806) (-1166.071) (-1166.892) -- 0:00:52
147500 -- [-1165.206] (-1164.219) (-1164.090) (-1166.351) * (-1166.007) (-1168.490) [-1165.568] (-1168.124) -- 0:00:52
148000 -- [-1165.106] (-1163.839) (-1163.665) (-1169.716) * (-1165.342) (-1166.515) (-1163.846) [-1165.198] -- 0:00:51
148500 -- (-1165.064) [-1163.948] (-1163.847) (-1170.774) * (-1165.659) [-1166.264] (-1167.213) (-1165.000) -- 0:00:51
149000 -- (-1166.933) (-1165.160) [-1164.804] (-1166.881) * (-1165.161) [-1165.178] (-1170.083) (-1167.408) -- 0:00:51
149500 -- (-1168.181) [-1163.654] (-1166.319) (-1166.367) * [-1165.895] (-1163.510) (-1164.736) (-1165.769) -- 0:00:51
150000 -- (-1167.702) [-1165.465] (-1165.055) (-1167.384) * (-1166.221) (-1165.283) [-1165.822] (-1167.713) -- 0:00:51
Average standard deviation of split frequencies: 0.018773
150500 -- [-1165.268] (-1167.113) (-1163.716) (-1167.660) * (-1165.968) (-1168.220) (-1164.034) [-1165.294] -- 0:00:50
151000 -- (-1166.693) (-1164.645) [-1163.768] (-1166.401) * (-1164.388) (-1166.317) (-1167.507) [-1168.710] -- 0:00:50
151500 -- (-1167.460) [-1164.356] (-1164.786) (-1163.931) * (-1164.957) [-1164.560] (-1165.408) (-1166.578) -- 0:00:50
152000 -- (-1166.683) (-1166.168) [-1168.427] (-1164.698) * (-1164.189) [-1164.390] (-1165.988) (-1167.062) -- 0:00:55
152500 -- (-1166.394) (-1165.307) [-1168.068] (-1166.005) * (-1165.228) [-1163.943] (-1164.905) (-1168.712) -- 0:00:55
153000 -- (-1168.035) [-1165.498] (-1163.775) (-1166.178) * (-1166.660) [-1165.938] (-1165.666) (-1170.600) -- 0:00:55
153500 -- (-1167.971) [-1165.217] (-1163.510) (-1169.914) * (-1167.505) (-1169.076) (-1167.925) [-1167.163] -- 0:00:55
154000 -- (-1169.752) [-1164.718] (-1165.859) (-1167.947) * [-1164.468] (-1169.624) (-1169.889) (-1165.312) -- 0:00:54
154500 -- (-1165.315) (-1164.488) (-1164.898) [-1166.822] * [-1165.908] (-1166.852) (-1169.290) (-1163.760) -- 0:00:54
155000 -- (-1163.794) (-1168.695) [-1163.990] (-1167.912) * [-1168.285] (-1165.836) (-1166.327) (-1166.822) -- 0:00:54
Average standard deviation of split frequencies: 0.020797
155500 -- [-1164.564] (-1165.924) (-1167.194) (-1163.783) * (-1166.937) (-1166.531) (-1164.591) [-1165.791] -- 0:00:54
156000 -- (-1167.998) [-1164.318] (-1166.995) (-1165.314) * [-1164.298] (-1166.474) (-1167.821) (-1164.807) -- 0:00:54
156500 -- (-1165.369) [-1167.187] (-1169.346) (-1165.582) * [-1165.029] (-1168.873) (-1167.609) (-1164.807) -- 0:00:53
157000 -- (-1167.756) (-1163.377) [-1165.515] (-1164.313) * [-1169.209] (-1167.760) (-1165.593) (-1169.196) -- 0:00:53
157500 -- (-1164.429) [-1163.746] (-1168.996) (-1163.668) * (-1163.594) [-1167.057] (-1166.720) (-1165.398) -- 0:00:53
158000 -- [-1164.682] (-1165.860) (-1164.452) (-1165.414) * (-1164.269) (-1169.055) (-1166.001) [-1166.636] -- 0:00:53
158500 -- (-1166.501) (-1168.099) [-1164.890] (-1163.750) * (-1164.313) [-1167.319] (-1164.473) (-1166.329) -- 0:00:53
159000 -- (-1164.629) (-1164.709) [-1166.338] (-1170.194) * [-1163.381] (-1164.684) (-1165.637) (-1165.845) -- 0:00:52
159500 -- (-1164.346) (-1164.797) [-1164.757] (-1168.931) * (-1165.700) (-1163.768) [-1164.197] (-1168.398) -- 0:00:52
160000 -- [-1163.317] (-1165.794) (-1165.078) (-1169.144) * (-1164.951) [-1164.789] (-1165.617) (-1164.382) -- 0:00:52
Average standard deviation of split frequencies: 0.020366
160500 -- (-1163.466) [-1164.106] (-1165.006) (-1171.273) * [-1166.195] (-1164.476) (-1165.978) (-1166.616) -- 0:00:52
161000 -- [-1167.819] (-1164.119) (-1166.154) (-1168.974) * (-1165.587) (-1165.466) [-1165.853] (-1167.291) -- 0:00:52
161500 -- [-1164.729] (-1164.604) (-1174.624) (-1168.018) * [-1165.529] (-1167.713) (-1165.980) (-1167.654) -- 0:00:51
162000 -- (-1165.737) [-1164.840] (-1167.032) (-1166.220) * (-1165.567) (-1165.454) (-1166.002) [-1166.515] -- 0:00:51
162500 -- (-1170.820) (-1163.694) [-1167.082] (-1171.167) * (-1170.377) [-1164.769] (-1166.462) (-1167.433) -- 0:00:51
163000 -- [-1170.642] (-1165.569) (-1169.903) (-1173.154) * (-1164.661) [-1165.916] (-1169.899) (-1164.947) -- 0:00:51
163500 -- (-1167.118) (-1168.326) (-1167.288) [-1166.682] * [-1164.512] (-1167.601) (-1166.785) (-1167.981) -- 0:00:51
164000 -- (-1167.468) [-1164.572] (-1167.240) (-1165.569) * [-1165.270] (-1172.576) (-1167.688) (-1164.599) -- 0:00:50
164500 -- [-1168.054] (-1168.057) (-1169.826) (-1165.163) * [-1169.009] (-1166.962) (-1171.281) (-1165.029) -- 0:00:50
165000 -- (-1165.355) [-1168.995] (-1169.526) (-1166.815) * [-1163.964] (-1166.943) (-1165.567) (-1163.918) -- 0:00:50
Average standard deviation of split frequencies: 0.020714
165500 -- (-1165.703) (-1171.556) (-1167.108) [-1166.475] * (-1164.311) [-1165.982] (-1165.685) (-1163.971) -- 0:00:50
166000 -- (-1165.596) [-1165.325] (-1170.156) (-1171.317) * (-1163.748) [-1165.745] (-1166.217) (-1165.352) -- 0:00:50
166500 -- (-1165.801) (-1164.314) [-1163.734] (-1170.410) * (-1164.978) (-1169.591) [-1167.165] (-1165.524) -- 0:00:50
167000 -- (-1165.857) [-1164.863] (-1163.821) (-1171.281) * [-1164.489] (-1165.277) (-1166.441) (-1165.866) -- 0:00:49
167500 -- (-1165.598) [-1163.567] (-1165.508) (-1169.510) * (-1165.641) [-1165.519] (-1163.584) (-1165.864) -- 0:00:49
168000 -- (-1164.402) [-1163.842] (-1166.136) (-1172.626) * (-1165.007) [-1164.783] (-1168.254) (-1164.966) -- 0:00:54
168500 -- [-1163.775] (-1165.628) (-1163.964) (-1172.525) * [-1168.554] (-1165.387) (-1170.288) (-1168.150) -- 0:00:54
169000 -- (-1163.783) (-1166.456) [-1163.964] (-1165.047) * (-1165.433) [-1163.462] (-1170.188) (-1166.481) -- 0:00:54
169500 -- (-1169.027) [-1164.450] (-1165.010) (-1165.389) * (-1165.409) [-1163.815] (-1169.687) (-1164.703) -- 0:00:53
170000 -- (-1167.082) (-1166.117) (-1166.595) [-1164.181] * (-1165.409) (-1163.923) (-1172.650) [-1166.108] -- 0:00:53
Average standard deviation of split frequencies: 0.022097
170500 -- (-1167.417) (-1165.358) (-1165.237) [-1167.736] * [-1165.283] (-1164.523) (-1170.047) (-1164.632) -- 0:00:53
171000 -- (-1167.014) [-1165.401] (-1165.660) (-1167.624) * (-1167.120) (-1164.572) (-1167.612) [-1164.213] -- 0:00:53
171500 -- (-1164.194) (-1165.184) [-1167.621] (-1172.149) * (-1166.737) (-1164.200) (-1164.041) [-1167.284] -- 0:00:53
172000 -- [-1166.891] (-1165.420) (-1165.099) (-1166.367) * (-1165.644) (-1171.746) [-1166.488] (-1164.875) -- 0:00:52
172500 -- (-1165.355) (-1167.521) [-1165.922] (-1166.758) * (-1165.255) (-1168.184) (-1165.171) [-1166.482] -- 0:00:52
173000 -- (-1165.165) (-1166.786) (-1164.776) [-1164.705] * (-1165.455) (-1165.474) (-1164.003) [-1165.562] -- 0:00:52
173500 -- [-1167.373] (-1166.607) (-1163.900) (-1164.641) * (-1167.357) (-1165.474) (-1168.531) [-1166.056] -- 0:00:52
174000 -- (-1167.163) (-1167.518) (-1164.815) [-1163.881] * (-1164.869) (-1170.471) (-1164.808) [-1166.609] -- 0:00:52
174500 -- (-1164.660) [-1167.328] (-1166.400) (-1166.351) * [-1164.533] (-1168.643) (-1166.167) (-1168.403) -- 0:00:52
175000 -- (-1164.142) (-1165.657) [-1165.125] (-1164.473) * (-1168.972) (-1164.845) (-1166.720) [-1166.280] -- 0:00:51
Average standard deviation of split frequencies: 0.022373
175500 -- (-1163.919) (-1164.012) (-1165.205) [-1166.543] * (-1166.135) (-1163.979) (-1166.653) [-1166.538] -- 0:00:51
176000 -- [-1166.477] (-1165.349) (-1167.114) (-1165.257) * (-1167.120) (-1165.294) [-1164.484] (-1168.632) -- 0:00:51
176500 -- (-1165.201) [-1164.561] (-1166.455) (-1163.947) * [-1166.506] (-1164.522) (-1164.180) (-1165.769) -- 0:00:51
177000 -- (-1163.913) [-1166.769] (-1166.789) (-1163.417) * (-1168.703) (-1164.963) [-1164.105] (-1165.681) -- 0:00:51
177500 -- (-1163.930) [-1166.090] (-1163.816) (-1163.832) * (-1165.771) [-1164.949] (-1167.576) (-1169.527) -- 0:00:50
178000 -- (-1165.987) (-1171.496) (-1164.995) [-1168.113] * (-1165.047) (-1168.515) [-1163.916] (-1166.952) -- 0:00:50
178500 -- (-1164.561) (-1166.391) (-1166.225) [-1165.578] * (-1163.944) [-1166.035] (-1165.086) (-1167.866) -- 0:00:50
179000 -- (-1164.539) (-1167.146) (-1169.391) [-1169.128] * [-1163.883] (-1163.641) (-1165.829) (-1164.816) -- 0:00:50
179500 -- (-1168.226) (-1165.354) (-1169.309) [-1167.265] * (-1163.704) [-1165.565] (-1164.857) (-1168.606) -- 0:00:50
180000 -- (-1165.282) (-1168.028) (-1168.681) [-1165.710] * (-1165.449) (-1164.361) (-1167.362) [-1165.365] -- 0:00:50
Average standard deviation of split frequencies: 0.020548
180500 -- [-1165.537] (-1164.942) (-1164.678) (-1169.364) * (-1167.221) (-1164.361) [-1166.481] (-1166.478) -- 0:00:49
181000 -- (-1167.975) (-1165.292) [-1166.492] (-1164.541) * (-1166.002) (-1163.420) (-1163.299) [-1165.243] -- 0:00:49
181500 -- (-1165.438) [-1166.048] (-1164.418) (-1164.462) * [-1165.180] (-1163.380) (-1165.927) (-1166.951) -- 0:00:49
182000 -- [-1167.698] (-1170.877) (-1165.109) (-1164.026) * (-1164.866) (-1163.946) [-1167.108] (-1165.037) -- 0:00:49
182500 -- [-1168.414] (-1170.192) (-1165.134) (-1164.553) * (-1164.312) [-1164.804] (-1167.835) (-1163.815) -- 0:00:49
183000 -- (-1163.353) (-1168.764) [-1165.576] (-1168.242) * [-1165.290] (-1167.175) (-1167.957) (-1164.619) -- 0:00:49
183500 -- [-1163.576] (-1168.061) (-1165.151) (-1165.662) * (-1165.313) (-1167.474) (-1167.939) [-1165.099] -- 0:00:48
184000 -- (-1166.013) [-1167.979] (-1164.349) (-1167.609) * (-1167.097) [-1166.836] (-1165.765) (-1166.701) -- 0:00:48
184500 -- (-1168.983) (-1167.029) (-1166.574) [-1165.371] * (-1164.785) (-1164.331) [-1164.801] (-1165.680) -- 0:00:53
185000 -- (-1165.274) (-1163.927) [-1165.384] (-1165.096) * (-1164.881) [-1165.508] (-1166.027) (-1165.803) -- 0:00:52
Average standard deviation of split frequencies: 0.020425
185500 -- [-1167.191] (-1165.372) (-1164.378) (-1166.074) * (-1163.836) (-1169.459) (-1164.259) [-1166.697] -- 0:00:52
186000 -- (-1173.322) [-1165.193] (-1165.594) (-1165.032) * (-1163.854) [-1164.839] (-1172.505) (-1166.298) -- 0:00:52
186500 -- (-1169.744) [-1164.164] (-1166.160) (-1165.665) * (-1164.106) (-1165.468) (-1167.555) [-1165.283] -- 0:00:52
187000 -- (-1169.005) (-1164.581) [-1164.274] (-1164.899) * [-1164.214] (-1167.231) (-1165.971) (-1165.376) -- 0:00:52
187500 -- (-1175.497) [-1168.194] (-1163.959) (-1166.636) * [-1163.778] (-1167.709) (-1169.113) (-1167.135) -- 0:00:52
188000 -- (-1170.883) [-1166.644] (-1166.245) (-1164.989) * (-1164.971) [-1165.771] (-1166.479) (-1168.258) -- 0:00:51
188500 -- [-1169.434] (-1166.872) (-1165.109) (-1167.368) * (-1167.888) (-1166.971) [-1166.387] (-1165.324) -- 0:00:51
189000 -- (-1169.009) (-1167.280) (-1168.065) [-1167.577] * (-1165.404) [-1164.464] (-1165.284) (-1166.527) -- 0:00:51
189500 -- (-1168.009) (-1166.411) (-1164.452) [-1163.504] * (-1164.833) (-1165.150) (-1164.878) [-1164.786] -- 0:00:51
190000 -- (-1167.072) (-1168.472) (-1163.962) [-1165.383] * [-1167.100] (-1165.273) (-1166.501) (-1163.873) -- 0:00:51
Average standard deviation of split frequencies: 0.018470
190500 -- (-1163.862) (-1165.574) [-1167.981] (-1165.558) * (-1168.508) (-1165.167) [-1163.651] (-1165.189) -- 0:00:50
191000 -- (-1163.994) [-1164.143] (-1171.382) (-1165.294) * (-1165.071) (-1174.016) (-1164.449) [-1163.614] -- 0:00:50
191500 -- [-1165.540] (-1165.077) (-1172.610) (-1166.269) * (-1163.945) (-1165.154) [-1166.745] (-1165.896) -- 0:00:50
192000 -- (-1167.724) [-1164.696] (-1167.925) (-1166.701) * [-1165.322] (-1164.717) (-1164.149) (-1166.538) -- 0:00:50
192500 -- (-1166.985) (-1166.546) [-1166.000] (-1168.455) * (-1164.709) (-1164.521) (-1165.648) [-1167.671] -- 0:00:50
193000 -- (-1166.553) (-1164.225) [-1166.460] (-1167.031) * (-1165.815) (-1167.640) (-1164.992) [-1165.922] -- 0:00:50
193500 -- (-1165.308) [-1164.241] (-1167.947) (-1170.152) * (-1165.494) (-1164.620) [-1164.083] (-1164.348) -- 0:00:50
194000 -- (-1164.285) (-1166.276) (-1167.706) [-1164.291] * [-1166.897] (-1168.303) (-1164.916) (-1164.339) -- 0:00:49
194500 -- (-1165.794) [-1167.442] (-1163.624) (-1164.893) * (-1168.781) [-1164.710] (-1168.137) (-1165.285) -- 0:00:49
195000 -- (-1163.951) [-1166.789] (-1166.740) (-1165.226) * [-1167.119] (-1166.621) (-1168.575) (-1163.975) -- 0:00:49
Average standard deviation of split frequencies: 0.018958
195500 -- (-1163.946) (-1163.776) [-1163.713] (-1165.634) * (-1165.400) (-1164.774) [-1164.259] (-1170.079) -- 0:00:49
196000 -- [-1167.144] (-1169.088) (-1164.073) (-1167.433) * (-1167.574) [-1165.378] (-1165.309) (-1165.962) -- 0:00:49
196500 -- (-1167.081) (-1172.026) (-1167.444) [-1166.082] * (-1169.638) [-1165.983] (-1167.009) (-1167.162) -- 0:00:49
197000 -- [-1169.214] (-1167.549) (-1166.653) (-1167.157) * (-1165.482) [-1164.204] (-1164.795) (-1167.379) -- 0:00:48
197500 -- (-1168.910) (-1166.107) [-1165.496] (-1164.605) * (-1166.472) [-1165.269] (-1165.798) (-1167.643) -- 0:00:48
198000 -- (-1169.720) [-1165.751] (-1165.039) (-1166.395) * (-1168.051) (-1163.967) [-1166.055] (-1168.738) -- 0:00:48
198500 -- (-1165.970) [-1166.210] (-1167.176) (-1168.397) * [-1165.252] (-1168.348) (-1167.049) (-1165.890) -- 0:00:48
199000 -- (-1168.471) [-1170.494] (-1166.868) (-1170.029) * (-1166.482) (-1168.382) [-1169.557] (-1165.276) -- 0:00:48
199500 -- [-1167.427] (-1166.830) (-1170.314) (-1165.415) * [-1165.894] (-1164.488) (-1166.864) (-1164.205) -- 0:00:48
200000 -- [-1165.957] (-1165.174) (-1168.418) (-1165.986) * [-1165.311] (-1166.697) (-1168.591) (-1167.234) -- 0:00:48
Average standard deviation of split frequencies: 0.018932
200500 -- (-1164.771) (-1165.174) [-1169.083] (-1164.937) * [-1164.618] (-1168.816) (-1164.310) (-1166.684) -- 0:00:51
201000 -- [-1165.842] (-1167.095) (-1168.400) (-1174.038) * (-1164.535) (-1166.068) (-1164.960) [-1164.611] -- 0:00:51
201500 -- (-1164.937) [-1164.732] (-1168.786) (-1169.240) * (-1166.626) (-1166.296) (-1165.043) [-1164.975] -- 0:00:51
202000 -- [-1165.164] (-1167.968) (-1167.781) (-1169.563) * [-1165.958] (-1166.163) (-1165.241) (-1164.766) -- 0:00:51
202500 -- [-1164.697] (-1165.957) (-1164.288) (-1164.815) * (-1164.401) [-1165.854] (-1167.233) (-1164.694) -- 0:00:51
203000 -- [-1166.131] (-1166.353) (-1167.406) (-1164.432) * (-1163.260) (-1165.035) [-1165.532] (-1166.775) -- 0:00:51
203500 -- (-1168.245) (-1167.849) [-1167.113] (-1165.712) * (-1163.756) (-1166.486) [-1166.483] (-1167.563) -- 0:00:50
204000 -- (-1168.484) [-1164.777] (-1165.543) (-1166.661) * [-1165.431] (-1164.805) (-1165.942) (-1163.646) -- 0:00:50
204500 -- (-1168.206) [-1167.726] (-1168.776) (-1165.595) * [-1165.662] (-1166.920) (-1166.593) (-1167.407) -- 0:00:50
205000 -- (-1165.131) (-1166.866) (-1164.671) [-1165.021] * (-1166.777) (-1169.115) [-1165.674] (-1167.689) -- 0:00:50
Average standard deviation of split frequencies: 0.018980
205500 -- (-1169.028) (-1164.576) (-1164.639) [-1166.515] * [-1164.393] (-1176.983) (-1165.480) (-1165.401) -- 0:00:50
206000 -- [-1164.658] (-1167.261) (-1165.403) (-1165.368) * (-1166.126) (-1167.268) (-1166.749) [-1163.999] -- 0:00:50
206500 -- (-1164.133) (-1164.285) (-1165.291) [-1164.188] * (-1166.748) (-1168.169) [-1167.758] (-1166.623) -- 0:00:49
207000 -- (-1165.287) (-1164.286) [-1167.355] (-1165.916) * (-1165.292) (-1164.379) (-1168.188) [-1168.943] -- 0:00:49
207500 -- (-1165.556) (-1164.329) (-1168.077) [-1164.916] * [-1169.580] (-1167.684) (-1165.241) (-1166.162) -- 0:00:49
208000 -- (-1165.286) (-1168.671) (-1166.794) [-1166.675] * (-1165.209) (-1168.908) [-1164.680] (-1169.784) -- 0:00:49
208500 -- (-1168.075) (-1163.784) (-1165.104) [-1164.871] * [-1165.402] (-1167.700) (-1166.447) (-1165.818) -- 0:00:49
209000 -- (-1170.188) (-1163.658) [-1165.062] (-1166.602) * [-1168.610] (-1166.825) (-1163.502) (-1165.297) -- 0:00:49
209500 -- (-1166.119) [-1164.692] (-1168.405) (-1167.461) * (-1163.687) (-1168.571) [-1164.105] (-1164.948) -- 0:00:49
210000 -- (-1168.576) [-1164.385] (-1169.118) (-1165.339) * (-1165.215) (-1165.926) (-1163.984) [-1163.471] -- 0:00:48
Average standard deviation of split frequencies: 0.016161
210500 -- [-1166.954] (-1166.332) (-1165.668) (-1169.861) * (-1164.715) [-1165.465] (-1165.863) (-1164.244) -- 0:00:48
211000 -- (-1170.071) [-1166.110] (-1167.024) (-1165.458) * (-1165.175) (-1163.931) [-1165.843] (-1164.179) -- 0:00:48
211500 -- (-1165.587) [-1165.454] (-1165.215) (-1164.827) * (-1164.884) (-1166.170) [-1166.274] (-1166.163) -- 0:00:48
212000 -- (-1166.617) [-1164.163] (-1166.963) (-1164.158) * [-1164.885] (-1165.754) (-1167.182) (-1170.116) -- 0:00:48
212500 -- (-1167.465) (-1166.232) (-1164.937) [-1164.002] * (-1164.950) [-1165.765] (-1164.594) (-1164.676) -- 0:00:48
213000 -- (-1164.253) (-1164.317) (-1168.640) [-1164.592] * (-1164.918) (-1164.337) [-1164.241] (-1168.711) -- 0:00:48
213500 -- (-1164.996) [-1164.150] (-1164.430) (-1166.721) * (-1163.898) (-1165.321) [-1163.817] (-1171.101) -- 0:00:47
214000 -- [-1163.945] (-1163.917) (-1165.671) (-1168.972) * (-1165.294) (-1164.196) [-1164.566] (-1165.476) -- 0:00:47
214500 -- [-1166.285] (-1166.009) (-1164.821) (-1164.434) * [-1164.759] (-1164.238) (-1164.511) (-1164.729) -- 0:00:47
215000 -- (-1169.656) (-1166.703) [-1164.662] (-1168.770) * [-1164.560] (-1166.513) (-1166.757) (-1166.253) -- 0:00:47
Average standard deviation of split frequencies: 0.015550
215500 -- [-1168.931] (-1165.469) (-1165.568) (-1168.792) * (-1165.988) (-1164.026) [-1167.594] (-1164.545) -- 0:00:47
216000 -- [-1167.809] (-1164.599) (-1164.430) (-1165.168) * (-1166.960) (-1165.953) (-1165.882) [-1164.397] -- 0:00:47
216500 -- (-1164.600) [-1166.870] (-1165.227) (-1168.101) * (-1165.497) (-1166.452) (-1164.343) [-1166.311] -- 0:00:50
217000 -- (-1165.285) [-1163.636] (-1166.335) (-1168.844) * [-1164.570] (-1168.664) (-1166.794) (-1164.687) -- 0:00:50
217500 -- (-1166.398) (-1163.636) (-1166.155) [-1166.957] * [-1167.848] (-1165.663) (-1163.213) (-1165.418) -- 0:00:50
218000 -- [-1166.541] (-1170.603) (-1165.092) (-1165.976) * (-1164.820) (-1167.547) [-1164.189] (-1168.508) -- 0:00:50
218500 -- (-1166.363) (-1166.623) (-1165.275) [-1169.148] * (-1167.281) [-1165.750] (-1164.744) (-1164.912) -- 0:00:50
219000 -- (-1165.781) [-1165.857] (-1164.849) (-1169.038) * (-1164.345) (-1167.694) (-1164.500) [-1165.030] -- 0:00:49
219500 -- (-1167.428) (-1165.011) (-1165.500) [-1166.260] * (-1164.786) (-1164.989) (-1166.974) [-1165.273] -- 0:00:49
220000 -- [-1165.538] (-1163.889) (-1165.035) (-1166.168) * (-1164.990) (-1167.165) (-1164.744) [-1165.059] -- 0:00:49
Average standard deviation of split frequencies: 0.014820
220500 -- [-1163.784] (-1168.020) (-1166.186) (-1166.995) * [-1165.657] (-1165.785) (-1165.794) (-1164.789) -- 0:00:49
221000 -- [-1163.453] (-1169.414) (-1164.994) (-1169.214) * (-1165.389) [-1165.552] (-1166.197) (-1163.956) -- 0:00:49
221500 -- (-1164.537) (-1166.786) [-1163.640] (-1166.642) * (-1164.910) (-1165.602) [-1168.872] (-1163.956) -- 0:00:49
222000 -- [-1163.615] (-1166.410) (-1164.640) (-1168.783) * [-1164.379] (-1164.328) (-1166.588) (-1163.735) -- 0:00:49
222500 -- (-1163.978) (-1164.073) [-1166.130] (-1168.335) * [-1165.088] (-1166.500) (-1168.277) (-1163.590) -- 0:00:48
223000 -- [-1163.916] (-1167.083) (-1166.686) (-1164.004) * (-1164.118) (-1167.496) [-1166.322] (-1165.301) -- 0:00:48
223500 -- (-1163.691) (-1167.948) [-1165.011] (-1163.727) * (-1165.046) (-1166.568) (-1173.921) [-1164.284] -- 0:00:48
224000 -- (-1167.406) [-1168.418] (-1167.907) (-1170.303) * [-1164.865] (-1172.468) (-1167.943) (-1164.053) -- 0:00:48
224500 -- [-1166.634] (-1167.424) (-1164.359) (-1169.044) * [-1164.517] (-1168.914) (-1164.180) (-1164.584) -- 0:00:48
225000 -- (-1168.803) [-1165.656] (-1168.172) (-1167.293) * (-1167.933) [-1164.504] (-1169.255) (-1166.016) -- 0:00:48
Average standard deviation of split frequencies: 0.016223
225500 -- [-1169.103] (-1166.187) (-1168.216) (-1163.710) * [-1165.923] (-1164.691) (-1164.982) (-1165.461) -- 0:00:48
226000 -- (-1168.233) (-1167.841) [-1164.697] (-1165.661) * (-1166.456) (-1164.551) [-1166.289] (-1167.403) -- 0:00:47
226500 -- (-1166.838) (-1167.311) [-1166.106] (-1165.661) * (-1165.900) [-1169.278] (-1168.754) (-1165.351) -- 0:00:47
227000 -- (-1166.446) (-1166.588) [-1167.261] (-1166.444) * [-1164.936] (-1167.036) (-1165.377) (-1165.404) -- 0:00:47
227500 -- (-1165.145) (-1164.719) (-1164.253) [-1164.004] * (-1165.676) (-1169.601) (-1166.083) [-1165.051] -- 0:00:47
228000 -- [-1165.251] (-1166.934) (-1163.549) (-1168.720) * (-1168.201) (-1170.427) [-1164.512] (-1165.468) -- 0:00:47
228500 -- (-1164.155) (-1166.183) [-1164.100] (-1170.410) * (-1166.926) (-1166.696) [-1164.152] (-1165.612) -- 0:00:47
229000 -- (-1164.242) (-1169.374) [-1164.557] (-1167.813) * (-1167.686) [-1164.108] (-1165.466) (-1165.376) -- 0:00:47
229500 -- [-1164.021] (-1165.460) (-1165.745) (-1167.149) * (-1164.191) [-1163.990] (-1165.064) (-1169.149) -- 0:00:47
230000 -- (-1163.676) [-1165.763] (-1164.849) (-1166.166) * (-1165.136) (-1166.020) (-1164.260) [-1165.430] -- 0:00:46
Average standard deviation of split frequencies: 0.015327
230500 -- (-1163.573) [-1164.803] (-1165.009) (-1169.620) * (-1165.297) [-1167.917] (-1166.076) (-1166.435) -- 0:00:46
231000 -- (-1167.537) (-1164.891) (-1171.757) [-1164.823] * (-1164.712) (-1166.857) [-1164.021] (-1165.173) -- 0:00:46
231500 -- [-1167.573] (-1166.663) (-1167.893) (-1167.220) * (-1165.384) (-1167.843) [-1165.838] (-1166.143) -- 0:00:46
232000 -- (-1164.360) (-1166.564) (-1166.227) [-1169.395] * (-1164.828) [-1166.615] (-1171.107) (-1164.625) -- 0:00:46
232500 -- [-1163.773] (-1166.748) (-1170.314) (-1166.612) * (-1166.877) (-1167.322) [-1165.763] (-1164.773) -- 0:00:46
233000 -- (-1163.768) (-1166.153) (-1165.123) [-1167.246] * (-1169.496) (-1165.141) (-1171.493) [-1164.275] -- 0:00:49
233500 -- (-1165.605) (-1167.344) (-1165.379) [-1167.548] * (-1164.143) [-1165.492] (-1164.990) (-1164.151) -- 0:00:49
234000 -- (-1168.336) (-1164.320) [-1165.889] (-1165.196) * (-1166.503) (-1166.348) (-1166.172) [-1165.383] -- 0:00:49
234500 -- (-1164.257) (-1165.482) [-1167.422] (-1165.345) * [-1164.102] (-1168.216) (-1165.656) (-1164.504) -- 0:00:48
235000 -- (-1165.499) [-1165.179] (-1167.558) (-1169.441) * (-1164.223) (-1168.955) (-1165.310) [-1167.147] -- 0:00:48
Average standard deviation of split frequencies: 0.017103
235500 -- (-1164.888) (-1166.375) [-1168.781] (-1167.317) * [-1166.245] (-1164.627) (-1165.189) (-1164.742) -- 0:00:48
236000 -- (-1168.607) (-1168.317) [-1166.825] (-1167.162) * [-1164.469] (-1163.333) (-1165.233) (-1165.220) -- 0:00:48
236500 -- [-1165.345] (-1166.997) (-1165.542) (-1165.651) * (-1164.230) [-1163.333] (-1164.872) (-1164.284) -- 0:00:48
237000 -- [-1164.850] (-1170.080) (-1165.265) (-1167.183) * (-1165.951) (-1166.029) [-1164.159] (-1165.347) -- 0:00:48
237500 -- (-1169.343) (-1165.690) (-1165.893) [-1166.796] * (-1165.186) [-1164.822] (-1167.337) (-1167.811) -- 0:00:48
238000 -- [-1169.227] (-1165.927) (-1165.514) (-1166.011) * (-1165.020) (-1167.073) [-1163.874] (-1168.727) -- 0:00:48
238500 -- (-1166.164) [-1165.987] (-1164.741) (-1165.131) * (-1165.390) (-1166.271) [-1167.360] (-1165.605) -- 0:00:47
239000 -- (-1164.746) [-1165.395] (-1166.046) (-1165.301) * (-1167.675) [-1165.832] (-1167.953) (-1168.872) -- 0:00:47
239500 -- (-1164.393) [-1167.743] (-1166.871) (-1165.972) * (-1164.157) (-1166.547) [-1165.570] (-1163.838) -- 0:00:47
240000 -- (-1164.906) (-1164.839) [-1163.230] (-1165.206) * [-1164.048] (-1165.040) (-1165.833) (-1163.524) -- 0:00:47
Average standard deviation of split frequencies: 0.016527
240500 -- (-1168.345) (-1165.561) [-1163.770] (-1164.892) * (-1168.770) (-1165.350) (-1165.244) [-1165.189] -- 0:00:47
241000 -- (-1165.851) (-1165.314) (-1163.751) [-1170.044] * [-1168.165] (-1168.308) (-1165.417) (-1167.179) -- 0:00:47
241500 -- (-1167.942) (-1167.355) (-1164.334) [-1170.001] * (-1166.863) (-1165.934) (-1165.706) [-1165.240] -- 0:00:47
242000 -- (-1167.161) [-1166.281] (-1164.318) (-1165.756) * (-1169.682) (-1165.999) (-1166.735) [-1164.500] -- 0:00:46
242500 -- (-1173.190) [-1164.212] (-1165.576) (-1163.676) * (-1166.230) (-1165.073) [-1168.497] (-1164.748) -- 0:00:46
243000 -- (-1169.102) (-1164.199) [-1164.711] (-1165.421) * (-1169.664) [-1164.374] (-1164.236) (-1164.013) -- 0:00:46
243500 -- (-1163.779) (-1164.903) (-1168.858) [-1164.489] * (-1166.686) [-1163.684] (-1165.453) (-1163.777) -- 0:00:46
244000 -- (-1164.881) [-1164.021] (-1166.454) (-1164.621) * (-1167.201) (-1163.732) (-1168.224) [-1163.776] -- 0:00:46
244500 -- (-1164.608) [-1166.861] (-1167.255) (-1164.005) * (-1167.013) (-1163.584) [-1166.490] (-1164.966) -- 0:00:46
245000 -- (-1165.297) (-1168.778) [-1168.003] (-1166.336) * (-1167.708) [-1164.637] (-1166.903) (-1164.962) -- 0:00:46
Average standard deviation of split frequencies: 0.015894
245500 -- [-1166.676] (-1167.000) (-1166.862) (-1165.033) * [-1163.975] (-1165.512) (-1165.679) (-1166.257) -- 0:00:46
246000 -- (-1166.220) (-1166.645) [-1164.216] (-1163.873) * (-1164.208) [-1164.671] (-1165.417) (-1165.297) -- 0:00:45
246500 -- [-1165.006] (-1166.273) (-1165.549) (-1163.641) * (-1165.420) (-1164.608) [-1165.345] (-1164.406) -- 0:00:45
247000 -- (-1167.619) (-1165.859) (-1164.682) [-1166.218] * (-1166.719) [-1168.484] (-1166.424) (-1165.816) -- 0:00:45
247500 -- (-1168.140) [-1165.703] (-1164.664) (-1166.610) * (-1166.287) (-1165.020) (-1166.309) [-1164.661] -- 0:00:45
248000 -- (-1166.210) [-1166.762] (-1163.949) (-1170.988) * (-1163.546) (-1164.316) [-1166.357] (-1164.680) -- 0:00:45
248500 -- (-1166.698) [-1164.039] (-1167.266) (-1171.430) * (-1163.630) (-1164.695) [-1165.565] (-1165.890) -- 0:00:45
249000 -- [-1166.029] (-1166.228) (-1168.642) (-1165.253) * (-1164.449) (-1168.680) (-1166.117) [-1166.471] -- 0:00:48
249500 -- (-1165.163) (-1165.152) (-1164.273) [-1166.346] * [-1164.014] (-1163.585) (-1167.104) (-1166.274) -- 0:00:48
250000 -- [-1168.006] (-1166.258) (-1165.459) (-1166.305) * (-1163.762) (-1164.295) (-1165.628) [-1164.726] -- 0:00:48
Average standard deviation of split frequencies: 0.015598
250500 -- (-1166.977) (-1164.471) (-1165.473) [-1165.636] * (-1163.539) [-1165.963] (-1168.834) (-1166.234) -- 0:00:47
251000 -- (-1168.626) (-1164.288) [-1166.141] (-1163.999) * (-1164.362) [-1164.353] (-1164.485) (-1164.416) -- 0:00:47
251500 -- (-1169.642) [-1165.600] (-1166.524) (-1165.547) * (-1164.765) [-1165.693] (-1166.427) (-1166.922) -- 0:00:47
252000 -- (-1167.161) (-1163.789) (-1166.354) [-1167.195] * (-1166.623) (-1166.678) (-1164.857) [-1165.036] -- 0:00:47
252500 -- (-1168.192) (-1163.337) [-1167.020] (-1167.204) * (-1168.309) (-1166.183) (-1165.565) [-1164.839] -- 0:00:47
253000 -- (-1164.713) [-1165.828] (-1167.156) (-1164.430) * [-1165.999] (-1164.007) (-1166.677) (-1164.692) -- 0:00:47
253500 -- (-1164.438) (-1165.648) (-1165.154) [-1164.168] * (-1168.696) (-1164.386) [-1166.486] (-1164.897) -- 0:00:47
254000 -- [-1164.473] (-1165.728) (-1164.504) (-1165.547) * [-1167.441] (-1165.722) (-1164.340) (-1164.966) -- 0:00:46
254500 -- (-1164.698) (-1164.896) [-1166.182] (-1164.586) * (-1165.194) (-1165.731) [-1165.150] (-1164.230) -- 0:00:46
255000 -- (-1167.731) (-1174.709) [-1167.718] (-1164.242) * (-1166.543) [-1166.700] (-1167.265) (-1164.973) -- 0:00:46
Average standard deviation of split frequencies: 0.014501
255500 -- (-1165.696) [-1169.179] (-1166.065) (-1163.969) * (-1165.226) [-1166.788] (-1169.792) (-1164.864) -- 0:00:46
256000 -- (-1168.312) (-1167.551) [-1167.328] (-1165.159) * [-1165.924] (-1165.750) (-1168.692) (-1164.668) -- 0:00:46
256500 -- (-1164.476) [-1164.955] (-1168.036) (-1165.507) * [-1165.270] (-1165.187) (-1166.941) (-1163.802) -- 0:00:46
257000 -- [-1165.651] (-1165.237) (-1166.014) (-1164.395) * (-1165.142) (-1164.814) [-1166.899] (-1167.416) -- 0:00:46
257500 -- [-1167.686] (-1165.008) (-1164.316) (-1164.497) * (-1165.021) (-1164.571) [-1165.614] (-1163.795) -- 0:00:46
258000 -- [-1168.156] (-1165.436) (-1163.996) (-1163.628) * (-1163.932) (-1174.863) [-1169.099] (-1167.603) -- 0:00:46
258500 -- [-1176.711] (-1163.977) (-1164.836) (-1165.615) * (-1164.314) (-1171.286) (-1168.487) [-1167.066] -- 0:00:45
259000 -- (-1174.614) (-1166.213) [-1165.059] (-1165.123) * (-1165.096) [-1164.560] (-1164.021) (-1167.005) -- 0:00:45
259500 -- (-1169.715) (-1165.571) [-1165.704] (-1165.468) * (-1166.329) (-1165.022) [-1168.658] (-1165.302) -- 0:00:45
260000 -- [-1164.168] (-1164.884) (-1164.615) (-1164.783) * (-1166.605) (-1167.159) (-1164.850) [-1165.102] -- 0:00:45
Average standard deviation of split frequencies: 0.014355
260500 -- (-1163.936) [-1163.872] (-1165.725) (-1163.732) * [-1164.083] (-1167.159) (-1164.843) (-1165.921) -- 0:00:45
261000 -- (-1164.081) [-1167.787] (-1164.552) (-1164.492) * (-1164.686) (-1168.165) [-1165.874] (-1169.849) -- 0:00:45
261500 -- (-1165.252) [-1167.153] (-1165.255) (-1163.730) * (-1164.501) [-1167.834] (-1164.783) (-1166.234) -- 0:00:45
262000 -- (-1164.347) [-1166.899] (-1165.607) (-1164.120) * [-1167.294] (-1165.779) (-1170.829) (-1165.045) -- 0:00:45
262500 -- (-1164.431) (-1165.927) (-1165.919) [-1165.220] * (-1166.583) [-1163.718] (-1167.711) (-1168.017) -- 0:00:44
263000 -- (-1166.178) (-1167.239) (-1165.479) [-1164.874] * (-1166.566) (-1165.190) [-1164.231] (-1168.452) -- 0:00:44
263500 -- (-1166.904) (-1165.813) (-1168.462) [-1164.572] * [-1166.144] (-1165.557) (-1164.415) (-1169.269) -- 0:00:44
264000 -- (-1163.401) (-1165.929) [-1166.454] (-1165.835) * (-1166.501) (-1165.274) [-1164.562] (-1166.470) -- 0:00:44
264500 -- (-1165.066) [-1165.448] (-1165.182) (-1164.714) * [-1164.576] (-1169.275) (-1164.173) (-1167.310) -- 0:00:44
265000 -- (-1170.637) (-1167.536) [-1163.965] (-1164.057) * (-1164.723) (-1164.561) [-1163.232] (-1168.371) -- 0:00:44
Average standard deviation of split frequencies: 0.013624
265500 -- (-1164.306) (-1170.834) [-1164.627] (-1165.330) * (-1164.430) (-1163.309) (-1164.412) [-1167.332] -- 0:00:47
266000 -- (-1164.411) (-1163.909) (-1172.404) [-1163.985] * (-1166.077) [-1166.040] (-1164.316) (-1165.632) -- 0:00:46
266500 -- (-1166.612) [-1163.938] (-1163.821) (-1164.168) * (-1163.246) [-1167.767] (-1163.479) (-1165.248) -- 0:00:46
267000 -- (-1164.747) (-1168.099) (-1164.664) [-1164.454] * [-1163.248] (-1165.876) (-1166.799) (-1165.837) -- 0:00:46
267500 -- (-1166.383) (-1166.546) [-1165.084] (-1164.376) * [-1167.323] (-1163.875) (-1166.707) (-1164.011) -- 0:00:46
268000 -- (-1166.825) (-1168.028) (-1166.400) [-1165.985] * (-1166.254) [-1164.290] (-1166.205) (-1163.421) -- 0:00:46
268500 -- [-1166.327] (-1168.079) (-1165.285) (-1164.557) * (-1166.596) (-1164.134) (-1165.637) [-1165.952] -- 0:00:46
269000 -- (-1166.126) [-1166.245] (-1167.887) (-1166.170) * (-1165.266) (-1165.963) [-1164.702] (-1164.032) -- 0:00:46
269500 -- (-1165.513) (-1165.865) [-1165.419] (-1170.288) * (-1168.471) [-1165.887] (-1164.488) (-1164.501) -- 0:00:46
270000 -- (-1168.621) (-1163.974) [-1166.151] (-1165.297) * (-1166.704) (-1163.655) (-1164.336) [-1168.493] -- 0:00:45
Average standard deviation of split frequencies: 0.013715
270500 -- (-1165.485) [-1167.369] (-1165.696) (-1166.389) * [-1168.496] (-1163.655) (-1164.167) (-1166.637) -- 0:00:45
271000 -- (-1165.075) (-1166.042) [-1165.057] (-1164.605) * (-1167.063) [-1167.350] (-1168.678) (-1166.898) -- 0:00:45
271500 -- (-1164.793) (-1164.750) [-1166.567] (-1166.094) * (-1164.403) (-1169.855) [-1165.263] (-1166.669) -- 0:00:45
272000 -- [-1169.869] (-1164.404) (-1164.639) (-1166.186) * [-1165.128] (-1164.055) (-1164.481) (-1167.311) -- 0:00:45
272500 -- [-1164.101] (-1165.538) (-1166.361) (-1165.876) * [-1165.343] (-1163.540) (-1164.078) (-1166.709) -- 0:00:45
273000 -- (-1165.456) (-1163.940) [-1166.433] (-1165.428) * (-1168.047) (-1169.122) (-1164.620) [-1167.195] -- 0:00:45
273500 -- [-1165.379] (-1166.367) (-1164.800) (-1170.851) * (-1165.515) [-1164.729] (-1166.135) (-1166.920) -- 0:00:45
274000 -- (-1164.903) [-1164.221] (-1165.438) (-1170.367) * (-1164.023) [-1164.626] (-1166.994) (-1166.010) -- 0:00:45
274500 -- (-1169.756) (-1164.118) [-1164.692] (-1175.268) * [-1164.629] (-1167.286) (-1166.396) (-1171.396) -- 0:00:44
275000 -- (-1168.200) [-1163.693] (-1166.273) (-1170.593) * [-1165.398] (-1167.903) (-1166.764) (-1171.415) -- 0:00:44
Average standard deviation of split frequencies: 0.012596
275500 -- (-1164.644) (-1163.605) (-1166.571) [-1167.031] * [-1164.723] (-1166.756) (-1167.941) (-1165.122) -- 0:00:44
276000 -- (-1167.116) (-1164.903) (-1168.298) [-1165.094] * (-1164.507) [-1164.747] (-1166.125) (-1166.479) -- 0:00:44
276500 -- [-1163.849] (-1169.031) (-1164.521) (-1167.171) * [-1163.656] (-1164.475) (-1165.321) (-1164.498) -- 0:00:44
277000 -- (-1163.796) (-1170.256) [-1165.180] (-1167.618) * (-1164.819) [-1165.177] (-1166.266) (-1164.344) -- 0:00:44
277500 -- [-1164.772] (-1171.530) (-1165.373) (-1165.928) * (-1165.593) (-1166.718) (-1164.208) [-1164.925] -- 0:00:44
278000 -- (-1163.586) (-1167.778) [-1166.730] (-1165.868) * (-1166.283) [-1165.678] (-1163.858) (-1164.091) -- 0:00:44
278500 -- (-1163.496) (-1164.425) (-1168.629) [-1167.863] * [-1164.908] (-1165.353) (-1166.065) (-1166.426) -- 0:00:44
279000 -- (-1166.383) (-1168.851) (-1164.469) [-1165.751] * (-1164.933) (-1168.254) (-1165.328) [-1166.646] -- 0:00:43
279500 -- [-1164.927] (-1166.636) (-1164.405) (-1166.380) * [-1165.514] (-1165.450) (-1164.526) (-1169.940) -- 0:00:43
280000 -- [-1168.481] (-1164.917) (-1165.172) (-1166.098) * (-1165.735) (-1165.621) (-1164.221) [-1170.940] -- 0:00:43
Average standard deviation of split frequencies: 0.011658
280500 -- [-1164.130] (-1164.925) (-1167.550) (-1169.384) * [-1163.669] (-1165.262) (-1167.157) (-1172.429) -- 0:00:43
281000 -- (-1166.186) (-1164.758) (-1164.807) [-1167.000] * [-1164.257] (-1165.333) (-1168.267) (-1172.898) -- 0:00:43
281500 -- [-1164.884] (-1165.813) (-1163.830) (-1170.070) * (-1165.249) [-1163.891] (-1167.732) (-1166.066) -- 0:00:45
282000 -- (-1166.745) (-1167.194) [-1164.832] (-1168.655) * (-1164.862) [-1166.093] (-1168.017) (-1165.712) -- 0:00:45
282500 -- (-1169.390) [-1167.003] (-1166.385) (-1169.374) * (-1164.662) (-1165.508) [-1168.866] (-1170.612) -- 0:00:45
283000 -- (-1167.370) [-1165.388] (-1165.177) (-1166.293) * (-1167.667) (-1165.508) (-1167.212) [-1169.112] -- 0:00:45
283500 -- (-1165.086) (-1168.386) (-1164.853) [-1167.243] * [-1166.823] (-1165.196) (-1167.027) (-1166.554) -- 0:00:45
284000 -- (-1163.458) (-1164.184) (-1165.836) [-1168.467] * [-1164.586] (-1164.093) (-1171.182) (-1168.254) -- 0:00:45
284500 -- (-1166.270) (-1164.363) [-1164.710] (-1168.498) * (-1168.518) [-1164.962] (-1165.786) (-1166.550) -- 0:00:45
285000 -- (-1166.780) (-1166.621) (-1164.832) [-1164.677] * (-1165.748) (-1169.889) [-1171.491] (-1165.328) -- 0:00:45
Average standard deviation of split frequencies: 0.011446
285500 -- [-1165.193] (-1167.156) (-1169.991) (-1173.087) * [-1166.925] (-1165.860) (-1167.226) (-1165.044) -- 0:00:45
286000 -- (-1164.603) (-1165.982) (-1169.459) [-1166.663] * (-1167.068) (-1164.499) (-1176.908) [-1165.019] -- 0:00:44
286500 -- (-1165.945) [-1167.756] (-1169.421) (-1166.463) * [-1165.104] (-1167.192) (-1168.667) (-1163.617) -- 0:00:44
287000 -- (-1171.404) [-1164.465] (-1166.948) (-1165.424) * (-1177.256) [-1166.582] (-1165.618) (-1164.711) -- 0:00:44
287500 -- (-1164.761) (-1165.520) [-1164.771] (-1167.608) * [-1165.841] (-1170.121) (-1165.531) (-1164.969) -- 0:00:44
288000 -- [-1167.877] (-1164.789) (-1166.649) (-1163.742) * (-1168.310) (-1167.827) [-1165.343] (-1164.936) -- 0:00:44
288500 -- (-1172.048) (-1166.094) (-1163.998) [-1165.475] * (-1166.052) (-1163.796) [-1165.510] (-1166.115) -- 0:00:44
289000 -- [-1168.604] (-1164.132) (-1165.367) (-1166.075) * (-1166.311) [-1165.853] (-1167.056) (-1164.665) -- 0:00:44
289500 -- (-1167.794) (-1164.363) (-1166.075) [-1164.527] * (-1164.334) (-1168.616) [-1165.306] (-1164.555) -- 0:00:44
290000 -- (-1165.029) [-1164.469] (-1163.731) (-1165.294) * [-1164.271] (-1166.803) (-1167.014) (-1165.055) -- 0:00:44
Average standard deviation of split frequencies: 0.012974
290500 -- (-1167.121) [-1164.506] (-1164.467) (-1164.509) * (-1163.995) (-1166.329) [-1168.697] (-1164.989) -- 0:00:43
291000 -- [-1165.460] (-1165.643) (-1164.816) (-1166.617) * (-1167.239) (-1167.028) [-1166.135] (-1164.393) -- 0:00:43
291500 -- (-1164.048) (-1164.431) (-1167.859) [-1165.292] * (-1164.563) [-1165.846] (-1165.566) (-1167.247) -- 0:00:43
292000 -- (-1166.123) (-1164.870) [-1165.287] (-1165.746) * (-1169.854) (-1163.687) [-1167.217] (-1164.670) -- 0:00:43
292500 -- [-1166.989] (-1164.432) (-1164.356) (-1168.305) * (-1165.399) [-1164.077] (-1166.087) (-1165.217) -- 0:00:43
293000 -- [-1165.085] (-1168.056) (-1167.716) (-1165.128) * (-1165.012) [-1165.067] (-1167.789) (-1164.971) -- 0:00:43
293500 -- (-1167.461) [-1165.049] (-1163.828) (-1165.733) * (-1165.104) [-1165.689] (-1166.523) (-1165.446) -- 0:00:43
294000 -- (-1164.236) [-1167.118] (-1165.368) (-1165.518) * (-1165.297) (-1164.877) (-1167.074) [-1164.657] -- 0:00:43
294500 -- (-1164.723) [-1168.439] (-1164.650) (-1166.047) * [-1165.573] (-1166.847) (-1164.659) (-1163.854) -- 0:00:43
295000 -- (-1165.258) (-1166.663) [-1166.438] (-1166.455) * [-1164.223] (-1165.093) (-1164.033) (-1166.527) -- 0:00:43
Average standard deviation of split frequencies: 0.013437
295500 -- [-1165.611] (-1166.936) (-1170.358) (-1165.781) * (-1164.624) (-1165.367) [-1165.214] (-1165.201) -- 0:00:42
296000 -- (-1165.048) (-1172.801) (-1170.203) [-1167.278] * (-1166.939) (-1166.466) (-1168.471) [-1165.886] -- 0:00:42
296500 -- (-1165.470) (-1165.194) (-1168.777) [-1165.660] * (-1165.713) (-1167.143) [-1166.317] (-1164.950) -- 0:00:42
297000 -- (-1163.578) (-1167.142) (-1164.603) [-1163.651] * (-1165.238) (-1168.396) (-1165.141) [-1166.023] -- 0:00:42
297500 -- (-1169.364) (-1166.272) (-1166.714) [-1165.403] * (-1165.717) (-1165.328) (-1164.959) [-1165.404] -- 0:00:42
298000 -- (-1168.752) [-1167.514] (-1166.990) (-1165.046) * (-1167.585) (-1169.384) [-1163.743] (-1164.680) -- 0:00:44
298500 -- (-1165.921) (-1168.641) [-1167.197] (-1164.869) * (-1168.112) [-1167.741] (-1164.705) (-1166.774) -- 0:00:44
299000 -- [-1166.368] (-1170.521) (-1167.810) (-1166.748) * (-1170.772) [-1164.996] (-1163.930) (-1166.174) -- 0:00:44
299500 -- (-1165.386) [-1171.740] (-1168.023) (-1164.928) * (-1167.146) (-1165.175) (-1167.575) [-1166.386] -- 0:00:44
300000 -- [-1166.352] (-1165.690) (-1167.479) (-1165.834) * (-1167.498) [-1166.904] (-1165.417) (-1167.305) -- 0:00:44
Average standard deviation of split frequencies: 0.012249
300500 -- (-1164.352) [-1166.497] (-1166.603) (-1164.675) * (-1166.564) (-1165.179) [-1164.348] (-1165.234) -- 0:00:44
301000 -- (-1165.863) [-1168.748] (-1167.907) (-1165.405) * (-1166.825) (-1164.279) [-1164.730] (-1165.353) -- 0:00:44
301500 -- (-1165.947) (-1170.455) (-1166.048) [-1166.525] * (-1169.176) (-1165.677) [-1163.646] (-1163.921) -- 0:00:44
302000 -- (-1164.277) (-1165.821) (-1167.366) [-1164.156] * (-1165.300) (-1163.904) [-1164.051] (-1166.494) -- 0:00:43
302500 -- (-1164.170) [-1163.779] (-1169.811) (-1164.901) * (-1165.405) [-1165.787] (-1164.825) (-1166.101) -- 0:00:43
303000 -- (-1164.289) (-1164.065) (-1165.534) [-1170.012] * [-1166.648] (-1166.188) (-1169.411) (-1164.021) -- 0:00:43
303500 -- [-1163.825] (-1163.650) (-1163.402) (-1164.299) * (-1168.502) (-1166.901) (-1170.607) [-1163.785] -- 0:00:43
304000 -- [-1165.329] (-1166.182) (-1164.944) (-1165.291) * (-1171.826) (-1166.035) (-1169.717) [-1163.631] -- 0:00:43
304500 -- (-1166.224) (-1164.356) (-1165.578) [-1165.788] * (-1166.113) [-1165.501] (-1167.488) (-1165.028) -- 0:00:43
305000 -- (-1165.306) (-1164.427) (-1164.996) [-1163.919] * (-1164.485) [-1165.252] (-1167.383) (-1164.404) -- 0:00:43
Average standard deviation of split frequencies: 0.011237
305500 -- (-1166.277) (-1167.932) (-1165.289) [-1166.593] * (-1164.069) [-1166.664] (-1166.823) (-1166.700) -- 0:00:43
306000 -- (-1166.568) (-1167.940) [-1164.724] (-1164.022) * (-1168.751) [-1167.048] (-1164.797) (-1166.586) -- 0:00:43
306500 -- [-1163.902] (-1165.802) (-1166.548) (-1169.778) * [-1164.147] (-1170.480) (-1168.009) (-1164.668) -- 0:00:42
307000 -- (-1165.553) (-1166.162) [-1165.059] (-1164.976) * (-1169.340) (-1167.540) (-1167.348) [-1164.247] -- 0:00:42
307500 -- (-1165.151) (-1169.053) (-1165.654) [-1165.325] * (-1165.173) [-1166.571] (-1164.473) (-1164.660) -- 0:00:42
308000 -- (-1165.490) (-1169.098) (-1165.894) [-1164.140] * (-1164.593) (-1165.386) (-1165.864) [-1164.669] -- 0:00:42
308500 -- [-1167.453] (-1165.356) (-1168.434) (-1164.137) * (-1164.309) (-1167.635) (-1165.127) [-1165.124] -- 0:00:42
309000 -- (-1166.283) (-1171.934) (-1169.736) [-1164.546] * [-1166.829] (-1167.241) (-1163.798) (-1166.444) -- 0:00:42
309500 -- (-1164.946) (-1169.744) [-1166.987] (-1172.437) * (-1164.228) [-1167.035] (-1164.889) (-1164.035) -- 0:00:42
310000 -- (-1165.013) [-1166.146] (-1166.319) (-1169.139) * [-1164.176] (-1166.959) (-1166.010) (-1165.827) -- 0:00:42
Average standard deviation of split frequencies: 0.010890
310500 -- [-1164.758] (-1166.476) (-1164.432) (-1169.396) * (-1164.874) (-1170.797) (-1166.354) [-1165.826] -- 0:00:42
311000 -- (-1168.270) [-1165.550] (-1165.166) (-1166.049) * [-1167.261] (-1165.961) (-1166.767) (-1164.261) -- 0:00:42
311500 -- [-1164.434] (-1164.976) (-1164.401) (-1167.997) * (-1164.675) (-1163.760) [-1166.504] (-1166.321) -- 0:00:41
312000 -- (-1164.821) [-1165.008] (-1166.651) (-1165.076) * (-1169.317) (-1164.600) (-1164.981) [-1172.633] -- 0:00:41
312500 -- (-1166.929) (-1167.001) (-1166.119) [-1165.355] * (-1168.143) (-1165.206) (-1166.406) [-1166.002] -- 0:00:41
313000 -- [-1168.466] (-1164.474) (-1166.504) (-1164.704) * (-1164.950) (-1165.206) (-1166.350) [-1164.860] -- 0:00:41
313500 -- (-1167.208) [-1169.931] (-1164.155) (-1166.942) * (-1164.708) (-1165.656) (-1164.464) [-1165.200] -- 0:00:41
314000 -- (-1166.446) (-1170.054) [-1165.096] (-1164.730) * (-1164.669) [-1166.690] (-1171.048) (-1165.841) -- 0:00:43
314500 -- [-1164.799] (-1165.612) (-1163.435) (-1164.515) * (-1165.704) (-1165.182) (-1169.640) [-1164.138] -- 0:00:43
315000 -- (-1164.266) (-1165.281) [-1167.044] (-1164.923) * (-1166.958) (-1164.684) (-1168.271) [-1167.188] -- 0:00:43
Average standard deviation of split frequencies: 0.010179
315500 -- (-1164.915) [-1166.996] (-1166.610) (-1164.970) * (-1165.958) (-1164.775) [-1165.786] (-1165.898) -- 0:00:43
316000 -- [-1163.517] (-1165.766) (-1166.501) (-1165.852) * [-1165.236] (-1165.130) (-1164.689) (-1166.850) -- 0:00:43
316500 -- (-1163.692) (-1166.391) [-1164.597] (-1164.252) * (-1165.370) (-1174.747) (-1165.287) [-1164.059] -- 0:00:43
317000 -- [-1164.004] (-1163.733) (-1164.737) (-1167.883) * (-1165.082) (-1169.836) [-1165.148] (-1170.572) -- 0:00:43
317500 -- [-1165.852] (-1164.935) (-1166.148) (-1164.562) * (-1164.067) [-1166.767] (-1164.985) (-1169.563) -- 0:00:42
318000 -- (-1163.901) [-1164.262] (-1170.364) (-1165.087) * [-1164.774] (-1166.257) (-1165.922) (-1169.584) -- 0:00:42
318500 -- (-1163.885) (-1163.924) [-1164.767] (-1165.179) * (-1165.973) [-1165.671] (-1165.752) (-1166.343) -- 0:00:42
319000 -- (-1163.344) (-1164.193) [-1163.944] (-1167.808) * (-1170.695) (-1165.871) (-1165.872) [-1164.088] -- 0:00:42
319500 -- (-1163.448) [-1165.127] (-1166.531) (-1168.883) * (-1169.800) [-1166.097] (-1165.601) (-1168.959) -- 0:00:42
320000 -- (-1163.474) (-1167.303) [-1168.423] (-1166.922) * (-1166.919) [-1166.739] (-1165.480) (-1165.656) -- 0:00:42
Average standard deviation of split frequencies: 0.009945
320500 -- (-1163.347) [-1163.825] (-1166.776) (-1166.489) * (-1165.095) [-1169.126] (-1164.281) (-1165.088) -- 0:00:42
321000 -- [-1163.474] (-1164.598) (-1168.436) (-1165.772) * (-1170.222) (-1169.643) (-1163.883) [-1166.908] -- 0:00:42
321500 -- [-1164.648] (-1163.701) (-1167.335) (-1165.191) * (-1166.137) (-1164.664) [-1163.405] (-1168.960) -- 0:00:42
322000 -- (-1163.802) (-1164.478) [-1168.274] (-1164.965) * (-1165.633) (-1166.354) [-1163.283] (-1164.161) -- 0:00:42
322500 -- (-1165.832) (-1164.364) [-1165.317] (-1171.336) * (-1165.803) (-1170.264) (-1163.813) [-1165.005] -- 0:00:42
323000 -- (-1165.960) [-1163.937] (-1164.019) (-1164.762) * (-1166.361) (-1167.892) (-1163.880) [-1164.667] -- 0:00:41
323500 -- [-1164.236] (-1163.832) (-1166.318) (-1166.034) * [-1164.217] (-1169.070) (-1163.452) (-1166.156) -- 0:00:41
324000 -- [-1165.361] (-1166.037) (-1165.492) (-1166.122) * (-1166.001) (-1165.644) (-1163.877) [-1165.990] -- 0:00:41
324500 -- (-1167.320) (-1165.158) [-1166.101] (-1164.064) * (-1164.679) (-1166.659) (-1165.556) [-1165.303] -- 0:00:41
325000 -- (-1165.742) (-1170.257) (-1167.208) [-1165.623] * (-1165.488) [-1167.791] (-1166.811) (-1166.621) -- 0:00:41
Average standard deviation of split frequencies: 0.009867
325500 -- [-1163.754] (-1166.195) (-1167.460) (-1163.975) * (-1168.452) (-1165.978) (-1168.985) [-1164.577] -- 0:00:41
326000 -- [-1165.436] (-1166.867) (-1168.137) (-1165.200) * (-1167.938) (-1163.898) (-1168.789) [-1166.869] -- 0:00:41
326500 -- (-1169.925) (-1166.520) [-1165.453] (-1167.580) * (-1167.389) [-1164.564] (-1165.071) (-1166.701) -- 0:00:41
327000 -- (-1165.560) (-1163.850) (-1166.738) [-1166.724] * [-1167.441] (-1164.293) (-1168.621) (-1164.972) -- 0:00:41
327500 -- (-1164.156) [-1163.815] (-1166.562) (-1167.708) * (-1166.408) (-1165.386) (-1168.756) [-1164.089] -- 0:00:41
328000 -- (-1163.785) [-1164.136] (-1164.402) (-1165.923) * (-1165.613) (-1164.061) (-1171.881) [-1164.372] -- 0:00:40
328500 -- (-1165.818) (-1164.136) [-1164.799] (-1169.933) * [-1165.905] (-1164.668) (-1167.434) (-1165.311) -- 0:00:40
329000 -- (-1164.806) (-1163.920) [-1166.294] (-1165.531) * (-1166.564) (-1164.484) (-1165.123) [-1167.293] -- 0:00:40
329500 -- [-1166.382] (-1164.298) (-1166.349) (-1166.272) * (-1166.785) [-1164.131] (-1165.252) (-1165.474) -- 0:00:40
330000 -- (-1167.169) [-1164.634] (-1168.789) (-1166.084) * (-1170.335) (-1163.378) (-1165.627) [-1164.556] -- 0:00:40
Average standard deviation of split frequencies: 0.009728
330500 -- (-1165.391) (-1164.270) [-1167.621] (-1165.453) * (-1164.875) [-1163.570] (-1163.904) (-1166.973) -- 0:00:42
331000 -- (-1163.859) (-1164.333) (-1168.302) [-1166.210] * (-1168.008) (-1163.926) [-1165.418] (-1167.103) -- 0:00:42
331500 -- (-1163.521) [-1166.191] (-1165.363) (-1170.717) * (-1167.205) (-1163.892) [-1165.577] (-1164.926) -- 0:00:42
332000 -- (-1163.852) (-1164.967) [-1163.947] (-1168.071) * [-1165.722] (-1163.882) (-1165.629) (-1171.438) -- 0:00:42
332500 -- (-1165.556) (-1165.787) [-1164.824] (-1168.862) * (-1163.997) [-1163.575] (-1165.167) (-1165.272) -- 0:00:42
333000 -- (-1164.284) [-1164.214] (-1166.944) (-1165.979) * (-1163.670) (-1164.838) [-1165.018] (-1168.603) -- 0:00:42
333500 -- (-1166.615) [-1167.738] (-1164.999) (-1168.013) * (-1164.521) (-1168.218) [-1167.269] (-1165.114) -- 0:00:41
334000 -- (-1169.983) (-1168.453) (-1164.065) [-1164.442] * (-1165.779) (-1167.223) (-1166.764) [-1165.586] -- 0:00:41
334500 -- [-1166.719] (-1166.150) (-1168.702) (-1165.959) * (-1165.563) (-1166.154) (-1168.292) [-1164.951] -- 0:00:41
335000 -- (-1166.060) [-1164.397] (-1164.678) (-1164.305) * (-1171.776) (-1164.042) (-1167.880) [-1164.023] -- 0:00:41
Average standard deviation of split frequencies: 0.009573
335500 -- (-1165.311) (-1165.698) (-1165.644) [-1171.101] * [-1168.899] (-1165.047) (-1171.758) (-1164.341) -- 0:00:41
336000 -- (-1165.023) [-1165.079] (-1168.960) (-1167.007) * (-1165.449) (-1165.619) (-1168.385) [-1165.466] -- 0:00:41
336500 -- (-1165.680) [-1167.445] (-1164.688) (-1166.334) * (-1164.361) [-1167.504] (-1164.782) (-1164.107) -- 0:00:41
337000 -- (-1165.838) (-1169.671) (-1168.037) [-1164.508] * (-1165.122) (-1164.389) [-1166.356] (-1169.251) -- 0:00:41
337500 -- [-1167.677] (-1168.171) (-1166.208) (-1164.431) * [-1170.330] (-1164.448) (-1166.954) (-1165.030) -- 0:00:41
338000 -- (-1170.892) (-1172.236) (-1168.537) [-1163.973] * (-1167.724) [-1166.756] (-1170.226) (-1167.033) -- 0:00:41
338500 -- (-1166.845) (-1166.221) (-1169.128) [-1164.319] * [-1165.545] (-1167.094) (-1166.690) (-1164.746) -- 0:00:41
339000 -- (-1163.812) (-1165.819) [-1163.544] (-1165.253) * (-1168.157) (-1166.124) (-1166.261) [-1165.748] -- 0:00:40
339500 -- [-1163.819] (-1164.042) (-1163.903) (-1167.027) * (-1168.635) (-1166.501) (-1164.218) [-1165.163] -- 0:00:40
340000 -- (-1164.312) (-1166.706) (-1165.766) [-1164.408] * (-1165.328) [-1165.320] (-1166.447) (-1166.173) -- 0:00:40
Average standard deviation of split frequencies: 0.009225
340500 -- (-1164.328) (-1164.532) [-1165.384] (-1171.301) * (-1164.243) (-1167.479) (-1166.226) [-1165.775] -- 0:00:40
341000 -- (-1163.467) (-1164.041) [-1164.031] (-1170.990) * [-1163.995] (-1163.939) (-1169.379) (-1164.423) -- 0:00:40
341500 -- (-1166.277) (-1163.853) (-1164.144) [-1169.813] * (-1167.110) (-1167.260) (-1169.787) [-1163.939] -- 0:00:40
342000 -- (-1165.262) (-1164.022) [-1164.080] (-1166.495) * [-1166.065] (-1164.923) (-1168.261) (-1164.561) -- 0:00:40
342500 -- (-1165.840) (-1164.106) [-1164.609] (-1165.194) * (-1165.313) (-1164.473) (-1168.719) [-1163.921] -- 0:00:40
343000 -- (-1164.544) (-1164.046) (-1164.627) [-1164.158] * (-1164.230) [-1165.721] (-1172.630) (-1167.104) -- 0:00:40
343500 -- (-1164.143) (-1163.773) [-1167.008] (-1165.470) * (-1168.399) (-1166.224) [-1167.626] (-1165.855) -- 0:00:40
344000 -- (-1164.791) (-1164.403) (-1165.414) [-1164.355] * (-1165.623) (-1166.392) (-1168.443) [-1165.981] -- 0:00:40
344500 -- (-1164.662) (-1171.067) (-1166.715) [-1167.703] * (-1164.924) (-1166.508) [-1166.655] (-1166.300) -- 0:00:39
345000 -- (-1164.746) [-1165.704] (-1165.036) (-1165.904) * [-1166.881] (-1164.716) (-1165.881) (-1163.802) -- 0:00:39
Average standard deviation of split frequencies: 0.010098
345500 -- (-1165.729) (-1165.567) [-1166.146] (-1164.965) * (-1175.489) (-1165.865) (-1168.429) [-1164.747] -- 0:00:39
346000 -- (-1166.995) (-1166.399) [-1168.305] (-1163.884) * (-1168.551) (-1165.485) [-1167.569] (-1165.546) -- 0:00:39
346500 -- [-1165.579] (-1165.359) (-1168.793) (-1164.426) * (-1165.020) (-1166.175) [-1165.634] (-1168.934) -- 0:00:41
347000 -- (-1165.154) (-1165.990) [-1167.751] (-1164.167) * (-1165.533) [-1166.783] (-1166.117) (-1166.987) -- 0:00:41
347500 -- (-1165.135) (-1164.511) (-1170.609) [-1163.929] * (-1166.637) (-1164.385) [-1165.292] (-1166.020) -- 0:00:41
348000 -- (-1166.736) [-1166.089] (-1167.307) (-1165.430) * [-1164.487] (-1164.065) (-1164.227) (-1166.764) -- 0:00:41
348500 -- (-1166.143) (-1167.034) (-1163.892) [-1166.997] * (-1168.177) (-1165.178) [-1165.570] (-1164.882) -- 0:00:41
349000 -- [-1163.927] (-1165.760) (-1166.888) (-1164.771) * (-1172.878) (-1166.940) [-1168.436] (-1164.448) -- 0:00:41
349500 -- (-1166.106) (-1164.672) (-1165.442) [-1164.125] * (-1169.276) (-1169.230) (-1168.712) [-1164.220] -- 0:00:40
350000 -- (-1164.173) (-1169.084) [-1167.146] (-1164.337) * [-1168.697] (-1171.137) (-1164.339) (-1163.976) -- 0:00:40
Average standard deviation of split frequencies: 0.010596
350500 -- (-1164.039) [-1167.028] (-1165.415) (-1164.680) * (-1165.128) (-1164.877) (-1164.356) [-1164.073] -- 0:00:40
351000 -- (-1165.281) (-1163.801) [-1164.852] (-1164.745) * (-1166.346) (-1166.699) [-1167.442] (-1165.001) -- 0:00:40
351500 -- (-1167.407) (-1164.138) (-1170.214) [-1164.877] * [-1165.211] (-1166.766) (-1167.037) (-1167.845) -- 0:00:40
352000 -- (-1166.941) [-1166.707] (-1165.771) (-1164.834) * [-1167.053] (-1167.811) (-1166.906) (-1165.200) -- 0:00:40
352500 -- (-1167.302) (-1164.177) [-1165.791] (-1163.543) * (-1165.534) (-1164.183) [-1167.053] (-1165.539) -- 0:00:40
353000 -- [-1165.582] (-1170.179) (-1165.407) (-1165.900) * (-1164.922) (-1165.800) [-1165.797] (-1165.866) -- 0:00:40
353500 -- (-1164.998) (-1165.769) [-1164.347] (-1164.421) * (-1165.824) (-1165.800) (-1176.387) [-1165.297] -- 0:00:40
354000 -- (-1165.735) (-1164.590) (-1168.417) [-1165.817] * (-1164.820) (-1171.142) (-1174.320) [-1164.494] -- 0:00:40
354500 -- (-1164.184) (-1164.351) [-1165.443] (-1165.638) * (-1164.868) (-1166.846) [-1164.930] (-1170.488) -- 0:00:40
355000 -- (-1164.754) (-1165.258) (-1165.434) [-1164.651] * (-1165.614) [-1164.588] (-1163.959) (-1172.677) -- 0:00:39
Average standard deviation of split frequencies: 0.010676
355500 -- (-1164.360) [-1164.113] (-1163.771) (-1165.864) * (-1167.520) (-1167.353) (-1163.381) [-1166.009] -- 0:00:39
356000 -- [-1165.757] (-1166.546) (-1165.516) (-1168.856) * (-1166.891) (-1165.890) (-1163.824) [-1166.939] -- 0:00:39
356500 -- [-1164.775] (-1164.786) (-1165.519) (-1163.724) * (-1167.299) [-1168.476] (-1165.361) (-1164.600) -- 0:00:39
357000 -- (-1164.272) (-1164.955) (-1166.382) [-1167.328] * (-1165.967) (-1163.642) (-1167.891) [-1164.220] -- 0:00:39
357500 -- (-1170.230) (-1166.279) [-1164.181] (-1167.135) * (-1168.022) [-1164.168] (-1170.692) (-1165.413) -- 0:00:39
358000 -- [-1168.503] (-1165.863) (-1165.230) (-1165.754) * [-1165.318] (-1164.283) (-1168.625) (-1165.409) -- 0:00:39
358500 -- (-1168.291) (-1164.517) (-1163.857) [-1167.141] * (-1168.679) (-1166.112) (-1167.117) [-1165.121] -- 0:00:39
359000 -- (-1173.104) (-1164.644) (-1164.917) [-1163.860] * (-1165.350) (-1168.609) (-1167.807) [-1164.705] -- 0:00:39
359500 -- (-1166.419) (-1164.924) [-1163.438] (-1165.420) * [-1166.197] (-1172.282) (-1168.260) (-1164.447) -- 0:00:39
360000 -- (-1164.809) (-1164.655) (-1167.594) [-1166.117] * [-1164.071] (-1166.488) (-1166.976) (-1163.787) -- 0:00:39
Average standard deviation of split frequencies: 0.009933
360500 -- (-1163.861) (-1164.697) (-1169.774) [-1166.506] * [-1163.976] (-1165.513) (-1164.150) (-1163.988) -- 0:00:39
361000 -- (-1165.308) (-1169.028) [-1166.357] (-1165.660) * (-1164.068) (-1165.728) (-1164.476) [-1166.112] -- 0:00:38
361500 -- [-1166.121] (-1168.392) (-1167.796) (-1164.672) * [-1165.363] (-1170.667) (-1165.053) (-1165.924) -- 0:00:38
362000 -- (-1165.598) (-1164.521) (-1164.400) [-1165.428] * (-1168.655) [-1165.455] (-1165.787) (-1165.755) -- 0:00:38
362500 -- (-1166.580) (-1167.690) [-1164.574] (-1163.871) * [-1168.317] (-1166.366) (-1165.114) (-1165.696) -- 0:00:40
363000 -- [-1167.853] (-1167.290) (-1169.435) (-1163.919) * (-1165.665) [-1165.975] (-1166.432) (-1166.221) -- 0:00:40
363500 -- (-1165.781) (-1164.704) [-1166.131] (-1163.818) * [-1164.299] (-1165.667) (-1164.522) (-1167.033) -- 0:00:40
364000 -- [-1166.059] (-1164.663) (-1167.548) (-1164.726) * [-1166.298] (-1165.992) (-1166.024) (-1164.356) -- 0:00:40
364500 -- [-1165.405] (-1164.745) (-1165.851) (-1164.979) * (-1166.476) (-1167.420) (-1166.339) [-1164.106] -- 0:00:40
365000 -- [-1165.232] (-1164.475) (-1163.942) (-1165.103) * [-1165.888] (-1166.398) (-1165.053) (-1163.834) -- 0:00:40
Average standard deviation of split frequencies: 0.010834
365500 -- (-1165.234) (-1165.567) (-1164.030) [-1167.355] * (-1167.667) (-1167.921) (-1164.548) [-1165.099] -- 0:00:39
366000 -- [-1163.554] (-1167.554) (-1163.852) (-1174.741) * (-1165.622) (-1166.289) [-1166.779] (-1167.647) -- 0:00:39
366500 -- (-1164.073) (-1168.024) [-1164.055] (-1165.724) * (-1166.850) (-1166.631) (-1167.919) [-1166.534] -- 0:00:39
367000 -- (-1164.984) [-1164.757] (-1164.129) (-1165.713) * (-1166.160) (-1167.461) [-1165.737] (-1163.630) -- 0:00:39
367500 -- (-1165.946) (-1164.671) (-1164.040) [-1164.112] * (-1163.898) (-1165.049) (-1165.796) [-1165.750] -- 0:00:39
368000 -- (-1165.203) (-1164.339) [-1164.633] (-1165.111) * [-1165.131] (-1167.106) (-1165.632) (-1166.355) -- 0:00:39
368500 -- (-1171.953) [-1164.989] (-1166.772) (-1166.923) * (-1164.238) (-1164.187) [-1166.525] (-1165.470) -- 0:00:39
369000 -- (-1167.886) (-1164.666) (-1164.745) [-1166.976] * (-1165.780) (-1165.124) [-1164.248] (-1166.720) -- 0:00:39
369500 -- (-1170.188) [-1166.440] (-1166.748) (-1166.301) * (-1164.917) [-1165.054] (-1164.320) (-1165.494) -- 0:00:39
370000 -- (-1169.093) (-1166.590) (-1165.989) [-1164.525] * (-1164.652) (-1168.827) [-1164.670] (-1168.714) -- 0:00:39
Average standard deviation of split frequencies: 0.010324
370500 -- [-1167.247] (-1169.462) (-1167.792) (-1164.607) * [-1166.953] (-1168.803) (-1167.456) (-1164.872) -- 0:00:39
371000 -- [-1165.657] (-1168.923) (-1163.748) (-1164.373) * (-1167.124) (-1165.840) [-1165.596] (-1166.707) -- 0:00:38
371500 -- (-1165.618) (-1164.336) (-1163.786) [-1164.392] * (-1166.862) (-1165.135) [-1164.641] (-1166.595) -- 0:00:38
372000 -- (-1165.332) (-1164.538) [-1163.374] (-1166.332) * [-1165.271] (-1166.126) (-1166.034) (-1166.366) -- 0:00:38
372500 -- (-1165.035) (-1166.495) [-1164.177] (-1169.298) * (-1165.404) [-1168.313] (-1166.154) (-1165.735) -- 0:00:38
373000 -- (-1167.915) [-1163.827] (-1163.487) (-1164.862) * (-1165.357) (-1166.235) [-1165.889] (-1167.360) -- 0:00:38
373500 -- (-1167.036) [-1164.444] (-1165.770) (-1169.663) * [-1169.662] (-1166.424) (-1164.855) (-1167.300) -- 0:00:38
374000 -- (-1169.095) [-1163.909] (-1165.389) (-1167.112) * [-1164.531] (-1166.342) (-1166.227) (-1164.791) -- 0:00:38
374500 -- (-1165.569) (-1164.312) (-1163.891) [-1164.494] * (-1166.502) (-1165.195) (-1166.766) [-1170.524] -- 0:00:38
375000 -- (-1168.094) (-1165.814) [-1167.816] (-1163.309) * (-1166.481) (-1166.008) [-1164.408] (-1170.400) -- 0:00:38
Average standard deviation of split frequencies: 0.010325
375500 -- (-1164.989) (-1164.217) [-1164.088] (-1164.828) * (-1167.039) (-1165.273) [-1164.926] (-1167.478) -- 0:00:38
376000 -- (-1164.886) (-1165.145) (-1165.516) [-1164.856] * [-1170.277] (-1164.616) (-1163.576) (-1165.553) -- 0:00:38
376500 -- (-1163.876) (-1164.430) (-1164.932) [-1164.411] * (-1164.807) (-1165.157) [-1163.573] (-1168.546) -- 0:00:38
377000 -- (-1164.447) [-1165.519] (-1163.856) (-1163.839) * (-1165.805) (-1164.418) (-1163.576) [-1164.097] -- 0:00:38
377500 -- [-1163.652] (-1165.415) (-1164.400) (-1166.099) * [-1163.987] (-1164.891) (-1168.802) (-1164.269) -- 0:00:37
378000 -- [-1164.679] (-1166.926) (-1168.906) (-1165.661) * (-1164.057) (-1164.612) (-1170.972) [-1163.840] -- 0:00:37
378500 -- (-1164.720) (-1167.292) [-1165.942] (-1167.792) * [-1163.719] (-1166.020) (-1164.893) (-1165.325) -- 0:00:37
379000 -- (-1165.534) (-1163.986) (-1172.049) [-1164.113] * (-1164.721) (-1164.974) [-1167.738] (-1165.089) -- 0:00:39
379500 -- (-1165.483) (-1165.603) [-1166.824] (-1166.473) * (-1164.289) (-1164.573) [-1164.448] (-1170.511) -- 0:00:39
380000 -- (-1167.323) (-1168.702) (-1170.376) [-1164.320] * [-1166.161] (-1167.696) (-1164.423) (-1166.899) -- 0:00:39
Average standard deviation of split frequencies: 0.010198
380500 -- (-1164.696) (-1168.383) (-1167.387) [-1166.700] * (-1165.258) [-1166.469] (-1165.862) (-1168.775) -- 0:00:39
381000 -- (-1163.793) (-1165.321) (-1166.089) [-1165.338] * (-1164.180) (-1163.714) (-1169.408) [-1171.473] -- 0:00:38
381500 -- [-1163.811] (-1165.757) (-1165.649) (-1164.312) * (-1164.133) (-1163.491) (-1165.889) [-1164.679] -- 0:00:38
382000 -- [-1165.052] (-1169.813) (-1165.027) (-1163.753) * (-1165.295) (-1165.577) (-1164.283) [-1164.046] -- 0:00:38
382500 -- [-1164.721] (-1167.408) (-1163.681) (-1166.113) * (-1164.836) [-1163.843] (-1163.669) (-1165.898) -- 0:00:38
383000 -- (-1165.608) [-1165.485] (-1167.227) (-1167.430) * [-1165.947] (-1163.809) (-1165.909) (-1164.040) -- 0:00:38
383500 -- (-1165.451) (-1165.421) (-1168.939) [-1166.911] * (-1166.973) (-1167.348) [-1164.999] (-1164.291) -- 0:00:38
384000 -- (-1165.347) [-1163.762] (-1167.807) (-1165.171) * [-1164.745] (-1165.445) (-1163.946) (-1165.034) -- 0:00:38
384500 -- (-1166.203) (-1163.966) [-1166.548] (-1166.957) * (-1164.042) (-1166.298) [-1164.504] (-1163.953) -- 0:00:38
385000 -- (-1164.755) (-1165.207) [-1166.555] (-1167.809) * (-1165.971) (-1166.148) (-1166.859) [-1164.583] -- 0:00:38
Average standard deviation of split frequencies: 0.010848
385500 -- (-1164.120) [-1167.738] (-1166.317) (-1167.939) * (-1164.993) (-1167.649) [-1166.783] (-1163.762) -- 0:00:38
386000 -- (-1165.377) [-1166.388] (-1164.503) (-1165.533) * [-1165.687] (-1165.900) (-1164.947) (-1166.453) -- 0:00:38
386500 -- (-1165.870) (-1166.573) [-1166.044] (-1166.360) * (-1164.949) (-1164.800) [-1164.561] (-1164.878) -- 0:00:38
387000 -- (-1165.971) (-1166.181) [-1166.115] (-1168.309) * (-1165.349) (-1165.957) [-1165.692] (-1164.289) -- 0:00:38
387500 -- (-1165.241) (-1165.668) [-1164.731] (-1167.561) * (-1163.835) (-1165.022) (-1164.831) [-1167.945] -- 0:00:37
388000 -- (-1165.932) (-1164.367) (-1165.975) [-1167.167] * (-1167.198) [-1163.597] (-1166.217) (-1165.015) -- 0:00:37
388500 -- (-1164.504) (-1163.497) (-1165.409) [-1163.494] * (-1165.138) (-1166.776) (-1164.848) [-1164.939] -- 0:00:37
389000 -- [-1165.575] (-1163.279) (-1164.961) (-1164.533) * (-1165.067) (-1174.485) [-1164.825] (-1166.614) -- 0:00:37
389500 -- [-1164.663] (-1164.399) (-1165.883) (-1164.467) * [-1168.358] (-1167.522) (-1164.256) (-1166.394) -- 0:00:37
390000 -- (-1166.051) [-1163.328] (-1165.567) (-1166.277) * (-1165.188) [-1166.249] (-1164.397) (-1168.879) -- 0:00:37
Average standard deviation of split frequencies: 0.010505
390500 -- (-1167.966) (-1163.906) [-1167.226] (-1166.227) * (-1164.977) [-1166.604] (-1164.927) (-1167.837) -- 0:00:37
391000 -- (-1164.245) (-1163.887) [-1164.934] (-1167.166) * [-1165.634] (-1164.902) (-1164.604) (-1164.970) -- 0:00:37
391500 -- (-1166.223) (-1163.430) (-1163.897) [-1165.627] * (-1165.074) (-1164.901) (-1164.373) [-1165.347] -- 0:00:37
392000 -- (-1167.162) (-1164.121) [-1164.634] (-1168.418) * (-1165.155) [-1164.806] (-1167.281) (-1164.070) -- 0:00:37
392500 -- (-1168.276) (-1165.746) (-1163.797) [-1163.657] * (-1166.503) (-1166.336) (-1169.321) [-1164.119] -- 0:00:37
393000 -- (-1164.557) (-1167.756) [-1166.556] (-1169.737) * (-1169.598) (-1166.544) (-1164.568) [-1164.418] -- 0:00:37
393500 -- (-1164.514) (-1167.621) [-1167.380] (-1168.900) * [-1164.222] (-1164.460) (-1167.556) (-1166.210) -- 0:00:36
394000 -- (-1164.797) (-1168.342) (-1164.132) [-1166.709] * [-1168.816] (-1165.486) (-1164.935) (-1166.711) -- 0:00:36
394500 -- (-1164.304) [-1165.780] (-1164.678) (-1165.276) * (-1169.521) [-1167.641] (-1163.669) (-1167.172) -- 0:00:36
395000 -- (-1165.025) [-1169.987] (-1164.548) (-1165.113) * (-1167.473) (-1171.269) (-1164.761) [-1165.836] -- 0:00:36
Average standard deviation of split frequencies: 0.011274
395500 -- (-1164.412) (-1167.954) [-1166.351] (-1167.462) * (-1164.125) (-1168.476) (-1165.003) [-1168.861] -- 0:00:38
396000 -- (-1165.408) (-1164.110) (-1165.061) [-1167.618] * (-1167.028) (-1164.079) [-1168.315] (-1168.742) -- 0:00:38
396500 -- [-1164.839] (-1165.885) (-1165.688) (-1168.253) * [-1163.904] (-1164.213) (-1164.791) (-1166.684) -- 0:00:38
397000 -- (-1164.081) (-1166.880) [-1164.764] (-1165.177) * (-1164.060) (-1166.359) (-1167.215) [-1166.514] -- 0:00:37
397500 -- [-1163.898] (-1166.010) (-1165.565) (-1165.073) * (-1166.482) (-1167.924) [-1167.286] (-1169.341) -- 0:00:37
398000 -- (-1166.154) (-1167.422) [-1165.654] (-1165.946) * (-1171.105) [-1164.370] (-1168.741) (-1164.040) -- 0:00:37
398500 -- (-1166.386) [-1164.147] (-1165.641) (-1165.368) * [-1168.604] (-1166.420) (-1166.505) (-1164.028) -- 0:00:37
399000 -- (-1171.828) (-1164.783) (-1164.624) [-1165.719] * (-1169.448) (-1164.159) [-1167.162] (-1166.883) -- 0:00:37
399500 -- (-1165.764) [-1164.669] (-1167.321) (-1164.151) * (-1170.320) (-1164.159) [-1166.465] (-1165.126) -- 0:00:37
400000 -- (-1166.059) (-1164.904) [-1165.553] (-1175.170) * (-1168.749) (-1164.560) [-1166.991] (-1164.556) -- 0:00:37
Average standard deviation of split frequencies: 0.011073
400500 -- [-1164.306] (-1164.904) (-1164.284) (-1170.231) * (-1165.102) (-1166.218) (-1165.186) [-1168.172] -- 0:00:37
401000 -- (-1164.341) (-1169.800) [-1166.129] (-1166.207) * [-1164.776] (-1165.689) (-1167.965) (-1165.231) -- 0:00:37
401500 -- (-1165.746) (-1167.277) (-1166.639) [-1163.974] * (-1166.365) (-1166.446) (-1165.137) [-1165.391] -- 0:00:37
402000 -- (-1167.872) [-1167.686] (-1164.876) (-1165.221) * (-1168.079) (-1165.798) [-1164.243] (-1165.324) -- 0:00:37
402500 -- (-1165.731) (-1165.464) (-1163.733) [-1168.168] * (-1168.622) (-1165.330) [-1165.467] (-1164.330) -- 0:00:37
403000 -- [-1163.940] (-1166.757) (-1168.575) (-1172.817) * (-1165.892) (-1165.787) [-1164.310] (-1167.539) -- 0:00:37
403500 -- [-1164.728] (-1169.332) (-1165.790) (-1165.820) * (-1166.746) [-1167.639] (-1165.713) (-1163.862) -- 0:00:36
404000 -- [-1166.075] (-1167.412) (-1166.144) (-1165.477) * (-1166.590) (-1167.498) [-1165.251] (-1164.475) -- 0:00:36
404500 -- [-1164.799] (-1165.256) (-1167.004) (-1171.007) * (-1167.193) (-1168.137) (-1168.814) [-1164.457] -- 0:00:36
405000 -- (-1166.275) (-1167.432) (-1171.563) [-1169.233] * (-1168.428) (-1165.797) (-1170.981) [-1164.373] -- 0:00:36
Average standard deviation of split frequencies: 0.011201
405500 -- (-1165.073) (-1164.650) (-1166.594) [-1165.273] * (-1164.892) (-1168.857) (-1165.446) [-1164.368] -- 0:00:36
406000 -- [-1165.601] (-1165.978) (-1166.027) (-1164.593) * (-1165.465) (-1165.001) [-1164.410] (-1164.905) -- 0:00:36
406500 -- [-1166.754] (-1167.220) (-1166.868) (-1165.667) * (-1165.145) (-1166.105) [-1164.043] (-1164.167) -- 0:00:36
407000 -- (-1166.446) (-1166.692) (-1171.233) [-1164.146] * (-1171.184) [-1166.964] (-1165.664) (-1174.046) -- 0:00:36
407500 -- (-1165.898) [-1166.795] (-1165.020) (-1163.820) * (-1168.226) (-1165.192) (-1164.417) [-1167.131] -- 0:00:36
408000 -- (-1173.669) (-1169.903) [-1165.155] (-1171.270) * (-1166.027) [-1167.503] (-1167.104) (-1167.199) -- 0:00:36
408500 -- (-1167.469) [-1166.377] (-1166.358) (-1164.731) * (-1165.547) [-1164.726] (-1169.568) (-1164.643) -- 0:00:36
409000 -- (-1165.235) (-1166.173) [-1164.662] (-1164.216) * [-1164.669] (-1168.735) (-1165.541) (-1167.946) -- 0:00:36
409500 -- (-1164.369) (-1165.050) [-1167.841] (-1164.220) * (-1169.371) [-1164.889] (-1165.473) (-1167.406) -- 0:00:36
410000 -- (-1164.758) (-1163.720) [-1166.329] (-1164.309) * (-1168.043) (-1167.407) (-1164.468) [-1164.418] -- 0:00:35
Average standard deviation of split frequencies: 0.011614
410500 -- (-1163.899) (-1163.695) [-1167.755] (-1171.411) * [-1166.912] (-1165.637) (-1165.961) (-1164.931) -- 0:00:35
411000 -- [-1164.881] (-1163.742) (-1165.426) (-1171.359) * (-1166.226) (-1165.554) (-1168.325) [-1167.914] -- 0:00:35
411500 -- (-1167.268) (-1163.825) (-1164.467) [-1165.158] * (-1163.697) (-1163.964) [-1165.695] (-1163.737) -- 0:00:37
412000 -- (-1163.300) [-1164.212] (-1166.480) (-1165.032) * (-1164.249) (-1166.262) [-1163.833] (-1164.298) -- 0:00:37
412500 -- (-1165.545) (-1168.801) [-1164.577] (-1167.159) * (-1169.635) (-1167.462) [-1164.807] (-1164.298) -- 0:00:37
413000 -- (-1166.455) (-1167.367) [-1166.365] (-1166.675) * [-1163.754] (-1166.933) (-1167.734) (-1169.367) -- 0:00:36
413500 -- (-1171.867) [-1164.597] (-1164.149) (-1166.188) * (-1166.632) (-1166.561) [-1166.718] (-1168.295) -- 0:00:36
414000 -- (-1165.453) [-1166.703] (-1165.676) (-1165.525) * (-1166.727) (-1166.996) [-1165.512] (-1166.852) -- 0:00:36
414500 -- (-1166.829) (-1165.310) [-1164.992] (-1163.812) * (-1166.878) [-1166.441] (-1164.081) (-1167.620) -- 0:00:36
415000 -- (-1164.410) (-1166.099) [-1168.864] (-1163.757) * (-1166.598) (-1169.170) (-1165.796) [-1166.075] -- 0:00:36
Average standard deviation of split frequencies: 0.012132
415500 -- [-1165.913] (-1165.424) (-1167.590) (-1169.712) * (-1165.825) (-1166.951) (-1165.872) [-1163.821] -- 0:00:36
416000 -- (-1163.966) (-1163.875) (-1164.241) [-1163.772] * (-1166.822) [-1163.905] (-1165.547) (-1163.977) -- 0:00:36
416500 -- [-1167.218] (-1164.795) (-1165.725) (-1165.328) * [-1166.336] (-1166.371) (-1169.535) (-1170.039) -- 0:00:36
417000 -- (-1164.283) (-1168.287) (-1170.991) [-1167.916] * [-1165.161] (-1164.948) (-1164.740) (-1163.600) -- 0:00:36
417500 -- [-1164.958] (-1165.094) (-1166.544) (-1166.575) * (-1166.125) (-1165.751) (-1165.594) [-1166.507] -- 0:00:36
418000 -- [-1165.030] (-1165.092) (-1165.065) (-1163.576) * [-1166.476] (-1168.723) (-1164.824) (-1166.295) -- 0:00:36
418500 -- (-1168.264) [-1164.594] (-1163.940) (-1164.408) * (-1169.318) [-1164.376] (-1167.159) (-1165.409) -- 0:00:36
419000 -- (-1171.073) (-1164.259) [-1166.302] (-1164.789) * (-1167.259) (-1163.906) (-1169.409) [-1163.934] -- 0:00:36
419500 -- (-1164.472) (-1166.292) [-1164.449] (-1163.763) * (-1164.935) [-1166.702] (-1164.008) (-1167.108) -- 0:00:35
420000 -- (-1166.333) [-1168.129] (-1164.412) (-1163.664) * (-1163.626) (-1166.183) (-1164.002) [-1163.932] -- 0:00:35
Average standard deviation of split frequencies: 0.012393
420500 -- (-1165.040) (-1165.993) [-1164.647] (-1167.103) * (-1164.388) [-1163.579] (-1165.998) (-1164.910) -- 0:00:35
421000 -- (-1165.040) [-1166.242] (-1165.338) (-1164.817) * [-1164.629] (-1165.873) (-1166.052) (-1165.034) -- 0:00:35
421500 -- [-1165.347] (-1163.332) (-1166.931) (-1164.743) * (-1167.459) [-1165.403] (-1164.617) (-1166.287) -- 0:00:35
422000 -- (-1165.115) (-1164.472) (-1164.498) [-1165.281] * (-1168.735) (-1164.468) (-1164.916) [-1168.870] -- 0:00:35
422500 -- (-1164.280) (-1165.737) [-1163.654] (-1163.929) * (-1165.744) (-1167.871) (-1167.279) [-1165.065] -- 0:00:35
423000 -- (-1165.018) (-1165.615) (-1164.208) [-1163.991] * (-1164.363) (-1168.868) [-1166.235] (-1170.242) -- 0:00:35
423500 -- [-1163.485] (-1167.650) (-1163.956) (-1164.238) * (-1168.934) [-1166.459] (-1164.206) (-1165.907) -- 0:00:35
424000 -- (-1163.298) (-1167.038) (-1165.067) [-1166.127] * (-1165.452) [-1167.843] (-1164.597) (-1170.046) -- 0:00:35
424500 -- (-1166.342) [-1167.932] (-1166.973) (-1166.246) * (-1164.634) [-1163.647] (-1165.323) (-1169.114) -- 0:00:35
425000 -- (-1166.059) [-1165.481] (-1166.824) (-1170.246) * (-1164.702) [-1165.357] (-1166.314) (-1166.061) -- 0:00:35
Average standard deviation of split frequencies: 0.012107
425500 -- [-1164.496] (-1165.398) (-1167.077) (-1170.385) * (-1164.221) (-1166.718) [-1163.766] (-1165.735) -- 0:00:35
426000 -- (-1170.256) [-1165.027] (-1165.122) (-1165.329) * [-1164.298] (-1164.043) (-1164.799) (-1163.549) -- 0:00:35
426500 -- (-1165.203) (-1168.346) [-1166.461] (-1166.922) * [-1165.248] (-1163.971) (-1163.917) (-1166.110) -- 0:00:34
427000 -- [-1172.033] (-1166.827) (-1166.158) (-1167.914) * (-1167.845) (-1169.509) [-1163.235] (-1164.952) -- 0:00:34
427500 -- (-1167.064) (-1164.929) (-1166.916) [-1165.285] * [-1167.222] (-1166.187) (-1165.603) (-1165.659) -- 0:00:36
428000 -- [-1168.886] (-1164.984) (-1164.156) (-1166.701) * (-1172.445) (-1165.684) (-1165.487) [-1165.866] -- 0:00:36
428500 -- (-1165.948) (-1165.083) (-1165.729) [-1164.417] * [-1169.003] (-1165.692) (-1165.974) (-1163.757) -- 0:00:36
429000 -- (-1171.958) (-1163.982) [-1164.567] (-1164.405) * (-1167.685) [-1163.807] (-1168.769) (-1165.142) -- 0:00:35
429500 -- [-1167.622] (-1165.477) (-1166.152) (-1166.165) * [-1165.116] (-1167.610) (-1168.737) (-1166.335) -- 0:00:35
430000 -- (-1169.533) [-1165.831] (-1166.852) (-1164.432) * (-1166.385) [-1166.518] (-1164.374) (-1166.259) -- 0:00:35
Average standard deviation of split frequencies: 0.012041
430500 -- [-1164.073] (-1164.767) (-1166.414) (-1164.746) * (-1165.810) (-1165.935) (-1163.500) [-1163.893] -- 0:00:35
431000 -- (-1164.603) [-1164.375] (-1168.056) (-1164.360) * (-1166.228) (-1163.721) (-1165.474) [-1165.235] -- 0:00:35
431500 -- [-1164.765] (-1164.050) (-1165.441) (-1164.336) * (-1165.606) [-1163.808] (-1166.150) (-1165.821) -- 0:00:35
432000 -- (-1166.363) (-1164.469) [-1164.025] (-1163.752) * [-1165.367] (-1163.700) (-1165.972) (-1165.856) -- 0:00:35
432500 -- (-1167.276) [-1164.421] (-1167.093) (-1166.705) * [-1165.458] (-1164.716) (-1166.427) (-1167.895) -- 0:00:35
433000 -- (-1165.971) (-1165.744) (-1164.309) [-1166.753] * (-1168.119) (-1165.249) (-1167.615) [-1168.755] -- 0:00:35
433500 -- [-1164.718] (-1169.968) (-1167.457) (-1166.799) * (-1163.443) (-1165.095) [-1163.434] (-1167.938) -- 0:00:35
434000 -- (-1163.803) [-1166.483] (-1164.968) (-1167.712) * (-1165.197) (-1166.008) [-1168.007] (-1167.224) -- 0:00:35
434500 -- (-1167.485) (-1164.150) [-1165.299] (-1166.170) * (-1165.439) [-1165.028] (-1164.770) (-1166.380) -- 0:00:35
435000 -- (-1165.763) [-1168.845] (-1166.736) (-1164.333) * (-1166.105) (-1164.353) (-1164.957) [-1166.970] -- 0:00:35
Average standard deviation of split frequencies: 0.012148
435500 -- (-1170.712) (-1171.565) (-1166.180) [-1167.105] * (-1168.165) (-1167.152) (-1165.731) [-1164.719] -- 0:00:34
436000 -- (-1168.546) [-1164.287] (-1165.364) (-1167.168) * [-1166.957] (-1165.732) (-1165.342) (-1166.982) -- 0:00:34
436500 -- (-1164.668) (-1165.337) (-1165.063) [-1165.554] * (-1167.067) (-1170.295) [-1173.465] (-1167.392) -- 0:00:34
437000 -- (-1166.522) [-1164.592] (-1164.444) (-1165.170) * (-1164.358) [-1164.859] (-1163.944) (-1166.872) -- 0:00:34
437500 -- (-1168.830) (-1165.229) (-1168.054) [-1166.056] * (-1166.381) [-1164.749] (-1164.927) (-1167.382) -- 0:00:34
438000 -- (-1165.775) (-1164.158) [-1170.707] (-1164.823) * (-1164.389) [-1165.906] (-1164.702) (-1164.325) -- 0:00:34
438500 -- (-1166.048) [-1165.466] (-1164.292) (-1165.342) * (-1165.837) [-1165.514] (-1169.635) (-1167.502) -- 0:00:34
439000 -- [-1166.149] (-1167.317) (-1165.302) (-1169.469) * (-1168.663) (-1165.558) (-1167.087) [-1165.761] -- 0:00:34
439500 -- (-1165.213) [-1163.724] (-1169.185) (-1165.730) * (-1165.365) [-1166.895] (-1165.363) (-1169.934) -- 0:00:34
440000 -- (-1164.035) (-1164.272) [-1165.777] (-1163.696) * [-1166.034] (-1167.577) (-1164.513) (-1165.956) -- 0:00:34
Average standard deviation of split frequencies: 0.011704
440500 -- (-1168.251) (-1164.394) [-1167.412] (-1163.666) * (-1166.334) [-1163.814] (-1166.933) (-1166.945) -- 0:00:34
441000 -- [-1165.540] (-1165.025) (-1166.442) (-1164.298) * [-1168.013] (-1165.290) (-1165.418) (-1164.993) -- 0:00:34
441500 -- (-1168.150) [-1165.693] (-1165.946) (-1167.366) * [-1168.422] (-1166.463) (-1166.340) (-1163.886) -- 0:00:34
442000 -- (-1165.683) (-1166.489) (-1167.156) [-1167.177] * (-1168.409) (-1166.908) [-1167.616] (-1164.586) -- 0:00:34
442500 -- (-1165.367) (-1167.858) [-1165.738] (-1164.646) * (-1167.365) (-1167.803) [-1168.684] (-1164.602) -- 0:00:34
443000 -- (-1166.739) (-1169.159) [-1163.882] (-1164.851) * (-1166.534) (-1169.043) [-1164.408] (-1163.778) -- 0:00:33
443500 -- (-1165.650) (-1166.721) [-1166.822] (-1165.269) * (-1164.749) [-1168.034] (-1165.132) (-1166.610) -- 0:00:33
444000 -- [-1165.240] (-1167.010) (-1167.730) (-1168.115) * [-1166.839] (-1165.605) (-1169.512) (-1170.747) -- 0:00:35
444500 -- (-1165.760) [-1166.450] (-1170.795) (-1166.651) * [-1163.438] (-1165.439) (-1164.923) (-1168.897) -- 0:00:34
445000 -- (-1165.722) (-1165.771) (-1170.686) [-1164.467] * (-1167.547) (-1165.197) [-1166.046] (-1165.353) -- 0:00:34
Average standard deviation of split frequencies: 0.012062
445500 -- (-1164.160) (-1163.965) [-1167.330] (-1164.099) * (-1165.958) [-1165.920] (-1164.428) (-1165.563) -- 0:00:34
446000 -- (-1165.422) (-1164.625) (-1165.972) [-1163.794] * (-1165.289) (-1164.559) (-1166.214) [-1165.547] -- 0:00:34
446500 -- (-1169.950) (-1167.905) (-1168.778) [-1164.268] * (-1165.861) (-1168.952) (-1169.460) [-1166.793] -- 0:00:34
447000 -- (-1165.983) (-1168.675) (-1167.589) [-1166.438] * (-1165.786) (-1169.424) [-1171.667] (-1169.593) -- 0:00:34
447500 -- (-1165.290) [-1165.568] (-1169.145) (-1166.933) * (-1165.251) [-1168.839] (-1169.341) (-1167.113) -- 0:00:34
448000 -- (-1167.555) (-1163.230) (-1167.382) [-1164.836] * [-1164.440] (-1164.983) (-1164.900) (-1167.126) -- 0:00:34
448500 -- (-1172.613) (-1163.243) (-1166.890) [-1165.194] * [-1166.516] (-1167.802) (-1166.791) (-1166.306) -- 0:00:34
449000 -- (-1165.126) [-1163.314] (-1167.599) (-1168.183) * [-1170.852] (-1168.073) (-1167.061) (-1164.269) -- 0:00:34
449500 -- [-1171.248] (-1164.063) (-1169.756) (-1167.148) * [-1167.667] (-1165.111) (-1170.240) (-1165.460) -- 0:00:34
450000 -- (-1165.511) (-1163.902) (-1168.971) [-1164.784] * (-1168.213) [-1164.577] (-1166.770) (-1170.722) -- 0:00:34
Average standard deviation of split frequencies: 0.012183
450500 -- [-1164.660] (-1164.214) (-1166.006) (-1165.276) * [-1166.745] (-1166.324) (-1166.966) (-1164.617) -- 0:00:34
451000 -- [-1166.076] (-1168.642) (-1165.370) (-1166.360) * [-1163.921] (-1164.535) (-1163.572) (-1166.875) -- 0:00:34
451500 -- (-1166.588) (-1169.639) [-1166.983] (-1166.287) * (-1166.039) (-1168.094) [-1163.348] (-1171.105) -- 0:00:34
452000 -- (-1165.277) (-1166.553) [-1166.264] (-1167.125) * (-1166.903) (-1170.018) (-1163.818) [-1164.143] -- 0:00:33
452500 -- (-1165.449) (-1166.219) (-1167.916) [-1167.250] * (-1167.524) (-1164.943) (-1163.592) [-1165.254] -- 0:00:33
453000 -- (-1167.436) (-1165.344) (-1164.790) [-1165.486] * [-1166.695] (-1165.379) (-1164.212) (-1168.006) -- 0:00:33
453500 -- [-1163.910] (-1165.279) (-1164.568) (-1165.200) * [-1166.810] (-1168.710) (-1164.344) (-1164.106) -- 0:00:33
454000 -- [-1164.076] (-1163.801) (-1164.765) (-1166.888) * (-1166.818) (-1168.477) (-1163.865) [-1163.762] -- 0:00:33
454500 -- (-1164.590) [-1167.306] (-1164.491) (-1166.073) * (-1166.412) (-1168.007) (-1166.630) [-1163.771] -- 0:00:33
455000 -- (-1166.570) (-1164.338) [-1164.723] (-1168.803) * (-1165.353) [-1167.682] (-1166.117) (-1164.273) -- 0:00:33
Average standard deviation of split frequencies: 0.012082
455500 -- (-1167.656) (-1165.221) (-1176.118) [-1166.764] * [-1165.264] (-1166.212) (-1163.808) (-1165.804) -- 0:00:33
456000 -- (-1164.812) (-1164.437) (-1164.809) [-1163.882] * (-1164.276) (-1167.724) (-1164.988) [-1164.870] -- 0:00:33
456500 -- (-1167.361) (-1165.024) (-1163.930) [-1163.847] * [-1164.314] (-1164.267) (-1166.560) (-1163.802) -- 0:00:33
457000 -- [-1166.393] (-1167.289) (-1164.591) (-1164.365) * (-1164.905) [-1164.884] (-1165.721) (-1168.609) -- 0:00:33
457500 -- (-1165.162) [-1166.395] (-1165.295) (-1164.440) * (-1164.872) (-1171.429) (-1168.767) [-1164.710] -- 0:00:33
458000 -- [-1164.438] (-1166.116) (-1164.954) (-1165.648) * [-1164.353] (-1166.922) (-1165.590) (-1169.663) -- 0:00:33
458500 -- (-1165.268) [-1164.824] (-1169.358) (-1167.274) * [-1163.636] (-1166.365) (-1164.972) (-1167.510) -- 0:00:33
459000 -- (-1165.456) (-1165.286) [-1166.523] (-1164.476) * [-1164.181] (-1165.430) (-1168.643) (-1163.781) -- 0:00:33
459500 -- (-1164.410) (-1165.616) [-1164.394] (-1164.613) * [-1164.585] (-1165.498) (-1165.585) (-1165.085) -- 0:00:34
460000 -- (-1164.475) (-1165.159) [-1167.119] (-1167.515) * (-1167.113) (-1171.010) (-1166.626) [-1164.852] -- 0:00:34
Average standard deviation of split frequencies: 0.011128
460500 -- [-1165.837] (-1165.255) (-1168.724) (-1167.164) * [-1164.209] (-1167.841) (-1165.198) (-1164.444) -- 0:00:33
461000 -- (-1164.358) [-1163.929] (-1168.484) (-1164.827) * [-1164.620] (-1163.600) (-1170.589) (-1164.535) -- 0:00:33
461500 -- [-1165.355] (-1164.154) (-1165.633) (-1166.162) * [-1166.869] (-1163.801) (-1165.869) (-1167.239) -- 0:00:33
462000 -- (-1167.267) [-1164.679] (-1169.170) (-1164.977) * (-1165.351) (-1163.786) [-1165.896] (-1165.720) -- 0:00:33
462500 -- [-1166.887] (-1168.740) (-1166.766) (-1168.587) * (-1167.002) [-1164.504] (-1166.576) (-1164.697) -- 0:00:33
463000 -- (-1165.293) (-1166.075) [-1166.036] (-1170.768) * (-1164.866) (-1165.207) [-1164.175] (-1164.699) -- 0:00:33
463500 -- (-1164.308) (-1167.677) (-1164.425) [-1170.064] * (-1164.229) (-1169.900) (-1164.248) [-1165.569] -- 0:00:33
464000 -- [-1164.777] (-1168.353) (-1166.632) (-1174.075) * (-1164.144) (-1168.528) (-1164.673) [-1164.103] -- 0:00:33
464500 -- (-1164.232) [-1165.315] (-1165.199) (-1165.422) * [-1167.072] (-1165.853) (-1163.951) (-1166.857) -- 0:00:33
465000 -- [-1164.277] (-1169.130) (-1167.438) (-1164.391) * (-1167.629) (-1166.886) [-1164.833] (-1165.367) -- 0:00:33
Average standard deviation of split frequencies: 0.010811
465500 -- (-1165.655) (-1167.908) (-1167.560) [-1165.988] * (-1166.385) (-1168.532) (-1165.173) [-1164.943] -- 0:00:33
466000 -- [-1164.583] (-1166.468) (-1168.057) (-1164.529) * [-1163.838] (-1165.717) (-1166.149) (-1163.513) -- 0:00:33
466500 -- (-1169.394) [-1166.505] (-1167.353) (-1163.840) * (-1164.873) (-1164.873) (-1164.807) [-1163.716] -- 0:00:33
467000 -- (-1167.081) [-1167.280] (-1167.926) (-1167.067) * (-1164.873) (-1167.501) (-1164.834) [-1172.811] -- 0:00:33
467500 -- (-1164.889) [-1165.397] (-1165.220) (-1165.057) * (-1164.035) (-1165.157) (-1166.693) [-1167.439] -- 0:00:33
468000 -- [-1165.759] (-1166.385) (-1164.376) (-1167.299) * (-1164.083) (-1169.893) (-1166.366) [-1166.703] -- 0:00:32
468500 -- [-1167.796] (-1166.980) (-1164.010) (-1165.081) * (-1169.958) (-1171.847) (-1166.751) [-1165.952] -- 0:00:32
469000 -- [-1164.880] (-1167.589) (-1168.099) (-1165.870) * (-1169.199) (-1171.993) (-1164.030) [-1165.261] -- 0:00:32
469500 -- (-1165.652) [-1164.579] (-1164.950) (-1164.020) * (-1164.043) (-1165.688) [-1164.134] (-1166.777) -- 0:00:32
470000 -- (-1164.526) (-1167.100) (-1164.927) [-1163.845] * (-1165.631) (-1164.798) [-1167.413] (-1167.273) -- 0:00:32
Average standard deviation of split frequencies: 0.010329
470500 -- (-1164.303) [-1165.616] (-1168.343) (-1164.581) * (-1166.031) (-1166.289) (-1164.956) [-1170.341] -- 0:00:32
471000 -- (-1166.603) (-1165.008) [-1164.774] (-1167.933) * (-1164.801) (-1167.669) (-1164.993) [-1166.171] -- 0:00:32
471500 -- (-1171.246) (-1165.382) (-1165.157) [-1166.432] * (-1164.629) (-1164.422) (-1164.237) [-1164.006] -- 0:00:32
472000 -- (-1167.855) [-1165.135] (-1168.884) (-1164.726) * (-1164.686) (-1164.286) [-1163.339] (-1163.796) -- 0:00:32
472500 -- (-1166.390) (-1165.847) [-1164.417] (-1164.113) * (-1164.346) (-1164.690) [-1165.210] (-1166.952) -- 0:00:32
473000 -- [-1165.724] (-1164.352) (-1165.032) (-1165.577) * (-1163.880) (-1172.242) [-1163.785] (-1166.406) -- 0:00:32
473500 -- (-1169.029) [-1169.156] (-1166.757) (-1163.827) * (-1166.445) [-1164.785] (-1166.316) (-1165.340) -- 0:00:32
474000 -- [-1165.367] (-1166.410) (-1165.219) (-1167.467) * (-1164.379) (-1164.790) [-1166.452] (-1165.449) -- 0:00:32
474500 -- (-1166.489) (-1167.152) [-1164.252] (-1167.305) * (-1164.527) [-1165.207] (-1165.558) (-1166.359) -- 0:00:32
475000 -- (-1164.501) [-1165.336] (-1164.992) (-1166.204) * (-1167.817) (-1166.932) [-1165.118] (-1168.160) -- 0:00:32
Average standard deviation of split frequencies: 0.010027
475500 -- (-1164.438) (-1166.049) (-1167.254) [-1164.535] * [-1163.841] (-1169.219) (-1167.913) (-1166.552) -- 0:00:33
476000 -- (-1166.300) (-1166.833) (-1170.036) [-1164.610] * (-1163.836) (-1165.093) (-1166.749) [-1165.312] -- 0:00:33
476500 -- (-1164.187) [-1166.819] (-1168.648) (-1167.387) * (-1164.422) (-1168.572) (-1163.585) [-1164.653] -- 0:00:32
477000 -- (-1164.236) (-1167.509) (-1169.325) [-1165.253] * (-1166.518) (-1166.820) [-1164.384] (-1166.733) -- 0:00:32
477500 -- [-1165.373] (-1167.654) (-1168.541) (-1165.572) * (-1166.847) (-1166.818) (-1165.643) [-1164.841] -- 0:00:32
478000 -- (-1167.434) [-1167.080] (-1167.225) (-1166.274) * (-1166.547) (-1166.015) [-1167.616] (-1167.331) -- 0:00:32
478500 -- (-1167.056) (-1165.697) (-1166.674) [-1166.928] * [-1166.358] (-1163.973) (-1167.804) (-1165.390) -- 0:00:32
479000 -- (-1165.743) (-1168.047) [-1163.490] (-1165.893) * (-1168.591) [-1163.724] (-1166.397) (-1169.286) -- 0:00:32
479500 -- [-1166.775] (-1167.210) (-1166.930) (-1168.471) * (-1165.488) [-1163.758] (-1167.263) (-1165.687) -- 0:00:32
480000 -- (-1164.510) (-1166.659) (-1165.577) [-1168.729] * (-1165.401) [-1164.843] (-1167.524) (-1165.719) -- 0:00:32
Average standard deviation of split frequencies: 0.011156
480500 -- (-1169.222) [-1164.569] (-1167.398) (-1164.871) * (-1164.774) [-1163.720] (-1170.252) (-1166.052) -- 0:00:32
481000 -- (-1164.732) (-1167.087) [-1167.446] (-1167.730) * (-1165.026) [-1163.612] (-1166.121) (-1167.736) -- 0:00:32
481500 -- (-1164.847) [-1164.943] (-1166.101) (-1167.339) * (-1164.415) (-1166.736) (-1166.291) [-1168.058] -- 0:00:32
482000 -- (-1164.916) [-1165.758] (-1164.005) (-1168.867) * (-1166.085) (-1169.309) (-1166.082) [-1164.884] -- 0:00:32
482500 -- (-1166.946) [-1165.163] (-1163.306) (-1169.266) * [-1164.781] (-1165.507) (-1164.607) (-1163.627) -- 0:00:32
483000 -- (-1164.730) [-1165.570] (-1163.685) (-1165.164) * (-1165.533) [-1163.560] (-1164.191) (-1163.980) -- 0:00:32
483500 -- [-1165.504] (-1170.881) (-1165.630) (-1165.259) * (-1166.761) (-1163.878) [-1165.254] (-1166.509) -- 0:00:32
484000 -- (-1166.706) (-1164.031) [-1166.025] (-1166.083) * (-1164.611) [-1165.806] (-1165.404) (-1167.048) -- 0:00:31
484500 -- (-1166.996) (-1167.515) (-1167.927) [-1164.168] * [-1167.547] (-1166.483) (-1164.110) (-1167.517) -- 0:00:31
485000 -- (-1166.642) (-1164.984) [-1167.833] (-1165.950) * [-1166.633] (-1168.362) (-1164.097) (-1165.602) -- 0:00:31
Average standard deviation of split frequencies: 0.010124
485500 -- (-1164.540) (-1167.905) (-1164.369) [-1166.111] * (-1165.778) (-1168.684) (-1163.999) [-1168.489] -- 0:00:31
486000 -- (-1165.778) (-1168.433) (-1165.507) [-1166.754] * (-1166.576) (-1165.724) (-1165.390) [-1165.507] -- 0:00:31
486500 -- [-1165.204] (-1166.577) (-1165.547) (-1164.466) * [-1165.081] (-1167.507) (-1165.775) (-1165.686) -- 0:00:31
487000 -- (-1164.824) [-1168.298] (-1166.581) (-1164.418) * (-1164.772) (-1165.971) [-1166.310] (-1167.934) -- 0:00:31
487500 -- (-1166.686) [-1167.100] (-1164.408) (-1165.725) * [-1164.385] (-1166.363) (-1164.473) (-1165.848) -- 0:00:31
488000 -- [-1164.849] (-1163.928) (-1166.631) (-1166.230) * (-1164.292) (-1166.042) [-1166.868] (-1163.866) -- 0:00:31
488500 -- (-1165.081) (-1168.089) [-1165.445] (-1168.515) * (-1164.587) (-1170.975) [-1164.058] (-1164.303) -- 0:00:31
489000 -- (-1163.983) [-1164.109] (-1167.982) (-1167.065) * (-1164.616) (-1166.554) (-1164.749) [-1164.819] -- 0:00:31
489500 -- (-1172.237) (-1163.766) [-1165.676] (-1165.866) * [-1164.216] (-1166.059) (-1164.560) (-1164.582) -- 0:00:31
490000 -- [-1165.776] (-1165.567) (-1165.005) (-1165.955) * (-1164.100) (-1166.191) (-1164.153) [-1164.005] -- 0:00:31
Average standard deviation of split frequencies: 0.010448
490500 -- (-1168.337) (-1164.315) [-1164.630] (-1169.977) * (-1166.097) [-1167.323] (-1167.716) (-1163.555) -- 0:00:31
491000 -- (-1169.045) (-1168.467) (-1164.776) [-1164.635] * [-1166.003] (-1165.829) (-1166.938) (-1165.093) -- 0:00:31
491500 -- [-1169.004] (-1166.727) (-1164.384) (-1166.156) * (-1167.204) (-1166.230) [-1166.002] (-1164.847) -- 0:00:32
492000 -- [-1165.282] (-1164.312) (-1165.850) (-1164.547) * (-1166.921) (-1166.870) [-1165.660] (-1165.162) -- 0:00:32
492500 -- (-1165.495) (-1163.716) (-1164.692) [-1166.624] * (-1166.602) (-1166.467) (-1166.832) [-1166.141] -- 0:00:31
493000 -- (-1166.883) (-1164.302) [-1163.855] (-1167.712) * (-1163.524) [-1167.306] (-1165.738) (-1165.553) -- 0:00:31
493500 -- (-1163.949) (-1166.207) [-1163.736] (-1166.174) * [-1163.794] (-1166.634) (-1170.047) (-1165.222) -- 0:00:31
494000 -- (-1163.980) (-1164.114) (-1165.465) [-1164.398] * (-1164.863) (-1168.633) [-1168.179] (-1165.680) -- 0:00:31
494500 -- (-1170.496) [-1163.879] (-1170.164) (-1166.063) * (-1167.910) (-1165.916) [-1164.664] (-1168.330) -- 0:00:31
495000 -- (-1165.748) (-1163.553) (-1167.374) [-1167.661] * [-1166.270] (-1165.405) (-1165.189) (-1168.224) -- 0:00:31
Average standard deviation of split frequencies: 0.010811
495500 -- (-1165.311) (-1168.595) [-1167.368] (-1165.879) * (-1165.257) (-1164.582) (-1165.581) [-1166.849] -- 0:00:31
496000 -- [-1166.349] (-1168.773) (-1167.393) (-1165.334) * (-1166.938) [-1166.489] (-1165.894) (-1165.169) -- 0:00:31
496500 -- (-1166.388) (-1165.943) [-1166.771] (-1167.671) * (-1165.378) (-1166.208) [-1167.106] (-1164.578) -- 0:00:31
497000 -- (-1166.952) (-1165.497) [-1166.483] (-1166.803) * (-1166.015) (-1167.000) (-1166.070) [-1163.968] -- 0:00:31
497500 -- (-1163.884) (-1167.611) (-1166.106) [-1164.621] * [-1166.342] (-1167.164) (-1165.973) (-1164.065) -- 0:00:31
498000 -- (-1164.595) (-1169.845) [-1164.547] (-1164.132) * (-1163.825) (-1166.395) [-1168.910] (-1164.754) -- 0:00:31
498500 -- (-1166.735) [-1168.794] (-1164.590) (-1163.730) * (-1164.104) [-1169.141] (-1168.581) (-1166.098) -- 0:00:31
499000 -- (-1168.471) (-1168.923) (-1163.542) [-1164.990] * (-1164.118) [-1171.519] (-1165.938) (-1166.635) -- 0:00:31
499500 -- (-1165.250) (-1167.224) [-1164.621] (-1165.762) * (-1167.613) [-1164.702] (-1165.916) (-1165.149) -- 0:00:31
500000 -- [-1166.841] (-1167.869) (-1164.358) (-1166.032) * (-1166.575) (-1165.685) (-1164.727) [-1165.027] -- 0:00:31
Average standard deviation of split frequencies: 0.010651
500500 -- (-1164.755) (-1170.324) [-1163.925] (-1164.724) * (-1166.726) (-1163.424) [-1164.851] (-1165.803) -- 0:00:30
501000 -- [-1163.899] (-1164.398) (-1164.360) (-1164.982) * (-1167.209) (-1165.510) [-1165.476] (-1167.183) -- 0:00:30
501500 -- (-1164.116) [-1164.828] (-1165.932) (-1168.292) * [-1165.912] (-1165.842) (-1164.088) (-1172.098) -- 0:00:30
502000 -- [-1165.617] (-1170.520) (-1168.992) (-1168.080) * (-1165.021) [-1163.831] (-1167.363) (-1166.207) -- 0:00:30
502500 -- (-1164.632) (-1170.386) [-1164.885] (-1166.791) * (-1165.680) (-1165.147) [-1165.478] (-1164.187) -- 0:00:30
503000 -- [-1164.702] (-1169.263) (-1169.135) (-1166.312) * (-1166.889) (-1163.794) [-1165.841] (-1167.510) -- 0:00:30
503500 -- (-1165.889) [-1166.928] (-1164.497) (-1167.547) * (-1164.064) [-1164.194] (-1166.952) (-1165.105) -- 0:00:30
504000 -- (-1169.827) (-1166.054) (-1166.263) [-1165.327] * [-1164.498] (-1164.622) (-1167.333) (-1167.685) -- 0:00:30
504500 -- (-1170.110) (-1164.637) [-1165.325] (-1166.426) * [-1164.495] (-1164.438) (-1165.233) (-1165.322) -- 0:00:30
505000 -- (-1167.292) (-1165.252) [-1163.793] (-1165.650) * (-1166.370) (-1165.808) (-1165.266) [-1166.568] -- 0:00:30
Average standard deviation of split frequencies: 0.010481
505500 -- (-1163.698) (-1164.751) (-1164.917) [-1164.602] * (-1169.784) [-1169.791] (-1164.304) (-1164.041) -- 0:00:30
506000 -- [-1164.833] (-1167.467) (-1163.807) (-1164.563) * (-1168.212) (-1171.106) [-1166.991] (-1165.669) -- 0:00:30
506500 -- (-1166.198) (-1168.989) (-1167.216) [-1164.588] * (-1166.065) (-1172.321) (-1164.542) [-1165.268] -- 0:00:30
507000 -- [-1165.280] (-1164.205) (-1166.477) (-1165.428) * [-1164.075] (-1168.157) (-1166.436) (-1164.759) -- 0:00:30
507500 -- (-1166.537) [-1166.299] (-1166.097) (-1164.949) * [-1163.184] (-1164.491) (-1167.087) (-1165.473) -- 0:00:30
508000 -- (-1168.352) [-1166.452] (-1169.129) (-1163.693) * (-1164.983) (-1165.898) [-1166.142] (-1163.621) -- 0:00:30
508500 -- (-1167.841) [-1163.863] (-1165.589) (-1165.238) * (-1163.977) (-1167.384) (-1166.854) [-1166.973] -- 0:00:30
509000 -- (-1165.793) (-1166.238) (-1166.453) [-1167.068] * (-1166.465) [-1164.698] (-1166.408) (-1164.310) -- 0:00:30
509500 -- (-1167.267) (-1164.410) (-1165.196) [-1163.773] * (-1164.712) (-1165.153) (-1169.619) [-1165.703] -- 0:00:30
510000 -- (-1167.516) (-1165.321) (-1166.114) [-1165.358] * [-1164.488] (-1167.835) (-1166.365) (-1164.406) -- 0:00:30
Average standard deviation of split frequencies: 0.011135
510500 -- (-1165.942) (-1166.842) (-1165.353) [-1164.466] * (-1166.863) [-1167.376] (-1165.607) (-1164.314) -- 0:00:30
511000 -- [-1166.601] (-1165.825) (-1166.328) (-1164.060) * (-1165.912) [-1167.598] (-1167.186) (-1164.289) -- 0:00:30
511500 -- [-1167.795] (-1164.990) (-1164.904) (-1163.359) * (-1168.447) (-1164.380) [-1165.111] (-1166.556) -- 0:00:30
512000 -- (-1171.997) (-1165.462) (-1164.227) [-1163.298] * [-1167.317] (-1167.071) (-1171.967) (-1165.822) -- 0:00:30
512500 -- (-1168.650) [-1164.373] (-1164.812) (-1164.666) * (-1166.039) [-1164.164] (-1166.598) (-1165.513) -- 0:00:30
513000 -- [-1166.504] (-1164.092) (-1164.894) (-1165.800) * (-1164.895) [-1163.323] (-1166.761) (-1166.093) -- 0:00:30
513500 -- (-1167.457) (-1164.082) [-1164.865] (-1164.190) * (-1165.347) (-1165.279) (-1164.186) [-1163.678] -- 0:00:30
514000 -- (-1166.906) (-1163.988) (-1164.787) [-1165.890] * (-1165.388) (-1164.729) [-1165.082] (-1165.438) -- 0:00:30
514500 -- (-1167.242) [-1164.105] (-1164.839) (-1165.271) * (-1165.213) (-1164.442) (-1167.840) [-1164.224] -- 0:00:30
515000 -- (-1166.483) [-1164.105] (-1163.440) (-1166.743) * (-1164.570) (-1164.744) (-1165.848) [-1165.094] -- 0:00:30
Average standard deviation of split frequencies: 0.010164
515500 -- (-1167.156) (-1168.585) (-1165.089) [-1165.136] * (-1166.215) [-1165.368] (-1163.756) (-1165.946) -- 0:00:30
516000 -- (-1167.196) (-1163.741) (-1165.064) [-1165.036] * (-1165.164) (-1164.062) (-1167.267) [-1165.463] -- 0:00:30
516500 -- (-1165.218) (-1165.078) (-1164.754) [-1164.577] * (-1169.347) (-1163.748) [-1166.700] (-1164.295) -- 0:00:29
517000 -- (-1164.431) (-1166.208) (-1163.444) [-1163.664] * (-1167.312) (-1167.345) [-1163.773] (-1165.271) -- 0:00:29
517500 -- (-1165.665) (-1164.040) [-1165.177] (-1170.159) * (-1166.626) (-1164.760) [-1165.095] (-1164.538) -- 0:00:29
518000 -- (-1165.726) (-1165.386) [-1165.275] (-1170.897) * (-1163.426) [-1165.286] (-1167.176) (-1168.098) -- 0:00:29
518500 -- (-1165.302) (-1165.370) [-1163.726] (-1170.897) * (-1164.704) (-1165.508) (-1164.195) [-1168.879] -- 0:00:29
519000 -- (-1164.372) (-1169.973) (-1163.973) [-1169.148] * (-1167.227) (-1165.808) (-1165.299) [-1167.502] -- 0:00:29
519500 -- (-1163.886) (-1166.638) [-1164.069] (-1169.883) * (-1167.588) (-1164.200) [-1164.741] (-1165.272) -- 0:00:29
520000 -- [-1165.683] (-1170.854) (-1164.722) (-1165.476) * (-1165.006) (-1163.988) (-1168.586) [-1167.461] -- 0:00:29
Average standard deviation of split frequencies: 0.010865
520500 -- [-1163.868] (-1169.472) (-1164.236) (-1165.431) * (-1167.829) (-1167.692) (-1167.645) [-1166.329] -- 0:00:29
521000 -- [-1165.579] (-1167.386) (-1166.035) (-1164.168) * (-1168.306) (-1164.294) [-1164.212] (-1165.542) -- 0:00:29
521500 -- (-1164.781) (-1165.190) [-1165.645] (-1164.615) * [-1164.501] (-1165.693) (-1166.878) (-1169.934) -- 0:00:29
522000 -- (-1167.579) (-1166.368) [-1164.082] (-1165.665) * (-1163.832) (-1164.900) (-1166.782) [-1164.909] -- 0:00:29
522500 -- (-1167.457) (-1166.597) [-1164.158] (-1164.755) * (-1165.696) (-1164.735) (-1165.024) [-1164.735] -- 0:00:29
523000 -- (-1165.947) (-1165.859) [-1164.491] (-1165.130) * (-1169.038) [-1167.775] (-1165.344) (-1166.694) -- 0:00:29
523500 -- (-1168.177) [-1163.549] (-1169.328) (-1164.125) * (-1165.782) (-1166.071) (-1166.212) [-1164.902] -- 0:00:29
524000 -- (-1164.659) (-1165.372) [-1163.821] (-1166.417) * (-1170.705) (-1166.230) [-1164.068] (-1163.451) -- 0:00:29
524500 -- (-1163.539) (-1163.471) (-1163.935) [-1165.108] * (-1166.038) (-1164.621) (-1165.646) [-1164.060] -- 0:00:29
525000 -- (-1163.693) (-1163.900) (-1165.269) [-1163.918] * (-1165.489) [-1164.639] (-1165.589) (-1165.846) -- 0:00:29
Average standard deviation of split frequencies: 0.009970
525500 -- (-1165.610) (-1164.954) [-1168.247] (-1164.375) * (-1165.446) (-1166.094) [-1169.669] (-1163.593) -- 0:00:29
526000 -- (-1164.631) (-1172.581) (-1165.842) [-1168.056] * (-1164.778) (-1166.776) (-1165.106) [-1166.623] -- 0:00:29
526500 -- (-1165.027) (-1167.221) (-1165.322) [-1163.923] * (-1166.032) (-1165.783) (-1165.151) [-1166.812] -- 0:00:29
527000 -- (-1166.203) [-1168.809] (-1167.272) (-1168.011) * (-1166.653) (-1164.174) (-1165.321) [-1164.894] -- 0:00:29
527500 -- [-1164.639] (-1166.913) (-1165.985) (-1167.031) * (-1166.343) (-1166.556) (-1165.594) [-1164.826] -- 0:00:29
528000 -- (-1164.757) [-1165.241] (-1166.468) (-1167.375) * [-1165.326] (-1164.945) (-1165.654) (-1166.145) -- 0:00:29
528500 -- [-1165.306] (-1165.654) (-1165.520) (-1166.235) * [-1164.279] (-1166.421) (-1164.748) (-1164.089) -- 0:00:29
529000 -- (-1163.680) (-1164.511) [-1166.595] (-1167.555) * (-1164.530) (-1166.446) (-1167.616) [-1165.074] -- 0:00:29
529500 -- (-1164.918) (-1167.535) (-1164.997) [-1165.029] * [-1164.047] (-1166.885) (-1164.205) (-1165.347) -- 0:00:29
530000 -- (-1163.641) (-1166.404) [-1164.697] (-1168.589) * (-1163.378) (-1164.939) (-1164.065) [-1163.417] -- 0:00:29
Average standard deviation of split frequencies: 0.009327
530500 -- (-1164.371) (-1167.203) (-1167.987) [-1164.914] * (-1164.441) (-1165.244) [-1167.042] (-1166.106) -- 0:00:29
531000 -- [-1164.750] (-1166.238) (-1173.705) (-1164.539) * (-1168.880) [-1168.722] (-1166.630) (-1169.441) -- 0:00:29
531500 -- (-1163.963) [-1165.460] (-1166.751) (-1166.124) * (-1170.068) (-1163.434) [-1164.451] (-1165.677) -- 0:00:29
532000 -- (-1165.102) (-1163.548) (-1166.445) [-1167.603] * [-1166.998] (-1164.601) (-1165.464) (-1164.234) -- 0:00:29
532500 -- (-1164.442) (-1166.456) (-1165.369) [-1168.410] * (-1167.869) (-1163.691) (-1164.693) [-1164.552] -- 0:00:28
533000 -- (-1166.981) (-1168.333) [-1166.256] (-1165.883) * (-1168.894) (-1163.466) (-1163.870) [-1163.633] -- 0:00:28
533500 -- (-1164.441) (-1169.692) (-1166.429) [-1166.459] * (-1167.176) (-1166.741) [-1169.809] (-1164.832) -- 0:00:28
534000 -- [-1169.251] (-1168.239) (-1164.795) (-1167.885) * (-1167.468) (-1164.587) (-1164.689) [-1164.371] -- 0:00:28
534500 -- (-1164.316) (-1165.573) [-1165.856] (-1168.294) * (-1166.807) [-1167.447] (-1166.491) (-1165.992) -- 0:00:28
535000 -- (-1166.040) (-1165.667) (-1167.481) [-1164.306] * (-1168.552) [-1167.013] (-1167.048) (-1167.184) -- 0:00:28
Average standard deviation of split frequencies: 0.009015
535500 -- (-1168.608) (-1165.395) (-1167.627) [-1165.068] * [-1167.320] (-1167.446) (-1164.344) (-1167.359) -- 0:00:28
536000 -- (-1164.716) [-1170.487] (-1166.670) (-1167.130) * [-1163.579] (-1166.346) (-1166.785) (-1167.470) -- 0:00:28
536500 -- (-1164.825) [-1167.718] (-1166.928) (-1165.768) * (-1165.934) [-1164.693] (-1169.065) (-1163.943) -- 0:00:28
537000 -- (-1164.577) [-1164.250] (-1166.170) (-1166.028) * [-1165.400] (-1164.726) (-1166.798) (-1166.661) -- 0:00:28
537500 -- [-1169.067] (-1163.581) (-1167.005) (-1163.893) * [-1166.173] (-1168.530) (-1165.396) (-1164.720) -- 0:00:28
538000 -- (-1168.654) (-1164.962) [-1165.324] (-1164.143) * (-1166.991) [-1164.318] (-1170.147) (-1164.227) -- 0:00:28
538500 -- (-1165.728) (-1163.663) [-1164.253] (-1165.908) * (-1164.682) (-1169.413) [-1167.282] (-1164.290) -- 0:00:28
539000 -- [-1163.369] (-1168.188) (-1166.059) (-1165.959) * (-1167.368) (-1166.170) [-1167.123] (-1164.087) -- 0:00:28
539500 -- (-1163.612) (-1168.189) [-1165.622] (-1168.864) * (-1165.472) (-1167.234) (-1166.205) [-1165.290] -- 0:00:28
540000 -- (-1165.532) (-1166.651) [-1165.418] (-1172.274) * [-1164.783] (-1164.560) (-1165.489) (-1164.724) -- 0:00:28
Average standard deviation of split frequencies: 0.008229
540500 -- [-1166.661] (-1165.918) (-1168.798) (-1167.568) * (-1164.844) (-1164.469) [-1163.931] (-1167.209) -- 0:00:28
541000 -- [-1166.020] (-1166.430) (-1165.850) (-1166.423) * (-1165.527) [-1164.142] (-1167.654) (-1164.219) -- 0:00:28
541500 -- (-1168.038) (-1166.871) [-1167.817] (-1166.587) * (-1165.164) (-1165.588) (-1168.902) [-1164.722] -- 0:00:28
542000 -- (-1165.603) (-1166.889) (-1165.629) [-1167.344] * (-1164.939) (-1169.290) (-1166.038) [-1165.059] -- 0:00:28
542500 -- (-1168.070) (-1165.528) [-1164.773] (-1165.789) * (-1165.086) (-1170.030) (-1165.524) [-1165.285] -- 0:00:28
543000 -- (-1164.372) [-1168.204] (-1166.054) (-1164.672) * (-1166.015) [-1166.987] (-1166.515) (-1167.927) -- 0:00:28
543500 -- (-1164.224) [-1170.538] (-1164.176) (-1164.435) * (-1167.230) (-1167.122) (-1165.796) [-1167.070] -- 0:00:28
544000 -- (-1163.922) [-1164.358] (-1163.871) (-1166.460) * (-1164.997) (-1163.998) [-1164.309] (-1170.387) -- 0:00:28
544500 -- (-1166.139) (-1164.570) [-1166.007] (-1165.642) * (-1173.079) (-1165.017) [-1163.935] (-1165.510) -- 0:00:28
545000 -- (-1167.949) [-1163.913] (-1165.926) (-1165.753) * (-1166.111) (-1164.071) [-1163.672] (-1167.660) -- 0:00:28
Average standard deviation of split frequencies: 0.007986
545500 -- (-1167.651) (-1163.414) [-1166.754] (-1164.919) * [-1167.392] (-1164.536) (-1166.614) (-1164.602) -- 0:00:28
546000 -- [-1165.738] (-1166.142) (-1166.211) (-1166.023) * (-1169.997) (-1164.592) (-1164.331) [-1166.389] -- 0:00:28
546500 -- (-1165.562) (-1166.542) (-1171.144) [-1165.577] * (-1167.317) (-1165.423) [-1163.927] (-1165.968) -- 0:00:28
547000 -- [-1163.496] (-1164.683) (-1168.594) (-1165.784) * [-1165.845] (-1164.988) (-1164.269) (-1165.994) -- 0:00:28
547500 -- [-1166.066] (-1164.629) (-1167.165) (-1169.746) * (-1168.309) [-1167.511] (-1166.065) (-1168.409) -- 0:00:28
548000 -- (-1165.334) (-1163.793) [-1165.384] (-1163.729) * [-1164.950] (-1165.026) (-1169.784) (-1166.466) -- 0:00:28
548500 -- (-1167.338) (-1163.960) (-1164.899) [-1164.974] * [-1165.844] (-1165.860) (-1167.670) (-1166.666) -- 0:00:27
549000 -- (-1165.663) (-1166.074) (-1164.955) [-1165.816] * [-1167.020] (-1167.024) (-1164.504) (-1166.957) -- 0:00:27
549500 -- (-1165.391) [-1164.179] (-1164.262) (-1165.216) * (-1164.710) (-1168.888) (-1166.550) [-1165.769] -- 0:00:27
550000 -- (-1166.061) (-1165.375) (-1164.485) [-1165.479] * (-1164.868) (-1164.990) (-1170.823) [-1164.449] -- 0:00:27
Average standard deviation of split frequencies: 0.007598
550500 -- (-1166.986) [-1165.528] (-1167.248) (-1169.010) * (-1166.827) [-1166.587] (-1164.992) (-1165.554) -- 0:00:27
551000 -- (-1165.803) (-1165.978) [-1165.587] (-1166.284) * (-1168.503) (-1168.062) [-1164.490] (-1167.404) -- 0:00:27
551500 -- (-1164.431) [-1164.286] (-1165.679) (-1167.032) * (-1164.472) (-1167.361) [-1165.497] (-1169.303) -- 0:00:27
552000 -- (-1164.450) (-1167.600) (-1163.880) [-1166.544] * [-1167.757] (-1167.941) (-1165.385) (-1167.116) -- 0:00:27
552500 -- (-1167.932) [-1164.787] (-1164.354) (-1166.106) * (-1166.351) (-1165.193) [-1166.865] (-1166.628) -- 0:00:27
553000 -- (-1165.976) (-1165.865) (-1163.681) [-1167.384] * [-1167.276] (-1169.559) (-1168.368) (-1167.818) -- 0:00:27
553500 -- (-1164.448) (-1165.529) [-1163.679] (-1165.466) * [-1167.593] (-1164.982) (-1165.558) (-1167.277) -- 0:00:27
554000 -- (-1164.811) (-1166.870) [-1165.593] (-1165.665) * [-1166.629] (-1165.318) (-1165.963) (-1168.712) -- 0:00:27
554500 -- (-1171.460) (-1167.813) [-1164.256] (-1165.344) * (-1167.888) (-1169.522) [-1166.290] (-1165.730) -- 0:00:27
555000 -- (-1167.416) (-1166.534) (-1164.812) [-1164.720] * (-1165.725) (-1167.858) [-1166.525] (-1165.437) -- 0:00:27
Average standard deviation of split frequencies: 0.008055
555500 -- [-1168.056] (-1168.823) (-1166.271) (-1164.881) * (-1168.000) [-1163.832] (-1169.089) (-1166.084) -- 0:00:27
556000 -- (-1165.531) [-1164.292] (-1165.170) (-1167.399) * (-1163.582) [-1165.198] (-1164.853) (-1166.185) -- 0:00:27
556500 -- (-1164.667) (-1168.597) (-1166.598) [-1164.509] * [-1164.725] (-1166.078) (-1167.017) (-1167.044) -- 0:00:27
557000 -- (-1164.925) (-1174.927) [-1166.527] (-1164.597) * [-1164.817] (-1166.833) (-1168.628) (-1165.221) -- 0:00:27
557500 -- (-1167.909) [-1169.575] (-1166.470) (-1165.180) * [-1164.903] (-1164.805) (-1168.290) (-1163.807) -- 0:00:27
558000 -- (-1167.768) (-1171.528) [-1166.484] (-1165.645) * (-1164.837) [-1166.270] (-1168.102) (-1164.199) -- 0:00:27
558500 -- (-1167.936) (-1164.387) [-1167.781] (-1166.192) * (-1167.292) (-1168.039) (-1164.244) [-1164.848] -- 0:00:27
559000 -- [-1164.882] (-1166.581) (-1164.443) (-1165.258) * (-1164.848) (-1164.578) [-1165.969] (-1165.326) -- 0:00:27
559500 -- (-1164.571) (-1166.959) (-1165.391) [-1164.774] * (-1165.614) [-1165.795] (-1165.438) (-1166.657) -- 0:00:27
560000 -- (-1168.894) (-1165.286) [-1165.179] (-1166.205) * (-1165.326) (-1167.731) [-1166.844] (-1169.156) -- 0:00:27
Average standard deviation of split frequencies: 0.008250
560500 -- (-1168.243) (-1165.679) (-1165.203) [-1166.126] * (-1165.020) (-1164.012) [-1166.708] (-1171.356) -- 0:00:27
561000 -- (-1164.525) (-1169.674) (-1165.805) [-1169.356] * (-1166.336) (-1168.909) (-1164.803) [-1163.934] -- 0:00:27
561500 -- (-1163.721) [-1166.917] (-1168.849) (-1164.733) * (-1165.635) (-1165.862) [-1167.591] (-1164.709) -- 0:00:27
562000 -- [-1165.583] (-1167.015) (-1166.518) (-1164.918) * (-1165.757) (-1168.577) (-1165.563) [-1167.069] -- 0:00:27
562500 -- (-1165.168) (-1165.703) (-1165.855) [-1163.547] * [-1165.821] (-1164.154) (-1164.040) (-1167.586) -- 0:00:27
563000 -- (-1164.086) (-1169.887) [-1165.994] (-1163.872) * (-1165.376) [-1165.332] (-1163.955) (-1166.087) -- 0:00:27
563500 -- (-1166.557) (-1168.617) (-1167.175) [-1166.590] * [-1164.027] (-1167.380) (-1167.084) (-1166.839) -- 0:00:27
564000 -- (-1167.684) [-1165.859] (-1167.046) (-1165.453) * (-1166.090) [-1166.509] (-1165.745) (-1171.771) -- 0:00:27
564500 -- (-1171.180) (-1169.285) [-1165.540] (-1164.419) * (-1164.652) [-1166.127] (-1165.360) (-1171.764) -- 0:00:27
565000 -- (-1166.060) (-1170.276) [-1165.942] (-1164.491) * [-1165.108] (-1167.004) (-1166.185) (-1167.804) -- 0:00:26
Average standard deviation of split frequencies: 0.007860
565500 -- (-1169.373) (-1170.517) (-1164.773) [-1164.325] * (-1166.421) (-1166.051) (-1166.004) [-1164.342] -- 0:00:26
566000 -- (-1168.642) (-1169.854) [-1170.374] (-1164.062) * (-1166.252) (-1171.896) [-1166.031] (-1165.762) -- 0:00:26
566500 -- (-1169.354) (-1166.029) [-1165.967] (-1163.976) * (-1169.806) [-1169.969] (-1164.821) (-1167.146) -- 0:00:26
567000 -- (-1165.585) (-1168.667) [-1164.384] (-1165.028) * (-1166.058) (-1168.087) (-1166.221) [-1163.653] -- 0:00:26
567500 -- (-1171.067) (-1166.904) [-1167.899] (-1164.154) * [-1165.609] (-1167.548) (-1164.545) (-1164.409) -- 0:00:26
568000 -- (-1164.091) (-1164.561) (-1168.819) [-1166.324] * (-1164.807) (-1165.822) (-1165.759) [-1163.441] -- 0:00:26
568500 -- (-1165.329) [-1165.335] (-1164.210) (-1167.711) * (-1167.127) [-1165.635] (-1166.298) (-1165.068) -- 0:00:26
569000 -- (-1165.240) [-1164.872] (-1165.886) (-1166.902) * [-1167.979] (-1168.792) (-1165.805) (-1164.795) -- 0:00:26
569500 -- (-1165.777) [-1163.728] (-1165.413) (-1163.919) * (-1164.022) (-1165.802) (-1164.546) [-1164.743] -- 0:00:26
570000 -- (-1168.808) [-1163.533] (-1165.024) (-1164.441) * (-1164.006) (-1167.044) [-1164.238] (-1163.859) -- 0:00:26
Average standard deviation of split frequencies: 0.007848
570500 -- (-1166.048) (-1164.256) (-1163.917) [-1164.327] * (-1166.523) (-1165.646) [-1165.766] (-1165.292) -- 0:00:26
571000 -- (-1166.080) (-1166.753) [-1164.022] (-1166.798) * (-1166.143) (-1164.680) (-1166.389) [-1165.117] -- 0:00:26
571500 -- [-1164.779] (-1166.692) (-1164.040) (-1166.275) * (-1166.042) (-1165.705) (-1168.868) [-1165.100] -- 0:00:26
572000 -- (-1166.245) (-1168.540) (-1167.346) [-1164.864] * [-1165.146] (-1165.798) (-1169.794) (-1164.983) -- 0:00:26
572500 -- (-1166.910) (-1163.515) [-1165.232] (-1164.466) * [-1165.778] (-1165.369) (-1164.997) (-1165.006) -- 0:00:26
573000 -- (-1165.335) (-1164.189) [-1166.210] (-1167.309) * (-1167.391) (-1164.453) [-1165.798] (-1164.388) -- 0:00:26
573500 -- (-1165.994) [-1164.026] (-1163.544) (-1167.525) * (-1168.003) (-1167.674) [-1163.311] (-1170.150) -- 0:00:26
574000 -- [-1164.799] (-1169.480) (-1166.510) (-1164.977) * (-1166.883) (-1169.031) (-1165.930) [-1165.399] -- 0:00:26
574500 -- [-1167.020] (-1165.170) (-1168.431) (-1166.178) * [-1164.642] (-1167.291) (-1166.365) (-1166.482) -- 0:00:26
575000 -- [-1165.179] (-1163.492) (-1167.327) (-1165.390) * (-1165.425) [-1167.772] (-1166.833) (-1164.745) -- 0:00:26
Average standard deviation of split frequencies: 0.008338
575500 -- (-1166.276) (-1163.732) [-1164.145] (-1163.663) * (-1164.219) [-1163.543] (-1167.279) (-1166.662) -- 0:00:26
576000 -- (-1171.525) [-1167.622] (-1167.246) (-1164.817) * (-1165.190) [-1163.918] (-1167.021) (-1166.601) -- 0:00:26
576500 -- (-1166.240) (-1165.650) [-1167.623] (-1165.037) * (-1166.453) [-1163.512] (-1164.593) (-1165.454) -- 0:00:26
577000 -- (-1164.489) (-1165.109) (-1164.849) [-1166.153] * (-1165.057) (-1166.197) (-1165.478) [-1165.825] -- 0:00:26
577500 -- (-1167.256) (-1163.509) [-1164.261] (-1164.255) * (-1165.995) (-1166.011) [-1166.620] (-1164.436) -- 0:00:26
578000 -- (-1164.606) (-1164.836) (-1169.136) [-1164.528] * (-1165.560) (-1166.045) (-1166.607) [-1165.540] -- 0:00:26
578500 -- (-1164.043) [-1164.585] (-1166.625) (-1166.622) * (-1164.518) (-1164.533) [-1166.402] (-1166.757) -- 0:00:26
579000 -- (-1163.548) [-1165.357] (-1167.877) (-1164.334) * (-1163.332) (-1164.885) [-1165.013] (-1167.059) -- 0:00:26
579500 -- (-1166.476) (-1167.454) (-1164.988) [-1164.266] * (-1164.056) [-1164.418] (-1164.040) (-1170.230) -- 0:00:26
580000 -- [-1165.476] (-1166.015) (-1168.063) (-1165.860) * (-1171.348) (-1165.285) [-1164.908] (-1168.159) -- 0:00:26
Average standard deviation of split frequencies: 0.008739
580500 -- (-1168.733) (-1165.958) (-1165.856) [-1164.240] * (-1164.645) [-1171.081] (-1165.569) (-1163.280) -- 0:00:26
581000 -- (-1166.554) (-1165.043) [-1165.391] (-1163.724) * [-1165.792] (-1166.772) (-1169.283) (-1171.399) -- 0:00:25
581500 -- [-1165.514] (-1163.653) (-1166.533) (-1163.879) * (-1164.721) [-1165.339] (-1164.923) (-1170.072) -- 0:00:25
582000 -- (-1169.271) (-1165.262) [-1164.701] (-1167.231) * [-1165.971] (-1164.942) (-1167.787) (-1165.446) -- 0:00:25
582500 -- (-1168.054) [-1166.473] (-1165.088) (-1164.240) * (-1164.113) [-1166.669] (-1165.858) (-1164.564) -- 0:00:25
583000 -- (-1167.352) [-1164.997] (-1165.423) (-1166.211) * [-1164.227] (-1165.201) (-1167.141) (-1163.840) -- 0:00:25
583500 -- (-1165.043) [-1165.465] (-1165.677) (-1166.144) * (-1169.432) [-1166.049] (-1164.080) (-1164.400) -- 0:00:25
584000 -- (-1165.509) (-1166.821) [-1167.472] (-1165.438) * [-1165.581] (-1169.208) (-1167.401) (-1164.334) -- 0:00:25
584500 -- (-1165.685) (-1169.429) [-1163.815] (-1165.030) * [-1166.333] (-1166.494) (-1166.766) (-1166.503) -- 0:00:25
585000 -- (-1165.493) (-1168.551) [-1167.029] (-1167.244) * (-1163.741) (-1165.893) [-1168.024] (-1170.466) -- 0:00:25
Average standard deviation of split frequencies: 0.008991
585500 -- [-1165.070] (-1167.077) (-1167.000) (-1164.887) * (-1164.568) [-1163.723] (-1165.039) (-1165.515) -- 0:00:25
586000 -- [-1166.735] (-1168.264) (-1163.729) (-1164.238) * [-1163.539] (-1164.610) (-1166.902) (-1165.596) -- 0:00:25
586500 -- (-1166.145) (-1166.735) (-1167.112) [-1165.051] * (-1164.227) [-1166.944] (-1166.014) (-1164.435) -- 0:00:25
587000 -- (-1164.500) (-1166.319) (-1167.461) [-1164.655] * [-1164.550] (-1170.725) (-1163.898) (-1165.173) -- 0:00:25
587500 -- (-1165.166) [-1165.846] (-1165.694) (-1169.434) * (-1164.771) [-1168.483] (-1165.312) (-1166.040) -- 0:00:25
588000 -- (-1165.743) [-1166.112] (-1165.978) (-1168.880) * [-1164.232] (-1168.517) (-1169.024) (-1164.981) -- 0:00:25
588500 -- [-1165.036] (-1165.143) (-1164.864) (-1164.308) * (-1165.447) [-1165.486] (-1169.073) (-1168.685) -- 0:00:25
589000 -- [-1167.661] (-1164.948) (-1166.867) (-1164.095) * (-1165.024) [-1167.050] (-1165.948) (-1165.348) -- 0:00:25
589500 -- (-1168.565) (-1164.517) (-1164.966) [-1164.360] * (-1163.503) (-1165.690) (-1164.767) [-1164.216] -- 0:00:25
590000 -- (-1166.751) (-1165.727) (-1164.015) [-1164.716] * (-1164.843) (-1166.241) (-1166.228) [-1164.552] -- 0:00:25
Average standard deviation of split frequencies: 0.009436
590500 -- (-1166.776) (-1170.854) [-1165.428] (-1163.646) * (-1164.911) (-1168.408) [-1165.853] (-1163.970) -- 0:00:25
591000 -- [-1166.088] (-1171.972) (-1164.310) (-1164.799) * [-1164.463] (-1169.838) (-1165.189) (-1166.708) -- 0:00:25
591500 -- [-1164.757] (-1169.154) (-1167.513) (-1164.798) * (-1166.814) (-1168.113) [-1164.967] (-1166.895) -- 0:00:25
592000 -- (-1167.389) (-1167.341) (-1167.431) [-1166.837] * (-1163.968) (-1166.775) [-1167.063] (-1169.547) -- 0:00:25
592500 -- (-1163.862) (-1164.463) (-1168.509) [-1166.616] * [-1164.505] (-1167.086) (-1167.725) (-1167.286) -- 0:00:25
593000 -- [-1164.228] (-1167.295) (-1170.658) (-1166.057) * (-1165.052) (-1168.826) [-1165.507] (-1165.710) -- 0:00:25
593500 -- [-1166.809] (-1167.509) (-1173.178) (-1163.840) * (-1165.336) (-1165.187) (-1165.864) [-1167.599] -- 0:00:25
594000 -- (-1170.497) (-1163.889) (-1168.398) [-1164.438] * (-1164.571) (-1163.277) (-1163.772) [-1171.284] -- 0:00:25
594500 -- (-1165.825) (-1163.916) (-1171.277) [-1163.978] * (-1167.222) (-1165.894) [-1163.898] (-1165.450) -- 0:00:25
595000 -- (-1165.720) (-1164.155) [-1167.288] (-1164.439) * (-1167.569) (-1168.220) (-1167.995) [-1164.134] -- 0:00:25
Average standard deviation of split frequencies: 0.009538
595500 -- [-1164.142] (-1167.971) (-1170.411) (-1166.621) * (-1166.048) (-1165.068) (-1165.177) [-1165.035] -- 0:00:25
596000 -- (-1164.247) [-1165.134] (-1170.663) (-1165.888) * (-1165.001) [-1164.213] (-1167.073) (-1168.696) -- 0:00:25
596500 -- (-1164.721) (-1164.580) [-1165.308] (-1163.524) * (-1166.372) (-1164.338) [-1164.873] (-1164.867) -- 0:00:25
597000 -- (-1164.985) (-1166.420) (-1165.451) [-1163.529] * (-1169.492) (-1164.180) (-1165.007) [-1166.265] -- 0:00:24
597500 -- [-1164.585] (-1165.842) (-1166.400) (-1163.732) * (-1164.264) (-1164.330) (-1164.848) [-1164.442] -- 0:00:24
598000 -- (-1166.705) [-1164.531] (-1166.642) (-1163.810) * (-1167.879) [-1164.499] (-1165.580) (-1164.440) -- 0:00:24
598500 -- (-1167.203) [-1164.956] (-1165.681) (-1163.999) * (-1167.652) (-1165.000) (-1170.313) [-1165.586] -- 0:00:24
599000 -- [-1164.803] (-1165.616) (-1167.558) (-1164.844) * (-1165.866) [-1165.816] (-1166.451) (-1166.591) -- 0:00:24
599500 -- [-1164.620] (-1170.210) (-1166.347) (-1164.297) * (-1169.724) [-1164.249] (-1165.191) (-1164.255) -- 0:00:24
600000 -- (-1164.826) (-1167.701) (-1166.023) [-1164.781] * (-1168.472) [-1166.758] (-1167.432) (-1164.576) -- 0:00:24
Average standard deviation of split frequencies: 0.009279
600500 -- (-1167.632) (-1168.705) [-1165.327] (-1166.295) * (-1165.883) (-1167.065) [-1165.985] (-1167.092) -- 0:00:24
601000 -- (-1165.266) [-1167.578] (-1165.530) (-1166.353) * (-1164.650) [-1164.966] (-1166.310) (-1164.476) -- 0:00:24
601500 -- (-1164.189) [-1168.384] (-1164.507) (-1164.940) * [-1163.560] (-1165.227) (-1167.440) (-1166.200) -- 0:00:24
602000 -- (-1166.274) (-1164.625) [-1167.258] (-1167.285) * [-1165.689] (-1165.210) (-1163.752) (-1164.342) -- 0:00:24
602500 -- (-1165.968) [-1166.017] (-1165.334) (-1164.951) * [-1165.830] (-1164.967) (-1168.636) (-1166.711) -- 0:00:24
603000 -- (-1164.190) [-1170.045] (-1166.196) (-1165.623) * [-1165.599] (-1165.546) (-1167.217) (-1164.609) -- 0:00:24
603500 -- (-1164.252) (-1170.540) (-1168.991) [-1168.062] * (-1164.707) (-1163.246) [-1165.759] (-1163.767) -- 0:00:24
604000 -- (-1163.521) [-1166.075] (-1166.082) (-1166.408) * (-1164.480) (-1165.099) [-1164.821] (-1164.279) -- 0:00:24
604500 -- (-1171.600) [-1165.645] (-1165.459) (-1165.961) * (-1169.828) (-1163.873) [-1164.238] (-1165.868) -- 0:00:24
605000 -- [-1167.379] (-1164.821) (-1164.618) (-1167.258) * (-1165.818) [-1164.545] (-1168.752) (-1164.099) -- 0:00:24
Average standard deviation of split frequencies: 0.009335
605500 -- [-1164.696] (-1163.869) (-1165.160) (-1165.188) * [-1163.794] (-1165.385) (-1169.831) (-1163.561) -- 0:00:24
606000 -- [-1165.564] (-1166.053) (-1163.765) (-1166.639) * (-1168.433) (-1166.536) (-1167.131) [-1163.861] -- 0:00:24
606500 -- (-1165.042) (-1164.392) [-1164.054] (-1167.650) * (-1167.458) [-1163.745] (-1164.942) (-1164.046) -- 0:00:24
607000 -- [-1164.918] (-1165.079) (-1165.068) (-1164.679) * (-1165.134) (-1169.986) (-1164.221) [-1163.834] -- 0:00:24
607500 -- (-1164.859) (-1165.011) [-1165.039] (-1164.500) * [-1166.734] (-1164.700) (-1166.252) (-1164.115) -- 0:00:24
608000 -- (-1166.724) (-1167.319) (-1165.441) [-1166.433] * [-1166.688] (-1165.161) (-1169.297) (-1164.773) -- 0:00:24
608500 -- [-1166.797] (-1165.973) (-1166.380) (-1168.785) * (-1164.929) (-1167.588) [-1169.983] (-1166.332) -- 0:00:24
609000 -- (-1164.936) (-1164.254) (-1166.746) [-1165.750] * (-1164.396) (-1164.870) (-1167.277) [-1164.534] -- 0:00:24
609500 -- (-1167.393) [-1164.209] (-1164.255) (-1165.911) * (-1164.422) (-1164.161) [-1163.851] (-1164.655) -- 0:00:24
610000 -- (-1164.304) (-1166.196) [-1164.832] (-1164.908) * (-1164.861) (-1164.180) [-1164.874] (-1164.905) -- 0:00:24
Average standard deviation of split frequencies: 0.009309
610500 -- (-1164.286) (-1164.526) (-1164.480) [-1164.849] * [-1172.521] (-1163.495) (-1164.920) (-1166.126) -- 0:00:24
611000 -- [-1165.446] (-1166.587) (-1166.024) (-1164.661) * (-1165.883) [-1166.662] (-1166.676) (-1165.966) -- 0:00:24
611500 -- [-1164.173] (-1170.037) (-1166.824) (-1164.785) * (-1168.520) [-1166.451] (-1168.004) (-1166.455) -- 0:00:24
612000 -- (-1164.256) (-1166.290) (-1167.078) [-1166.710] * (-1165.663) (-1164.660) [-1171.542] (-1167.708) -- 0:00:24
612500 -- [-1165.871] (-1169.387) (-1164.051) (-1163.766) * (-1167.525) [-1168.123] (-1164.484) (-1168.570) -- 0:00:24
613000 -- (-1165.425) (-1164.815) [-1164.211] (-1164.449) * (-1165.257) (-1166.767) [-1166.734] (-1166.764) -- 0:00:23
613500 -- (-1165.866) [-1167.698] (-1164.020) (-1165.359) * (-1167.074) [-1163.955] (-1167.001) (-1166.821) -- 0:00:23
614000 -- (-1166.895) (-1172.831) [-1164.351] (-1163.928) * [-1165.356] (-1169.637) (-1164.805) (-1166.577) -- 0:00:23
614500 -- (-1163.891) (-1166.870) [-1163.825] (-1167.864) * (-1166.321) (-1166.569) (-1167.264) [-1169.979] -- 0:00:23
615000 -- [-1166.095] (-1167.686) (-1164.609) (-1165.755) * (-1164.779) (-1164.851) [-1164.759] (-1166.548) -- 0:00:23
Average standard deviation of split frequencies: 0.009093
615500 -- (-1166.974) [-1168.122] (-1169.771) (-1163.692) * (-1165.223) [-1164.303] (-1166.141) (-1165.375) -- 0:00:23
616000 -- [-1163.663] (-1166.937) (-1168.279) (-1165.657) * (-1168.270) [-1165.339] (-1164.778) (-1165.438) -- 0:00:23
616500 -- [-1163.831] (-1166.086) (-1168.977) (-1166.075) * (-1165.803) (-1166.024) [-1163.691] (-1163.500) -- 0:00:23
617000 -- (-1163.801) (-1165.015) [-1164.516] (-1170.754) * [-1167.346] (-1168.374) (-1170.747) (-1166.953) -- 0:00:23
617500 -- (-1165.755) (-1164.568) (-1165.832) [-1164.271] * (-1164.676) [-1166.674] (-1166.642) (-1165.718) -- 0:00:23
618000 -- (-1163.860) [-1165.211] (-1164.150) (-1164.503) * (-1164.121) [-1164.831] (-1164.037) (-1169.857) -- 0:00:23
618500 -- (-1165.678) (-1165.453) (-1164.465) [-1163.971] * (-1164.935) [-1164.700] (-1163.796) (-1165.464) -- 0:00:23
619000 -- (-1165.978) (-1164.343) [-1164.221] (-1164.324) * (-1165.977) [-1164.547] (-1164.775) (-1165.911) -- 0:00:23
619500 -- [-1164.700] (-1164.803) (-1165.906) (-1167.344) * [-1164.486] (-1165.628) (-1164.710) (-1164.455) -- 0:00:23
620000 -- (-1168.900) (-1163.962) (-1166.446) [-1165.901] * (-1165.837) [-1164.802] (-1164.981) (-1169.990) -- 0:00:23
Average standard deviation of split frequencies: 0.008891
620500 -- (-1166.944) (-1164.048) [-1164.365] (-1164.462) * [-1169.085] (-1166.764) (-1167.928) (-1164.933) -- 0:00:23
621000 -- (-1166.804) (-1163.859) (-1164.841) [-1165.791] * (-1170.004) [-1164.384] (-1167.427) (-1164.317) -- 0:00:23
621500 -- [-1163.791] (-1163.860) (-1164.854) (-1164.361) * (-1165.779) (-1173.932) [-1165.159] (-1168.846) -- 0:00:23
622000 -- (-1164.883) [-1168.684] (-1164.475) (-1169.057) * (-1164.315) [-1170.777] (-1165.777) (-1164.142) -- 0:00:23
622500 -- (-1163.687) (-1166.630) (-1165.100) [-1167.893] * [-1166.624] (-1169.701) (-1169.341) (-1167.570) -- 0:00:23
623000 -- (-1163.427) (-1166.995) (-1165.268) [-1167.428] * (-1163.461) (-1170.290) (-1167.164) [-1164.942] -- 0:00:23
623500 -- (-1164.315) (-1165.994) (-1167.158) [-1164.564] * [-1167.458] (-1164.687) (-1168.477) (-1167.446) -- 0:00:23
624000 -- (-1166.682) (-1171.476) [-1166.559] (-1167.002) * (-1168.622) (-1165.009) (-1165.166) [-1165.947] -- 0:00:23
624500 -- (-1164.068) [-1165.728] (-1167.725) (-1166.862) * [-1164.728] (-1166.602) (-1166.888) (-1164.690) -- 0:00:23
625000 -- (-1164.397) (-1164.892) [-1167.529] (-1164.239) * [-1166.695] (-1167.285) (-1163.947) (-1166.639) -- 0:00:23
Average standard deviation of split frequencies: 0.007907
625500 -- (-1166.563) (-1165.459) [-1164.042] (-1163.853) * (-1164.914) [-1165.820] (-1168.323) (-1164.826) -- 0:00:23
626000 -- (-1163.657) [-1164.180] (-1163.640) (-1165.429) * [-1165.030] (-1169.089) (-1167.871) (-1166.250) -- 0:00:23
626500 -- [-1165.324] (-1164.085) (-1164.718) (-1166.735) * [-1164.393] (-1167.298) (-1172.888) (-1166.363) -- 0:00:23
627000 -- (-1164.356) (-1166.425) [-1163.999] (-1170.117) * [-1165.390] (-1165.497) (-1164.650) (-1165.255) -- 0:00:23
627500 -- (-1168.099) [-1164.739] (-1164.939) (-1167.367) * [-1165.820] (-1164.360) (-1167.443) (-1164.710) -- 0:00:23
628000 -- (-1164.436) (-1166.303) (-1168.991) [-1167.209] * (-1164.496) (-1167.634) [-1170.321] (-1171.013) -- 0:00:23
628500 -- (-1163.654) (-1164.955) (-1167.135) [-1166.027] * [-1164.266] (-1166.592) (-1172.766) (-1165.373) -- 0:00:23
629000 -- (-1164.666) (-1164.201) [-1164.220] (-1164.971) * (-1164.887) [-1165.260] (-1165.764) (-1165.612) -- 0:00:23
629500 -- (-1164.871) (-1164.610) (-1164.592) [-1164.263] * (-1165.267) [-1169.607] (-1165.009) (-1164.418) -- 0:00:22
630000 -- (-1166.224) (-1164.614) (-1168.581) [-1167.530] * [-1164.441] (-1169.379) (-1165.642) (-1165.002) -- 0:00:22
Average standard deviation of split frequencies: 0.008269
630500 -- (-1168.752) (-1164.175) (-1169.634) [-1166.895] * [-1164.394] (-1166.785) (-1166.578) (-1165.081) -- 0:00:22
631000 -- [-1165.573] (-1165.163) (-1165.220) (-1166.631) * (-1164.321) [-1166.362] (-1164.438) (-1164.021) -- 0:00:22
631500 -- (-1165.470) [-1163.569] (-1165.479) (-1167.768) * (-1165.505) (-1165.596) (-1167.096) [-1164.189] -- 0:00:22
632000 -- (-1164.736) (-1164.195) [-1165.498] (-1164.696) * [-1164.651] (-1164.344) (-1168.343) (-1167.153) -- 0:00:22
632500 -- (-1164.413) [-1164.193] (-1164.206) (-1168.812) * (-1166.353) (-1169.095) (-1167.953) [-1164.960] -- 0:00:22
633000 -- (-1166.419) [-1165.116] (-1163.861) (-1165.148) * (-1165.256) (-1168.871) (-1164.386) [-1165.858] -- 0:00:22
633500 -- [-1163.383] (-1165.330) (-1164.819) (-1166.122) * (-1166.578) [-1165.922] (-1163.464) (-1167.707) -- 0:00:22
634000 -- (-1163.756) [-1165.260] (-1164.977) (-1168.211) * (-1165.455) [-1165.959] (-1167.927) (-1163.538) -- 0:00:22
634500 -- (-1163.759) (-1164.870) [-1164.472] (-1167.227) * (-1164.034) [-1168.034] (-1165.187) (-1165.013) -- 0:00:22
635000 -- (-1163.891) [-1165.121] (-1163.821) (-1165.173) * [-1164.067] (-1166.031) (-1168.835) (-1164.621) -- 0:00:22
Average standard deviation of split frequencies: 0.008200
635500 -- [-1164.259] (-1165.333) (-1164.507) (-1167.719) * [-1163.455] (-1164.833) (-1164.683) (-1164.457) -- 0:00:22
636000 -- (-1165.278) (-1163.779) (-1164.929) [-1165.034] * [-1163.876] (-1164.625) (-1165.409) (-1165.993) -- 0:00:22
636500 -- (-1166.632) (-1163.757) [-1165.472] (-1165.134) * [-1166.408] (-1164.645) (-1166.482) (-1169.527) -- 0:00:22
637000 -- (-1163.761) (-1163.792) (-1165.007) [-1163.332] * (-1166.908) (-1165.346) (-1167.902) [-1166.841] -- 0:00:22
637500 -- (-1169.332) [-1163.884] (-1164.772) (-1166.684) * (-1165.154) (-1166.079) [-1165.986] (-1165.079) -- 0:00:22
638000 -- (-1169.755) (-1165.426) [-1163.722] (-1170.256) * [-1165.872] (-1165.123) (-1165.569) (-1164.309) -- 0:00:22
638500 -- (-1165.853) [-1165.775] (-1163.643) (-1165.313) * [-1164.897] (-1163.941) (-1166.562) (-1165.459) -- 0:00:22
639000 -- (-1163.795) [-1168.985] (-1164.573) (-1165.883) * [-1165.106] (-1164.047) (-1165.356) (-1168.261) -- 0:00:22
639500 -- (-1165.291) [-1164.804] (-1166.450) (-1165.200) * [-1165.137] (-1164.028) (-1165.670) (-1168.264) -- 0:00:22
640000 -- [-1164.348] (-1164.303) (-1164.671) (-1171.209) * (-1165.458) (-1165.949) [-1164.739] (-1167.517) -- 0:00:22
Average standard deviation of split frequencies: 0.007542
640500 -- (-1168.551) (-1166.206) [-1164.054] (-1165.931) * (-1167.507) [-1166.730] (-1165.604) (-1166.636) -- 0:00:22
641000 -- (-1164.521) [-1164.241] (-1165.124) (-1166.860) * [-1164.105] (-1165.894) (-1165.543) (-1165.191) -- 0:00:22
641500 -- (-1168.235) (-1165.942) (-1167.162) [-1166.088] * (-1163.729) (-1163.849) [-1168.377] (-1164.072) -- 0:00:22
642000 -- (-1169.117) [-1165.937] (-1167.074) (-1165.239) * [-1165.322] (-1164.405) (-1169.646) (-1164.437) -- 0:00:22
642500 -- (-1167.963) (-1165.895) (-1164.327) [-1163.959] * [-1165.320] (-1169.338) (-1165.553) (-1165.554) -- 0:00:22
643000 -- (-1166.430) (-1167.877) [-1164.294] (-1164.475) * [-1164.726] (-1164.563) (-1164.299) (-1164.871) -- 0:00:22
643500 -- (-1165.594) (-1167.854) (-1165.355) [-1166.650] * (-1164.697) (-1165.215) [-1164.369] (-1165.318) -- 0:00:22
644000 -- (-1164.017) [-1164.353] (-1172.209) (-1166.682) * (-1163.978) (-1165.110) [-1167.460] (-1168.472) -- 0:00:22
644500 -- [-1163.745] (-1164.596) (-1166.958) (-1165.236) * [-1165.325] (-1166.367) (-1166.760) (-1164.053) -- 0:00:22
645000 -- [-1164.553] (-1166.586) (-1165.484) (-1165.054) * (-1169.014) (-1164.879) (-1165.384) [-1163.463] -- 0:00:22
Average standard deviation of split frequencies: 0.007753
645500 -- (-1165.378) [-1165.783] (-1170.540) (-1166.178) * [-1169.030] (-1165.677) (-1167.243) (-1163.650) -- 0:00:21
646000 -- (-1169.242) [-1167.699] (-1166.729) (-1165.191) * (-1169.026) (-1167.838) (-1168.604) [-1163.652] -- 0:00:21
646500 -- [-1165.005] (-1164.201) (-1167.149) (-1170.929) * [-1164.548] (-1171.723) (-1167.227) (-1164.476) -- 0:00:21
647000 -- (-1166.311) [-1164.214] (-1169.066) (-1164.989) * [-1163.319] (-1170.853) (-1166.841) (-1164.742) -- 0:00:21
647500 -- (-1167.930) (-1164.635) [-1164.886] (-1165.725) * (-1166.223) (-1171.316) (-1168.915) [-1164.330] -- 0:00:21
648000 -- (-1166.748) [-1165.431] (-1165.171) (-1166.068) * (-1170.241) [-1165.857] (-1169.235) (-1166.899) -- 0:00:21
648500 -- (-1164.715) (-1166.285) [-1165.140] (-1165.027) * [-1169.099] (-1164.509) (-1165.693) (-1167.371) -- 0:00:21
649000 -- [-1165.213] (-1167.842) (-1164.141) (-1166.425) * (-1169.971) [-1164.302] (-1167.189) (-1170.768) -- 0:00:21
649500 -- (-1166.342) (-1163.730) [-1164.636] (-1166.279) * [-1164.650] (-1165.587) (-1164.917) (-1165.829) -- 0:00:21
650000 -- [-1165.678] (-1170.145) (-1166.311) (-1164.539) * (-1164.982) (-1166.865) (-1165.177) [-1165.423] -- 0:00:21
Average standard deviation of split frequencies: 0.007879
650500 -- (-1164.256) (-1167.819) [-1166.941] (-1171.541) * (-1167.037) (-1166.311) (-1164.523) [-1165.098] -- 0:00:21
651000 -- (-1163.854) [-1172.409] (-1165.923) (-1166.187) * (-1167.538) (-1164.875) [-1163.518] (-1167.173) -- 0:00:21
651500 -- (-1163.874) (-1165.636) [-1165.461] (-1167.761) * (-1166.321) [-1165.236] (-1166.366) (-1168.331) -- 0:00:21
652000 -- [-1164.239] (-1168.258) (-1165.784) (-1166.781) * (-1164.848) (-1168.054) [-1166.967] (-1166.829) -- 0:00:21
652500 -- (-1164.302) (-1167.641) (-1171.042) [-1166.139] * (-1174.650) (-1168.461) (-1164.473) [-1166.338] -- 0:00:21
653000 -- (-1165.115) (-1168.546) [-1165.090] (-1168.066) * [-1163.824] (-1166.149) (-1164.436) (-1166.265) -- 0:00:21
653500 -- (-1166.824) [-1164.176] (-1164.771) (-1164.662) * (-1164.243) [-1167.206] (-1169.347) (-1168.848) -- 0:00:21
654000 -- (-1167.016) (-1165.170) (-1165.074) [-1164.621] * (-1166.057) [-1165.357] (-1165.294) (-1163.556) -- 0:00:21
654500 -- (-1169.333) [-1165.954] (-1168.714) (-1166.941) * [-1166.385] (-1165.710) (-1166.372) (-1165.725) -- 0:00:21
655000 -- (-1165.112) [-1165.081] (-1166.325) (-1165.117) * (-1163.440) (-1167.934) [-1165.502] (-1167.432) -- 0:00:21
Average standard deviation of split frequencies: 0.008084
655500 -- (-1167.751) [-1166.557] (-1165.986) (-1163.680) * (-1167.781) [-1163.735] (-1168.136) (-1168.078) -- 0:00:21
656000 -- (-1168.204) [-1168.708] (-1166.291) (-1165.608) * (-1167.912) [-1164.815] (-1169.513) (-1168.970) -- 0:00:21
656500 -- (-1164.478) [-1167.444] (-1166.964) (-1164.819) * (-1165.386) (-1167.517) (-1165.326) [-1167.562] -- 0:00:21
657000 -- (-1164.471) (-1165.617) (-1168.751) [-1164.963] * [-1163.605] (-1165.428) (-1164.111) (-1166.785) -- 0:00:21
657500 -- (-1165.429) (-1166.913) [-1165.412] (-1164.760) * (-1163.857) (-1167.228) (-1164.011) [-1165.547] -- 0:00:21
658000 -- (-1166.310) (-1163.548) (-1165.655) [-1164.805] * [-1164.649] (-1164.400) (-1164.999) (-1166.171) -- 0:00:21
658500 -- (-1167.309) (-1165.120) (-1168.000) [-1164.616] * (-1166.283) (-1164.882) [-1164.798] (-1164.102) -- 0:00:21
659000 -- (-1165.609) (-1166.373) (-1170.142) [-1165.791] * (-1165.902) (-1166.967) (-1165.683) [-1164.400] -- 0:00:21
659500 -- (-1166.390) (-1164.393) (-1163.565) [-1164.924] * (-1164.576) (-1166.121) [-1165.364] (-1166.158) -- 0:00:21
660000 -- (-1165.937) (-1166.268) (-1163.903) [-1164.564] * (-1165.120) (-1167.629) (-1166.214) [-1164.176] -- 0:00:21
Average standard deviation of split frequencies: 0.007983
660500 -- [-1164.553] (-1164.284) (-1164.453) (-1164.729) * (-1166.120) (-1166.996) [-1166.925] (-1164.620) -- 0:00:21
661000 -- [-1166.202] (-1164.583) (-1167.434) (-1165.243) * (-1167.394) (-1168.888) [-1166.359] (-1164.622) -- 0:00:21
661500 -- [-1163.812] (-1165.206) (-1166.318) (-1166.922) * (-1165.951) (-1164.632) [-1166.800] (-1166.868) -- 0:00:20
662000 -- (-1166.840) (-1164.932) [-1171.825] (-1165.085) * (-1170.682) [-1164.852] (-1169.085) (-1166.785) -- 0:00:20
662500 -- (-1167.006) [-1165.797] (-1165.052) (-1166.836) * [-1165.031] (-1164.859) (-1165.422) (-1169.891) -- 0:00:20
663000 -- (-1171.031) (-1165.031) (-1166.292) [-1164.930] * (-1164.675) [-1163.628] (-1168.899) (-1168.331) -- 0:00:20
663500 -- [-1167.865] (-1164.091) (-1166.255) (-1166.026) * (-1167.651) (-1164.773) (-1166.013) [-1165.277] -- 0:00:20
664000 -- (-1163.773) (-1168.113) [-1168.220] (-1165.707) * (-1166.181) (-1166.239) (-1170.581) [-1166.691] -- 0:00:20
664500 -- (-1163.722) [-1166.013] (-1165.447) (-1166.971) * (-1168.568) [-1165.253] (-1164.784) (-1165.861) -- 0:00:20
665000 -- (-1166.690) (-1166.046) (-1166.909) [-1164.939] * (-1167.985) (-1165.291) [-1164.449] (-1164.792) -- 0:00:20
Average standard deviation of split frequencies: 0.007786
665500 -- [-1164.940] (-1164.891) (-1164.273) (-1163.467) * (-1164.583) (-1167.157) (-1164.480) [-1165.368] -- 0:00:20
666000 -- (-1167.603) (-1164.484) [-1164.326] (-1163.622) * [-1165.766] (-1166.133) (-1165.330) (-1172.170) -- 0:00:20
666500 -- (-1164.545) (-1167.709) [-1164.339] (-1163.364) * (-1163.824) (-1165.884) (-1167.598) [-1164.334] -- 0:00:20
667000 -- (-1164.934) (-1164.476) (-1165.169) [-1164.793] * (-1165.663) (-1163.959) (-1166.677) [-1164.053] -- 0:00:20
667500 -- [-1166.319] (-1164.529) (-1163.966) (-1164.614) * (-1164.724) [-1164.204] (-1165.479) (-1164.550) -- 0:00:20
668000 -- (-1164.321) (-1164.204) (-1163.936) [-1163.988] * [-1167.248] (-1165.897) (-1165.526) (-1165.566) -- 0:00:20
668500 -- [-1165.236] (-1165.279) (-1169.203) (-1164.042) * (-1166.623) (-1167.820) (-1167.636) [-1163.958] -- 0:00:20
669000 -- (-1165.141) [-1165.709] (-1166.378) (-1164.791) * (-1164.568) [-1165.124] (-1166.114) (-1165.754) -- 0:00:20
669500 -- [-1164.930] (-1167.486) (-1164.466) (-1164.903) * (-1167.433) (-1176.608) [-1166.720] (-1166.409) -- 0:00:20
670000 -- (-1163.854) (-1166.507) [-1164.351] (-1164.714) * (-1164.832) (-1166.560) (-1166.874) [-1163.704] -- 0:00:20
Average standard deviation of split frequencies: 0.007468
670500 -- [-1165.928] (-1168.370) (-1166.223) (-1165.461) * [-1164.714] (-1165.023) (-1164.586) (-1165.943) -- 0:00:20
671000 -- (-1168.769) (-1164.765) [-1164.765] (-1164.477) * (-1166.795) [-1170.447] (-1165.574) (-1166.970) -- 0:00:20
671500 -- (-1170.283) (-1164.073) (-1164.524) [-1166.264] * (-1165.376) [-1172.281] (-1165.818) (-1164.424) -- 0:00:20
672000 -- (-1168.476) (-1166.476) [-1163.906] (-1165.165) * (-1168.426) (-1165.197) [-1165.496] (-1168.091) -- 0:00:20
672500 -- [-1164.808] (-1167.042) (-1163.737) (-1166.757) * (-1165.996) (-1167.583) [-1164.217] (-1166.057) -- 0:00:20
673000 -- (-1169.877) (-1165.358) [-1169.401] (-1163.979) * (-1165.673) [-1166.290] (-1166.759) (-1165.916) -- 0:00:20
673500 -- (-1171.390) (-1167.175) (-1169.527) [-1164.573] * (-1164.846) (-1165.439) (-1165.146) [-1164.512] -- 0:00:20
674000 -- (-1170.403) [-1163.470] (-1168.833) (-1164.794) * (-1166.207) [-1164.015] (-1168.221) (-1164.109) -- 0:00:20
674500 -- [-1164.558] (-1165.267) (-1167.178) (-1164.301) * (-1166.988) [-1165.643] (-1164.872) (-1163.989) -- 0:00:20
675000 -- (-1164.510) (-1165.611) [-1164.846] (-1166.381) * [-1166.707] (-1163.647) (-1166.788) (-1166.769) -- 0:00:20
Average standard deviation of split frequencies: 0.007540
675500 -- (-1164.467) (-1169.089) (-1168.293) [-1164.223] * (-1165.260) (-1169.007) (-1166.408) [-1167.528] -- 0:00:20
676000 -- (-1165.123) (-1165.450) [-1167.178] (-1169.291) * (-1170.510) (-1164.206) (-1164.407) [-1166.055] -- 0:00:20
676500 -- (-1163.916) (-1166.268) [-1166.602] (-1165.367) * [-1165.248] (-1164.206) (-1164.910) (-1165.115) -- 0:00:20
677000 -- [-1166.522] (-1166.938) (-1166.087) (-1167.330) * (-1165.857) (-1167.904) [-1164.633] (-1168.264) -- 0:00:20
677500 -- (-1163.934) (-1165.911) [-1168.134] (-1168.845) * (-1165.822) (-1165.925) [-1164.427] (-1167.759) -- 0:00:19
678000 -- (-1165.708) (-1166.106) (-1168.640) [-1164.431] * [-1163.767] (-1166.248) (-1165.264) (-1164.753) -- 0:00:19
678500 -- (-1166.336) [-1168.405] (-1164.622) (-1167.473) * (-1164.597) (-1165.960) [-1164.986] (-1163.618) -- 0:00:19
679000 -- [-1166.660] (-1163.852) (-1163.810) (-1167.676) * (-1165.873) [-1166.114] (-1164.013) (-1163.707) -- 0:00:19
679500 -- (-1166.094) (-1166.556) (-1165.402) [-1170.339] * (-1166.456) (-1165.070) (-1168.911) [-1164.796] -- 0:00:19
680000 -- [-1165.195] (-1165.541) (-1167.253) (-1165.125) * (-1164.991) (-1164.774) [-1169.952] (-1167.683) -- 0:00:19
Average standard deviation of split frequencies: 0.007272
680500 -- (-1165.570) [-1165.904] (-1165.119) (-1166.826) * [-1164.470] (-1164.522) (-1171.926) (-1165.667) -- 0:00:19
681000 -- (-1166.618) (-1163.883) (-1168.189) [-1166.060] * (-1164.683) [-1164.441] (-1170.878) (-1166.202) -- 0:00:19
681500 -- (-1164.786) (-1170.072) (-1165.368) [-1165.715] * (-1164.126) (-1166.095) (-1164.213) [-1166.591] -- 0:00:19
682000 -- [-1166.949] (-1164.028) (-1166.028) (-1166.029) * (-1168.840) (-1166.983) (-1164.606) [-1166.530] -- 0:00:19
682500 -- (-1165.103) (-1164.562) [-1165.341] (-1164.636) * (-1166.256) (-1166.948) [-1165.587] (-1164.399) -- 0:00:19
683000 -- [-1169.733] (-1167.836) (-1164.919) (-1164.419) * (-1165.830) (-1167.764) (-1165.245) [-1165.001] -- 0:00:19
683500 -- (-1166.221) (-1163.857) (-1164.940) [-1167.906] * (-1165.336) [-1166.766] (-1165.138) (-1166.838) -- 0:00:19
684000 -- (-1165.500) [-1164.985] (-1165.566) (-1171.687) * (-1167.077) (-1165.784) [-1165.444] (-1167.030) -- 0:00:19
684500 -- (-1164.981) (-1163.998) [-1167.667] (-1163.666) * (-1165.150) [-1163.919] (-1165.374) (-1164.476) -- 0:00:19
685000 -- (-1167.370) (-1164.434) [-1166.136] (-1166.854) * (-1168.855) [-1165.844] (-1165.732) (-1166.217) -- 0:00:19
Average standard deviation of split frequencies: 0.007731
685500 -- [-1164.434] (-1165.986) (-1167.181) (-1165.914) * (-1163.505) (-1164.700) (-1166.133) [-1165.492] -- 0:00:19
686000 -- (-1165.959) (-1167.585) [-1168.426] (-1163.720) * [-1164.020] (-1165.298) (-1165.083) (-1164.597) -- 0:00:19
686500 -- (-1165.337) [-1166.219] (-1166.122) (-1163.477) * (-1166.781) (-1168.673) [-1165.164] (-1164.965) -- 0:00:19
687000 -- (-1164.573) [-1163.808] (-1166.123) (-1164.557) * (-1167.005) (-1167.495) [-1165.042] (-1169.204) -- 0:00:19
687500 -- (-1166.232) [-1164.268] (-1165.600) (-1163.952) * (-1167.701) (-1167.830) [-1163.726] (-1168.537) -- 0:00:19
688000 -- (-1166.726) (-1166.348) [-1165.129] (-1165.463) * (-1168.669) (-1164.969) (-1166.142) [-1164.415] -- 0:00:19
688500 -- (-1167.213) (-1165.709) [-1164.901] (-1168.410) * [-1164.836] (-1164.627) (-1165.096) (-1166.543) -- 0:00:19
689000 -- [-1165.803] (-1167.276) (-1168.678) (-1165.645) * (-1163.957) [-1163.697] (-1165.757) (-1168.960) -- 0:00:19
689500 -- (-1165.652) [-1165.966] (-1170.784) (-1166.678) * (-1167.126) [-1163.697] (-1163.462) (-1168.948) -- 0:00:19
690000 -- [-1165.122] (-1163.868) (-1168.061) (-1163.875) * [-1167.768] (-1165.136) (-1164.922) (-1167.042) -- 0:00:19
Average standard deviation of split frequencies: 0.007806
690500 -- (-1165.620) [-1164.824] (-1165.087) (-1165.809) * (-1166.544) (-1165.713) (-1163.768) [-1166.808] -- 0:00:19
691000 -- (-1165.929) [-1164.426] (-1165.484) (-1165.672) * (-1165.967) [-1163.593] (-1163.310) (-1166.897) -- 0:00:19
691500 -- (-1164.336) (-1166.167) (-1165.505) [-1165.201] * [-1165.018] (-1166.070) (-1164.569) (-1166.273) -- 0:00:19
692000 -- (-1165.530) [-1165.841] (-1167.243) (-1165.666) * (-1164.048) (-1165.834) (-1164.676) [-1165.613] -- 0:00:19
692500 -- (-1166.098) [-1163.705] (-1166.902) (-1164.803) * (-1164.181) (-1165.532) (-1165.039) [-1166.378] -- 0:00:19
693000 -- [-1166.379] (-1166.584) (-1169.297) (-1164.961) * (-1166.817) [-1165.683] (-1165.137) (-1165.280) -- 0:00:19
693500 -- (-1165.727) (-1170.829) [-1164.349] (-1166.564) * (-1166.197) [-1166.564] (-1169.004) (-1166.349) -- 0:00:19
694000 -- (-1165.275) (-1165.365) [-1164.541] (-1166.054) * (-1166.164) [-1164.767] (-1166.688) (-1166.943) -- 0:00:18
694500 -- (-1164.836) (-1167.076) [-1164.883] (-1170.295) * (-1166.276) (-1169.554) [-1164.113] (-1165.799) -- 0:00:18
695000 -- (-1163.408) [-1166.140] (-1164.849) (-1165.684) * (-1163.818) (-1164.056) [-1163.590] (-1164.795) -- 0:00:18
Average standard deviation of split frequencies: 0.008001
695500 -- (-1164.070) (-1165.605) [-1163.871] (-1166.989) * (-1164.296) (-1166.273) (-1164.584) [-1164.481] -- 0:00:18
696000 -- [-1165.577] (-1170.421) (-1166.821) (-1164.212) * (-1164.308) [-1165.461] (-1169.342) (-1165.483) -- 0:00:18
696500 -- (-1168.711) (-1166.869) [-1165.268] (-1166.632) * [-1163.615] (-1165.281) (-1168.939) (-1166.156) -- 0:00:18
697000 -- (-1165.947) (-1166.439) [-1164.677] (-1164.332) * (-1164.455) (-1164.923) [-1164.172] (-1165.733) -- 0:00:18
697500 -- (-1165.085) [-1165.158] (-1164.646) (-1163.613) * [-1164.734] (-1166.021) (-1166.388) (-1166.014) -- 0:00:18
698000 -- [-1164.713] (-1166.569) (-1164.251) (-1165.581) * [-1164.188] (-1168.810) (-1165.442) (-1164.008) -- 0:00:18
698500 -- [-1167.330] (-1165.493) (-1164.228) (-1163.367) * [-1165.265] (-1166.205) (-1167.852) (-1166.502) -- 0:00:18
699000 -- (-1166.362) (-1165.960) (-1164.160) [-1164.521] * [-1170.362] (-1167.353) (-1163.886) (-1164.495) -- 0:00:18
699500 -- [-1166.048] (-1166.994) (-1165.430) (-1165.113) * (-1170.087) (-1166.016) [-1163.745] (-1164.943) -- 0:00:18
700000 -- (-1163.916) [-1169.232] (-1165.451) (-1163.413) * (-1171.083) (-1164.945) [-1165.678] (-1165.552) -- 0:00:18
Average standard deviation of split frequencies: 0.008158
700500 -- [-1164.316] (-1165.702) (-1167.048) (-1165.809) * (-1168.196) (-1165.838) (-1164.707) [-1163.831] -- 0:00:18
701000 -- (-1169.656) (-1165.483) (-1165.964) [-1164.590] * (-1166.637) [-1163.945] (-1165.760) (-1163.854) -- 0:00:18
701500 -- (-1170.579) (-1165.698) [-1167.695] (-1164.255) * (-1166.070) [-1164.169] (-1167.197) (-1164.396) -- 0:00:18
702000 -- (-1170.952) [-1163.892] (-1167.644) (-1165.225) * (-1168.069) [-1164.444] (-1165.402) (-1165.707) -- 0:00:18
702500 -- (-1167.148) (-1165.159) [-1166.258] (-1165.239) * (-1170.081) (-1166.107) (-1166.566) [-1165.539] -- 0:00:18
703000 -- (-1165.824) (-1164.464) [-1166.579] (-1165.066) * (-1164.952) (-1171.872) (-1166.133) [-1167.404] -- 0:00:18
703500 -- (-1164.469) (-1165.280) (-1167.154) [-1164.354] * [-1167.538] (-1164.803) (-1167.066) (-1165.020) -- 0:00:18
704000 -- (-1166.044) (-1165.955) (-1166.334) [-1165.331] * (-1164.244) (-1166.262) [-1169.855] (-1165.032) -- 0:00:18
704500 -- (-1163.902) [-1166.349] (-1168.740) (-1164.438) * [-1163.908] (-1164.992) (-1166.909) (-1164.454) -- 0:00:18
705000 -- [-1163.902] (-1171.999) (-1166.504) (-1165.669) * (-1164.062) [-1163.843] (-1167.971) (-1166.349) -- 0:00:18
Average standard deviation of split frequencies: 0.008327
705500 -- (-1164.004) (-1165.350) (-1168.124) [-1166.267] * (-1168.838) (-1165.548) (-1165.870) [-1165.069] -- 0:00:18
706000 -- (-1165.426) (-1165.207) [-1168.560] (-1167.168) * (-1165.759) (-1167.758) (-1163.411) [-1165.522] -- 0:00:18
706500 -- (-1163.699) (-1165.509) [-1165.883] (-1163.580) * (-1167.607) (-1167.677) [-1164.981] (-1165.202) -- 0:00:18
707000 -- (-1165.028) [-1164.669] (-1166.888) (-1168.113) * (-1164.477) (-1169.037) (-1166.329) [-1163.873] -- 0:00:18
707500 -- (-1164.943) [-1170.942] (-1169.070) (-1169.161) * (-1164.495) [-1165.421] (-1168.024) (-1165.878) -- 0:00:18
708000 -- (-1163.759) [-1168.366] (-1166.973) (-1169.559) * (-1164.302) (-1167.420) [-1165.666] (-1165.142) -- 0:00:18
708500 -- (-1163.807) (-1166.783) (-1167.372) [-1166.980] * [-1164.473] (-1165.248) (-1166.156) (-1167.354) -- 0:00:18
709000 -- (-1169.376) [-1166.892] (-1167.254) (-1165.432) * (-1164.463) (-1168.675) [-1164.310] (-1165.121) -- 0:00:18
709500 -- [-1165.023] (-1166.267) (-1163.554) (-1166.334) * (-1164.713) (-1172.637) [-1163.968] (-1165.472) -- 0:00:18
710000 -- (-1167.705) (-1166.843) (-1168.688) [-1164.310] * (-1165.089) (-1166.415) (-1164.228) [-1164.776] -- 0:00:17
Average standard deviation of split frequencies: 0.008001
710500 -- [-1164.746] (-1164.709) (-1167.342) (-1165.764) * (-1168.634) (-1166.516) [-1169.065] (-1163.345) -- 0:00:17
711000 -- [-1164.829] (-1165.743) (-1166.491) (-1165.620) * (-1165.880) [-1168.654] (-1164.838) (-1166.821) -- 0:00:17
711500 -- (-1166.792) (-1164.025) [-1166.828] (-1165.873) * (-1165.606) (-1164.128) (-1164.540) [-1165.358] -- 0:00:17
712000 -- (-1166.786) (-1164.488) (-1165.416) [-1165.615] * [-1167.032] (-1165.855) (-1165.415) (-1166.223) -- 0:00:17
712500 -- (-1170.375) (-1165.520) [-1164.600] (-1166.990) * [-1165.691] (-1165.432) (-1169.275) (-1164.789) -- 0:00:17
713000 -- [-1164.804] (-1164.818) (-1167.277) (-1166.673) * [-1163.910] (-1165.324) (-1165.507) (-1164.789) -- 0:00:17
713500 -- (-1165.227) (-1163.445) [-1163.996] (-1167.065) * (-1163.657) (-1164.518) (-1169.351) [-1167.005] -- 0:00:17
714000 -- (-1164.702) (-1167.560) [-1163.493] (-1167.199) * (-1165.284) (-1163.893) [-1166.068] (-1167.621) -- 0:00:17
714500 -- (-1166.672) (-1165.812) (-1164.969) [-1166.808] * (-1167.801) (-1167.889) [-1163.887] (-1167.745) -- 0:00:17
715000 -- (-1163.735) (-1163.910) [-1165.496] (-1167.366) * (-1166.330) (-1168.390) [-1165.208] (-1172.214) -- 0:00:17
Average standard deviation of split frequencies: 0.008394
715500 -- (-1164.418) [-1165.124] (-1168.029) (-1164.633) * [-1164.294] (-1165.698) (-1164.011) (-1171.760) -- 0:00:17
716000 -- (-1164.982) (-1164.314) [-1164.344] (-1164.506) * (-1163.942) (-1168.062) [-1167.147] (-1168.784) -- 0:00:17
716500 -- (-1165.973) [-1166.510] (-1163.865) (-1165.026) * [-1164.872] (-1164.760) (-1163.743) (-1163.879) -- 0:00:17
717000 -- [-1164.102] (-1164.634) (-1164.679) (-1165.170) * [-1165.360] (-1168.813) (-1163.566) (-1165.972) -- 0:00:17
717500 -- (-1164.020) (-1166.811) [-1163.715] (-1168.992) * (-1164.597) [-1166.920] (-1164.216) (-1165.976) -- 0:00:17
718000 -- (-1164.865) (-1164.312) [-1165.214] (-1168.304) * (-1169.296) [-1164.028] (-1164.446) (-1165.295) -- 0:00:17
718500 -- (-1168.253) (-1163.791) [-1164.599] (-1163.962) * (-1163.420) (-1165.524) [-1164.441] (-1165.295) -- 0:00:17
719000 -- (-1164.443) (-1164.164) [-1166.306] (-1163.936) * [-1163.459] (-1165.791) (-1164.908) (-1165.341) -- 0:00:17
719500 -- [-1164.375] (-1163.970) (-1166.573) (-1167.538) * [-1166.738] (-1164.305) (-1165.546) (-1164.086) -- 0:00:17
720000 -- [-1164.168] (-1164.244) (-1166.959) (-1167.538) * (-1166.080) (-1164.377) [-1164.556] (-1163.577) -- 0:00:17
Average standard deviation of split frequencies: 0.008463
720500 -- (-1166.323) (-1164.802) (-1165.503) [-1167.643] * (-1166.074) (-1167.064) [-1164.020] (-1165.133) -- 0:00:17
721000 -- [-1168.305] (-1167.659) (-1165.023) (-1164.156) * (-1171.077) [-1164.826] (-1166.116) (-1164.591) -- 0:00:17
721500 -- [-1168.448] (-1165.957) (-1166.636) (-1166.914) * (-1169.053) (-1166.301) (-1167.348) [-1165.774] -- 0:00:17
722000 -- (-1164.969) (-1165.317) [-1167.242] (-1166.410) * [-1165.120] (-1165.057) (-1167.089) (-1165.788) -- 0:00:17
722500 -- (-1165.874) [-1164.095] (-1168.953) (-1165.378) * (-1167.137) [-1166.279] (-1168.550) (-1169.190) -- 0:00:17
723000 -- [-1167.235] (-1165.213) (-1164.333) (-1166.152) * (-1166.375) (-1164.850) [-1168.942] (-1172.724) -- 0:00:17
723500 -- (-1164.610) (-1168.829) [-1164.997] (-1165.984) * (-1166.527) [-1164.112] (-1166.771) (-1163.952) -- 0:00:17
724000 -- (-1167.186) (-1164.800) [-1164.482] (-1164.730) * [-1169.551] (-1167.611) (-1167.837) (-1167.956) -- 0:00:17
724500 -- (-1165.441) [-1164.757] (-1165.810) (-1168.061) * [-1169.047] (-1170.861) (-1171.855) (-1166.891) -- 0:00:17
725000 -- (-1173.175) [-1165.786] (-1165.591) (-1167.003) * (-1166.883) (-1171.851) (-1167.932) [-1164.986] -- 0:00:17
Average standard deviation of split frequencies: 0.008360
725500 -- (-1165.055) [-1166.801] (-1163.857) (-1167.053) * (-1169.116) (-1167.026) [-1172.178] (-1166.936) -- 0:00:17
726000 -- (-1164.834) (-1163.740) [-1169.416] (-1166.168) * (-1164.309) [-1165.168] (-1166.713) (-1170.452) -- 0:00:16
726500 -- (-1163.580) (-1164.886) [-1163.665] (-1165.537) * [-1165.363] (-1166.956) (-1165.833) (-1169.202) -- 0:00:16
727000 -- (-1166.063) [-1164.656] (-1165.131) (-1164.385) * (-1169.221) (-1166.910) (-1165.537) [-1165.191] -- 0:00:16
727500 -- (-1165.799) [-1164.179] (-1164.492) (-1164.606) * (-1167.461) (-1168.246) (-1166.082) [-1163.905] -- 0:00:16
728000 -- (-1167.799) (-1165.988) [-1169.352] (-1166.220) * (-1166.046) (-1165.084) [-1165.292] (-1169.596) -- 0:00:16
728500 -- [-1166.121] (-1164.800) (-1167.556) (-1168.363) * (-1170.669) (-1165.398) [-1164.803] (-1165.381) -- 0:00:16
729000 -- (-1165.200) (-1169.234) [-1168.018] (-1165.761) * (-1165.643) [-1165.586] (-1168.279) (-1165.581) -- 0:00:16
729500 -- (-1164.944) (-1167.899) (-1171.943) [-1165.973] * [-1165.528] (-1166.286) (-1168.059) (-1165.137) -- 0:00:16
730000 -- (-1166.746) (-1164.867) [-1165.174] (-1163.620) * (-1165.946) (-1164.935) [-1164.595] (-1166.787) -- 0:00:16
Average standard deviation of split frequencies: 0.008549
730500 -- [-1165.135] (-1168.326) (-1164.872) (-1168.480) * (-1170.354) [-1165.480] (-1165.828) (-1164.292) -- 0:00:16
731000 -- [-1164.885] (-1170.915) (-1164.859) (-1171.077) * [-1165.321] (-1166.481) (-1164.720) (-1164.537) -- 0:00:16
731500 -- (-1166.116) [-1164.201] (-1166.264) (-1174.017) * (-1165.488) (-1166.078) (-1164.785) [-1164.625] -- 0:00:16
732000 -- (-1164.311) [-1163.863] (-1166.401) (-1168.463) * (-1165.189) [-1164.735] (-1165.601) (-1165.343) -- 0:00:16
732500 -- [-1164.619] (-1166.923) (-1167.716) (-1169.097) * [-1167.284] (-1164.885) (-1164.782) (-1164.284) -- 0:00:16
733000 -- [-1165.941] (-1167.470) (-1165.696) (-1165.552) * (-1166.068) (-1164.881) [-1164.637] (-1165.149) -- 0:00:16
733500 -- (-1170.124) (-1165.450) [-1166.483] (-1164.402) * (-1164.584) (-1165.026) (-1164.280) [-1164.250] -- 0:00:16
734000 -- (-1166.106) (-1169.820) [-1167.550] (-1165.200) * [-1164.740] (-1165.824) (-1163.786) (-1167.018) -- 0:00:16
734500 -- (-1165.049) (-1165.980) [-1166.710] (-1166.597) * (-1166.481) (-1165.828) [-1163.787] (-1164.295) -- 0:00:16
735000 -- [-1165.766] (-1164.185) (-1166.485) (-1165.130) * (-1166.545) [-1165.741] (-1168.722) (-1165.714) -- 0:00:16
Average standard deviation of split frequencies: 0.008246
735500 -- (-1165.949) [-1165.248] (-1166.366) (-1163.894) * (-1165.031) (-1165.736) (-1168.092) [-1165.243] -- 0:00:16
736000 -- [-1165.862] (-1163.647) (-1165.289) (-1164.929) * (-1168.696) [-1163.632] (-1164.019) (-1165.588) -- 0:00:16
736500 -- (-1164.252) (-1166.236) (-1164.919) [-1165.024] * (-1165.141) [-1164.164] (-1167.051) (-1163.836) -- 0:00:16
737000 -- [-1165.939] (-1166.169) (-1164.990) (-1165.960) * (-1165.969) [-1164.991] (-1164.966) (-1167.152) -- 0:00:16
737500 -- [-1163.720] (-1165.898) (-1163.912) (-1164.493) * [-1164.372] (-1164.061) (-1164.298) (-1166.959) -- 0:00:16
738000 -- (-1164.249) (-1164.217) [-1165.737] (-1168.120) * (-1165.486) (-1172.841) [-1167.263] (-1166.277) -- 0:00:16
738500 -- (-1163.332) (-1166.001) [-1164.882] (-1166.587) * (-1168.284) [-1167.783] (-1164.637) (-1164.544) -- 0:00:16
739000 -- (-1163.876) [-1164.588] (-1166.355) (-1167.276) * (-1167.159) (-1165.846) [-1165.981] (-1165.979) -- 0:00:16
739500 -- (-1164.549) [-1164.137] (-1164.994) (-1171.058) * [-1164.738] (-1163.811) (-1165.511) (-1163.884) -- 0:00:16
740000 -- [-1164.287] (-1167.925) (-1165.601) (-1164.688) * [-1165.469] (-1164.103) (-1173.555) (-1166.996) -- 0:00:16
Average standard deviation of split frequencies: 0.008314
740500 -- [-1164.262] (-1165.873) (-1171.172) (-1164.575) * (-1165.286) [-1166.723] (-1173.490) (-1167.182) -- 0:00:16
741000 -- (-1163.656) [-1166.027] (-1165.671) (-1167.447) * (-1170.983) [-1167.635] (-1169.606) (-1166.031) -- 0:00:16
741500 -- (-1168.914) [-1168.724] (-1164.687) (-1167.187) * (-1166.052) [-1164.363] (-1169.085) (-1165.627) -- 0:00:16
742000 -- (-1165.734) (-1163.909) [-1165.789] (-1164.260) * (-1164.803) (-1165.116) (-1166.949) [-1163.409] -- 0:00:15
742500 -- (-1164.368) [-1164.673] (-1163.829) (-1164.502) * [-1164.698] (-1164.252) (-1166.968) (-1166.268) -- 0:00:15
743000 -- (-1166.599) [-1163.694] (-1165.199) (-1164.365) * (-1164.094) (-1164.106) (-1168.964) [-1166.522] -- 0:00:15
743500 -- (-1164.002) [-1164.936] (-1166.553) (-1166.267) * [-1163.700] (-1167.366) (-1170.569) (-1167.454) -- 0:00:15
744000 -- (-1166.877) [-1163.614] (-1166.768) (-1165.790) * [-1164.519] (-1166.609) (-1168.038) (-1167.153) -- 0:00:15
744500 -- (-1164.562) (-1163.730) [-1165.449] (-1165.603) * [-1164.877] (-1165.412) (-1169.447) (-1165.652) -- 0:00:15
745000 -- (-1164.306) (-1167.287) (-1168.482) [-1164.286] * [-1164.647] (-1164.698) (-1164.192) (-1164.218) -- 0:00:15
Average standard deviation of split frequencies: 0.008810
745500 -- (-1169.463) [-1167.155] (-1165.517) (-1163.925) * (-1165.203) (-1164.450) (-1165.456) [-1165.262] -- 0:00:15
746000 -- (-1167.229) [-1165.897] (-1164.408) (-1164.735) * [-1165.954] (-1165.233) (-1166.836) (-1166.072) -- 0:00:15
746500 -- (-1167.598) (-1170.510) [-1166.280] (-1169.290) * (-1176.188) [-1163.477] (-1163.837) (-1164.777) -- 0:00:15
747000 -- [-1164.680] (-1164.698) (-1164.533) (-1167.833) * (-1172.264) (-1164.805) [-1164.994] (-1167.278) -- 0:00:15
747500 -- (-1165.883) [-1165.322] (-1165.359) (-1164.592) * (-1170.327) (-1164.156) [-1165.828] (-1164.488) -- 0:00:15
748000 -- (-1164.946) (-1165.981) (-1165.301) [-1164.151] * [-1169.970] (-1164.700) (-1163.650) (-1165.000) -- 0:00:15
748500 -- (-1166.713) [-1167.595] (-1165.379) (-1167.043) * (-1166.376) (-1165.429) (-1166.795) [-1166.721] -- 0:00:15
749000 -- (-1164.411) [-1168.404] (-1167.717) (-1167.610) * (-1165.208) [-1165.331] (-1165.838) (-1165.267) -- 0:00:15
749500 -- (-1166.201) (-1166.605) [-1168.801] (-1165.130) * (-1174.269) (-1166.593) (-1165.638) [-1164.932] -- 0:00:15
750000 -- (-1169.962) (-1165.395) (-1166.688) [-1167.790] * [-1165.617] (-1166.085) (-1165.908) (-1164.549) -- 0:00:15
Average standard deviation of split frequencies: 0.008125
750500 -- (-1167.694) (-1165.654) [-1165.397] (-1163.628) * [-1165.069] (-1165.115) (-1167.810) (-1169.796) -- 0:00:15
751000 -- (-1168.532) (-1164.631) [-1164.670] (-1165.646) * (-1163.314) [-1165.297] (-1164.380) (-1165.693) -- 0:00:15
751500 -- [-1165.581] (-1164.008) (-1165.142) (-1165.720) * (-1166.364) (-1165.784) (-1164.947) [-1164.763] -- 0:00:15
752000 -- (-1166.247) [-1164.209] (-1166.052) (-1169.147) * (-1164.532) (-1165.902) [-1167.843] (-1165.335) -- 0:00:15
752500 -- (-1166.842) (-1167.517) [-1164.309] (-1164.394) * (-1167.132) (-1165.891) (-1167.261) [-1164.342] -- 0:00:15
753000 -- (-1166.832) (-1164.459) [-1165.456] (-1171.062) * (-1164.480) (-1164.552) [-1165.823] (-1166.544) -- 0:00:15
753500 -- [-1166.703] (-1163.811) (-1173.222) (-1172.095) * (-1167.985) (-1165.310) [-1163.700] (-1167.186) -- 0:00:15
754000 -- (-1164.250) [-1163.835] (-1172.696) (-1168.997) * [-1164.004] (-1172.304) (-1163.777) (-1166.118) -- 0:00:15
754500 -- (-1164.122) (-1164.867) [-1167.493] (-1169.164) * (-1165.889) (-1169.764) [-1164.111] (-1165.236) -- 0:00:15
755000 -- [-1163.794] (-1166.400) (-1165.448) (-1164.224) * (-1165.894) (-1166.532) (-1165.557) [-1165.056] -- 0:00:15
Average standard deviation of split frequencies: 0.009133
755500 -- (-1166.160) (-1165.717) [-1164.999] (-1167.048) * (-1168.185) [-1165.267] (-1165.896) (-1164.053) -- 0:00:15
756000 -- (-1165.611) (-1169.193) [-1164.762] (-1165.484) * (-1166.676) [-1165.270] (-1168.177) (-1168.139) -- 0:00:15
756500 -- (-1165.622) [-1168.507] (-1164.985) (-1168.052) * (-1166.386) (-1163.716) (-1166.965) [-1164.247] -- 0:00:15
757000 -- (-1166.221) (-1165.954) [-1166.066] (-1165.259) * (-1166.692) (-1165.204) (-1167.484) [-1164.156] -- 0:00:15
757500 -- (-1163.617) (-1165.636) [-1168.805] (-1166.291) * (-1165.059) [-1166.661] (-1164.708) (-1164.962) -- 0:00:15
758000 -- (-1166.825) (-1165.839) [-1166.697] (-1165.067) * [-1164.940] (-1164.028) (-1163.981) (-1165.926) -- 0:00:15
758500 -- (-1166.857) (-1165.477) [-1164.797] (-1163.711) * (-1164.530) [-1164.605] (-1164.147) (-1168.375) -- 0:00:14
759000 -- (-1166.469) (-1166.763) [-1164.672] (-1164.560) * [-1164.398] (-1164.254) (-1164.259) (-1168.554) -- 0:00:14
759500 -- (-1165.194) (-1171.140) (-1164.855) [-1164.747] * [-1165.088] (-1167.024) (-1165.311) (-1164.631) -- 0:00:14
760000 -- (-1164.128) [-1164.115] (-1163.704) (-1164.461) * (-1167.705) (-1165.481) [-1164.056] (-1163.827) -- 0:00:14
Average standard deviation of split frequencies: 0.008822
760500 -- (-1165.994) [-1165.759] (-1166.068) (-1166.954) * [-1164.064] (-1165.366) (-1163.968) (-1164.524) -- 0:00:14
761000 -- [-1165.515] (-1165.264) (-1164.831) (-1163.986) * (-1165.346) [-1163.976] (-1165.182) (-1163.834) -- 0:00:14
761500 -- (-1164.704) [-1165.273] (-1166.502) (-1165.377) * (-1165.042) [-1163.884] (-1164.951) (-1163.834) -- 0:00:14
762000 -- (-1164.883) [-1167.328] (-1167.354) (-1165.415) * [-1166.373] (-1165.380) (-1166.432) (-1163.549) -- 0:00:14
762500 -- (-1169.657) (-1166.096) (-1168.640) [-1165.418] * (-1168.066) (-1165.277) [-1166.436] (-1163.567) -- 0:00:14
763000 -- [-1164.112] (-1164.978) (-1171.647) (-1163.453) * [-1168.158] (-1166.163) (-1171.514) (-1166.908) -- 0:00:14
763500 -- (-1168.270) [-1165.569] (-1171.010) (-1169.043) * (-1164.289) (-1166.845) [-1164.223] (-1166.464) -- 0:00:14
764000 -- (-1164.221) (-1165.184) (-1170.949) [-1164.897] * (-1164.388) (-1164.990) (-1165.749) [-1167.676] -- 0:00:14
764500 -- [-1165.648] (-1165.010) (-1169.677) (-1164.423) * (-1167.804) (-1165.345) [-1164.713] (-1166.175) -- 0:00:14
765000 -- (-1164.956) (-1163.650) [-1169.816] (-1167.302) * (-1163.974) (-1165.768) [-1165.249] (-1166.424) -- 0:00:14
Average standard deviation of split frequencies: 0.008724
765500 -- [-1165.729] (-1164.509) (-1165.570) (-1165.165) * (-1164.849) [-1165.904] (-1168.731) (-1166.486) -- 0:00:14
766000 -- (-1169.614) [-1164.697] (-1164.579) (-1164.740) * [-1164.777] (-1164.726) (-1170.949) (-1164.675) -- 0:00:14
766500 -- (-1165.444) (-1163.922) [-1165.301] (-1166.037) * (-1166.002) (-1164.250) [-1164.656] (-1167.480) -- 0:00:14
767000 -- (-1164.708) [-1164.505] (-1165.521) (-1165.778) * (-1168.964) [-1164.821] (-1165.059) (-1170.886) -- 0:00:14
767500 -- [-1165.743] (-1163.880) (-1164.262) (-1165.081) * (-1165.299) [-1165.235] (-1165.980) (-1164.314) -- 0:00:14
768000 -- (-1163.393) [-1163.953] (-1165.767) (-1165.249) * (-1163.801) (-1171.157) (-1167.030) [-1169.000] -- 0:00:14
768500 -- (-1163.440) [-1169.759] (-1166.511) (-1163.891) * (-1167.392) [-1167.935] (-1165.621) (-1166.658) -- 0:00:14
769000 -- [-1163.852] (-1166.778) (-1166.575) (-1163.970) * (-1168.886) [-1164.136] (-1166.850) (-1170.105) -- 0:00:14
769500 -- (-1163.766) (-1164.950) (-1164.940) [-1163.472] * (-1165.504) (-1166.508) (-1165.032) [-1169.119] -- 0:00:14
770000 -- (-1164.602) (-1172.309) (-1166.297) [-1163.539] * (-1163.333) (-1164.857) [-1166.214] (-1168.368) -- 0:00:14
Average standard deviation of split frequencies: 0.008815
770500 -- (-1167.373) [-1166.043] (-1165.795) (-1166.636) * (-1163.747) (-1165.496) [-1164.469] (-1166.675) -- 0:00:14
771000 -- [-1166.244] (-1168.253) (-1167.432) (-1167.900) * (-1163.799) (-1165.647) [-1168.745] (-1164.643) -- 0:00:14
771500 -- (-1165.580) (-1166.102) [-1165.806] (-1166.191) * (-1165.913) (-1167.239) [-1165.544] (-1168.586) -- 0:00:14
772000 -- [-1167.254] (-1166.769) (-1166.403) (-1170.899) * (-1167.703) (-1164.689) [-1169.962] (-1166.297) -- 0:00:14
772500 -- [-1165.487] (-1167.029) (-1164.597) (-1166.792) * (-1168.150) (-1165.416) [-1166.301] (-1164.899) -- 0:00:14
773000 -- [-1165.349] (-1164.037) (-1164.847) (-1164.704) * (-1164.221) (-1165.886) [-1165.629] (-1164.727) -- 0:00:14
773500 -- (-1165.761) [-1164.023] (-1165.026) (-1166.488) * (-1165.661) (-1165.062) (-1166.817) [-1166.646] -- 0:00:14
774000 -- (-1164.083) (-1164.337) (-1168.289) [-1165.045] * (-1170.121) (-1165.949) (-1168.310) [-1163.791] -- 0:00:14
774500 -- (-1164.407) (-1163.976) (-1166.518) [-1166.894] * (-1164.143) [-1164.422] (-1166.370) (-1165.410) -- 0:00:13
775000 -- (-1166.090) (-1166.810) (-1172.311) [-1166.937] * (-1166.931) [-1164.387] (-1167.182) (-1166.144) -- 0:00:13
Average standard deviation of split frequencies: 0.008540
775500 -- [-1164.010] (-1168.847) (-1173.275) (-1170.095) * [-1168.111] (-1164.540) (-1170.380) (-1165.299) -- 0:00:13
776000 -- [-1164.711] (-1170.916) (-1170.771) (-1169.815) * (-1166.263) (-1164.914) (-1166.695) [-1166.270] -- 0:00:13
776500 -- (-1165.698) (-1164.754) [-1167.600] (-1167.954) * (-1165.807) (-1167.231) [-1165.688] (-1166.353) -- 0:00:13
777000 -- (-1165.672) (-1165.562) (-1165.945) [-1169.833] * (-1164.689) [-1167.213] (-1165.861) (-1164.287) -- 0:00:13
777500 -- (-1166.565) [-1167.510] (-1163.610) (-1167.337) * [-1165.547] (-1165.507) (-1164.157) (-1164.505) -- 0:00:13
778000 -- [-1164.239] (-1166.198) (-1165.202) (-1165.358) * [-1164.233] (-1167.138) (-1166.595) (-1172.169) -- 0:00:13
778500 -- (-1165.618) [-1166.039] (-1166.685) (-1166.264) * (-1164.524) [-1165.319] (-1164.259) (-1171.571) -- 0:00:13
779000 -- (-1163.551) (-1166.469) [-1167.423] (-1170.325) * [-1164.565] (-1167.968) (-1164.611) (-1167.251) -- 0:00:13
779500 -- (-1165.377) (-1166.210) (-1171.436) [-1168.537] * (-1164.648) (-1168.252) [-1167.461] (-1164.975) -- 0:00:13
780000 -- (-1165.835) [-1164.661] (-1167.771) (-1164.465) * [-1164.063] (-1168.214) (-1165.835) (-1167.710) -- 0:00:13
Average standard deviation of split frequencies: 0.008560
780500 -- (-1165.232) [-1165.009] (-1164.942) (-1165.405) * [-1165.226] (-1164.936) (-1165.232) (-1166.302) -- 0:00:13
781000 -- (-1165.449) [-1164.813] (-1164.190) (-1164.400) * [-1164.915] (-1165.302) (-1170.348) (-1170.048) -- 0:00:13
781500 -- (-1165.169) [-1167.136] (-1164.683) (-1164.305) * (-1164.920) (-1164.604) [-1164.453] (-1163.269) -- 0:00:13
782000 -- (-1165.670) (-1167.138) (-1168.243) [-1166.107] * (-1166.925) (-1164.426) (-1163.302) [-1166.654] -- 0:00:13
782500 -- [-1166.211] (-1166.048) (-1163.542) (-1166.302) * (-1166.389) (-1164.988) (-1163.899) [-1164.689] -- 0:00:13
783000 -- (-1164.923) (-1165.235) (-1163.333) [-1165.042] * (-1165.401) [-1164.775] (-1164.696) (-1164.698) -- 0:00:13
783500 -- (-1166.320) (-1164.510) [-1164.773] (-1166.259) * (-1166.548) [-1166.716] (-1164.083) (-1166.153) -- 0:00:13
784000 -- [-1167.307] (-1167.413) (-1165.314) (-1165.279) * (-1165.298) (-1166.724) [-1163.556] (-1165.164) -- 0:00:13
784500 -- (-1164.599) (-1164.708) [-1164.991] (-1165.355) * (-1165.063) (-1166.249) (-1163.556) [-1170.075] -- 0:00:13
785000 -- (-1165.209) [-1166.046] (-1165.867) (-1165.924) * (-1166.515) (-1165.649) [-1163.959] (-1168.693) -- 0:00:13
Average standard deviation of split frequencies: 0.008608
785500 -- (-1167.286) [-1164.578] (-1165.987) (-1163.624) * (-1168.663) (-1166.250) [-1164.642] (-1166.619) -- 0:00:13
786000 -- (-1165.413) (-1169.334) [-1168.781] (-1167.995) * (-1164.500) (-1164.486) [-1165.627] (-1167.523) -- 0:00:13
786500 -- [-1167.366] (-1166.369) (-1165.084) (-1165.564) * (-1164.682) (-1164.939) (-1164.618) [-1166.030] -- 0:00:13
787000 -- (-1164.409) [-1167.986] (-1167.817) (-1163.252) * (-1163.671) (-1164.682) [-1169.120] (-1166.075) -- 0:00:13
787500 -- [-1165.024] (-1168.143) (-1167.546) (-1167.083) * (-1164.374) (-1166.039) (-1164.137) [-1165.715] -- 0:00:13
788000 -- (-1169.235) (-1167.030) (-1165.056) [-1167.020] * (-1170.583) (-1166.193) (-1164.295) [-1164.139] -- 0:00:13
788500 -- (-1164.979) [-1163.624] (-1168.031) (-1170.211) * (-1168.100) (-1165.345) [-1164.236] (-1170.035) -- 0:00:13
789000 -- (-1165.046) (-1164.699) [-1164.477] (-1170.268) * (-1167.511) (-1166.467) [-1167.969] (-1166.786) -- 0:00:13
789500 -- [-1165.094] (-1165.093) (-1165.878) (-1168.391) * (-1164.591) (-1166.363) (-1168.976) [-1164.310] -- 0:00:13
790000 -- (-1163.720) (-1163.997) (-1165.012) [-1167.468] * [-1163.946] (-1170.104) (-1169.315) (-1164.112) -- 0:00:13
Average standard deviation of split frequencies: 0.008628
790500 -- (-1166.121) (-1164.611) (-1165.444) [-1167.140] * (-1166.169) [-1164.930] (-1172.502) (-1163.961) -- 0:00:12
791000 -- (-1164.697) (-1165.496) (-1163.776) [-1166.717] * [-1168.603] (-1166.212) (-1170.346) (-1164.124) -- 0:00:12
791500 -- (-1164.435) [-1164.568] (-1164.098) (-1165.981) * (-1168.204) [-1166.776] (-1166.558) (-1168.073) -- 0:00:12
792000 -- (-1168.340) [-1169.428] (-1165.919) (-1163.379) * (-1168.080) (-1164.968) [-1167.289] (-1167.931) -- 0:00:12
792500 -- (-1166.331) (-1174.553) [-1166.524] (-1165.277) * [-1164.990] (-1164.710) (-1165.590) (-1166.771) -- 0:00:12
793000 -- (-1166.179) (-1165.308) (-1166.266) [-1164.300] * (-1165.788) (-1164.009) (-1167.724) [-1165.980] -- 0:00:12
793500 -- (-1167.258) [-1168.098] (-1164.031) (-1166.646) * (-1165.002) (-1164.010) [-1163.441] (-1164.461) -- 0:00:12
794000 -- (-1166.191) [-1166.295] (-1164.497) (-1166.495) * (-1166.070) [-1164.707] (-1167.614) (-1172.381) -- 0:00:12
794500 -- [-1164.388] (-1167.554) (-1164.745) (-1166.106) * (-1167.171) (-1163.582) [-1165.618] (-1164.251) -- 0:00:12
795000 -- [-1166.678] (-1167.735) (-1164.474) (-1166.966) * (-1164.387) (-1165.670) (-1163.793) [-1167.483] -- 0:00:12
Average standard deviation of split frequencies: 0.009092
795500 -- (-1170.527) (-1164.787) (-1167.635) [-1165.442] * [-1163.729] (-1166.340) (-1164.552) (-1165.771) -- 0:00:12
796000 -- (-1165.416) [-1165.535] (-1168.010) (-1166.655) * (-1167.869) (-1168.155) [-1164.432] (-1164.609) -- 0:00:12
796500 -- (-1166.795) (-1164.804) [-1165.475] (-1166.001) * (-1166.882) [-1163.996] (-1166.522) (-1167.656) -- 0:00:12
797000 -- (-1163.975) (-1165.670) [-1164.638] (-1165.526) * (-1164.142) [-1165.661] (-1165.542) (-1171.806) -- 0:00:12
797500 -- (-1164.235) [-1167.094] (-1166.893) (-1165.498) * [-1163.716] (-1164.349) (-1166.713) (-1167.689) -- 0:00:12
798000 -- (-1168.815) (-1170.164) [-1165.180] (-1165.333) * (-1166.388) (-1166.594) (-1167.370) [-1170.203] -- 0:00:12
798500 -- [-1166.373] (-1167.234) (-1164.518) (-1166.149) * [-1164.257] (-1171.927) (-1165.956) (-1168.574) -- 0:00:12
799000 -- [-1165.095] (-1172.405) (-1168.233) (-1165.704) * (-1166.236) [-1165.527] (-1166.393) (-1166.643) -- 0:00:12
799500 -- (-1167.782) (-1166.444) [-1167.807] (-1167.903) * (-1168.392) (-1168.762) [-1163.785] (-1166.392) -- 0:00:12
800000 -- (-1163.625) (-1165.105) [-1170.470] (-1166.709) * [-1163.924] (-1167.991) (-1165.451) (-1164.178) -- 0:00:12
Average standard deviation of split frequencies: 0.008500
800500 -- (-1163.697) (-1165.005) (-1166.336) [-1165.740] * (-1164.327) (-1165.517) (-1171.577) [-1163.681] -- 0:00:12
801000 -- (-1163.594) [-1168.591] (-1165.729) (-1164.940) * (-1169.519) [-1163.971] (-1164.876) (-1169.431) -- 0:00:12
801500 -- (-1164.616) (-1167.989) (-1166.035) [-1166.226] * [-1165.921] (-1163.201) (-1164.295) (-1168.786) -- 0:00:12
802000 -- (-1164.261) [-1165.008] (-1169.686) (-1165.137) * (-1165.430) (-1164.875) [-1164.293] (-1164.437) -- 0:00:12
802500 -- [-1163.937] (-1166.243) (-1167.467) (-1165.285) * (-1169.984) (-1164.451) (-1166.969) [-1165.631] -- 0:00:12
803000 -- (-1166.575) [-1167.708] (-1166.658) (-1165.423) * (-1165.761) [-1164.108] (-1169.379) (-1166.076) -- 0:00:12
803500 -- (-1165.942) (-1165.000) (-1164.103) [-1164.802] * (-1167.671) (-1166.557) [-1166.964] (-1164.783) -- 0:00:12
804000 -- (-1164.735) (-1166.840) [-1163.335] (-1165.124) * (-1167.095) [-1165.298] (-1166.529) (-1164.034) -- 0:00:12
804500 -- [-1165.332] (-1164.743) (-1164.410) (-1165.945) * (-1165.050) (-1164.307) (-1164.030) [-1164.220] -- 0:00:12
805000 -- (-1165.294) (-1164.995) (-1167.509) [-1165.262] * (-1164.047) (-1170.823) (-1167.340) [-1164.861] -- 0:00:12
Average standard deviation of split frequencies: 0.008188
805500 -- (-1165.607) (-1164.457) [-1166.536] (-1166.171) * (-1164.720) [-1165.171] (-1168.180) (-1164.180) -- 0:00:12
806000 -- (-1165.166) [-1163.797] (-1166.347) (-1166.561) * (-1166.793) (-1165.146) [-1163.286] (-1164.252) -- 0:00:12
806500 -- (-1166.184) (-1163.717) [-1166.811] (-1165.674) * (-1165.432) [-1169.081] (-1165.629) (-1165.009) -- 0:00:11
807000 -- (-1165.347) [-1167.981] (-1163.796) (-1165.798) * (-1164.648) (-1177.668) [-1164.394] (-1167.927) -- 0:00:11
807500 -- (-1164.869) (-1165.417) (-1166.050) [-1165.610] * (-1166.512) (-1181.195) (-1164.333) [-1164.099] -- 0:00:11
808000 -- [-1167.854] (-1169.708) (-1167.636) (-1166.043) * (-1165.019) (-1173.039) (-1164.565) [-1165.200] -- 0:00:11
808500 -- (-1167.589) (-1164.990) (-1168.137) [-1165.498] * [-1164.563] (-1164.663) (-1164.702) (-1166.043) -- 0:00:11
809000 -- (-1166.834) [-1166.165] (-1165.648) (-1164.281) * (-1165.503) (-1166.965) [-1165.606] (-1165.012) -- 0:00:11
809500 -- (-1165.132) (-1169.081) (-1165.122) [-1168.686] * [-1165.990] (-1165.504) (-1165.433) (-1165.544) -- 0:00:11
810000 -- (-1164.460) [-1166.763] (-1166.213) (-1168.749) * (-1163.926) (-1171.535) (-1166.094) [-1166.048] -- 0:00:11
Average standard deviation of split frequencies: 0.008068
810500 -- (-1166.918) (-1166.047) [-1164.415] (-1163.561) * (-1163.956) (-1166.497) [-1163.526] (-1165.300) -- 0:00:11
811000 -- (-1166.600) [-1165.346] (-1165.640) (-1164.684) * (-1166.767) (-1167.575) (-1165.146) [-1164.974] -- 0:00:11
811500 -- (-1174.074) [-1163.533] (-1163.716) (-1163.891) * (-1165.070) (-1164.530) [-1164.270] (-1166.488) -- 0:00:11
812000 -- (-1164.460) (-1164.310) [-1164.318] (-1164.274) * [-1164.414] (-1165.920) (-1165.725) (-1164.720) -- 0:00:11
812500 -- (-1164.393) (-1167.877) [-1164.755] (-1165.981) * [-1165.056] (-1165.075) (-1164.903) (-1164.627) -- 0:00:11
813000 -- (-1169.997) (-1166.751) [-1164.885] (-1167.753) * (-1164.872) (-1165.557) (-1165.555) [-1164.096] -- 0:00:11
813500 -- (-1166.161) (-1165.131) [-1165.246] (-1165.929) * (-1165.074) (-1166.592) [-1164.726] (-1170.483) -- 0:00:11
814000 -- (-1164.954) (-1164.227) [-1168.557] (-1166.682) * (-1165.855) (-1167.488) [-1165.022] (-1167.318) -- 0:00:11
814500 -- (-1164.337) (-1165.673) [-1168.180] (-1165.996) * (-1167.259) (-1167.102) (-1168.412) [-1163.822] -- 0:00:11
815000 -- (-1164.423) [-1167.911] (-1169.305) (-1163.637) * (-1169.324) (-1166.186) [-1164.337] (-1164.501) -- 0:00:11
Average standard deviation of split frequencies: 0.008242
815500 -- (-1163.392) [-1168.789] (-1167.980) (-1164.357) * (-1166.276) (-1167.346) (-1166.084) [-1164.506] -- 0:00:11
816000 -- (-1163.945) (-1172.143) (-1166.559) [-1167.449] * (-1166.638) (-1170.069) (-1164.478) [-1166.926] -- 0:00:11
816500 -- (-1165.454) [-1165.765] (-1164.958) (-1169.132) * (-1166.860) (-1166.317) [-1164.367] (-1165.197) -- 0:00:11
817000 -- (-1167.733) (-1165.988) (-1164.112) [-1167.320] * (-1167.934) (-1165.685) [-1164.583] (-1165.336) -- 0:00:11
817500 -- (-1163.950) (-1163.565) [-1164.213] (-1166.343) * (-1167.259) [-1164.074] (-1164.462) (-1165.097) -- 0:00:11
818000 -- (-1163.781) [-1163.825] (-1163.816) (-1167.518) * [-1164.814] (-1165.764) (-1166.512) (-1165.185) -- 0:00:11
818500 -- (-1164.330) (-1164.913) [-1163.805] (-1165.786) * (-1165.702) (-1166.030) (-1167.209) [-1163.991] -- 0:00:11
819000 -- [-1165.617] (-1168.116) (-1165.121) (-1164.574) * (-1164.764) [-1165.341] (-1167.326) (-1165.659) -- 0:00:11
819500 -- (-1163.662) (-1169.498) (-1165.210) [-1164.800] * [-1164.329] (-1166.326) (-1171.171) (-1167.362) -- 0:00:11
820000 -- [-1163.654] (-1164.178) (-1164.512) (-1165.145) * (-1167.576) [-1167.559] (-1165.458) (-1166.393) -- 0:00:11
Average standard deviation of split frequencies: 0.008652
820500 -- [-1169.780] (-1166.996) (-1167.089) (-1169.011) * (-1164.881) (-1165.787) (-1166.343) [-1166.574] -- 0:00:11
821000 -- (-1170.626) (-1167.050) [-1167.892] (-1166.310) * [-1165.262] (-1164.967) (-1165.844) (-1167.567) -- 0:00:11
821500 -- (-1171.158) (-1165.780) (-1164.042) [-1166.168] * (-1164.985) (-1164.871) [-1166.963] (-1166.347) -- 0:00:11
822000 -- (-1167.769) [-1167.329] (-1165.925) (-1169.046) * [-1166.187] (-1166.004) (-1167.891) (-1176.029) -- 0:00:11
822500 -- (-1167.635) (-1164.250) [-1163.624] (-1166.655) * (-1167.766) (-1164.576) [-1165.924] (-1168.484) -- 0:00:11
823000 -- [-1166.390] (-1165.120) (-1168.590) (-1168.259) * (-1164.313) (-1166.078) [-1164.441] (-1164.442) -- 0:00:10
823500 -- (-1166.960) (-1169.667) (-1167.562) [-1166.722] * (-1163.964) (-1164.077) (-1167.899) [-1165.983] -- 0:00:10
824000 -- (-1164.347) (-1168.048) [-1166.673] (-1166.545) * [-1164.049] (-1167.441) (-1164.775) (-1167.507) -- 0:00:10
824500 -- (-1164.438) (-1166.449) (-1167.997) [-1166.084] * (-1164.902) (-1166.598) [-1165.917] (-1166.787) -- 0:00:10
825000 -- (-1164.616) (-1164.232) [-1165.412] (-1166.431) * [-1165.003] (-1164.610) (-1165.942) (-1167.093) -- 0:00:10
Average standard deviation of split frequencies: 0.008168
825500 -- (-1169.038) (-1165.893) (-1164.995) [-1163.730] * (-1165.368) (-1165.368) (-1166.480) [-1165.235] -- 0:00:10
826000 -- [-1167.192] (-1165.690) (-1165.539) (-1164.626) * (-1165.575) (-1165.363) [-1165.523] (-1165.331) -- 0:00:10
826500 -- (-1164.928) (-1165.934) [-1166.281] (-1168.732) * (-1167.015) [-1166.771] (-1164.924) (-1165.092) -- 0:00:10
827000 -- (-1164.793) [-1167.015] (-1167.107) (-1166.983) * (-1164.772) (-1166.586) (-1167.344) [-1164.297] -- 0:00:10
827500 -- [-1164.866] (-1164.578) (-1165.699) (-1166.844) * (-1165.469) (-1165.209) (-1167.257) [-1165.770] -- 0:00:10
828000 -- [-1164.312] (-1166.080) (-1165.682) (-1164.400) * (-1165.865) (-1171.446) [-1165.712] (-1165.261) -- 0:00:10
828500 -- (-1170.899) (-1167.340) [-1164.321] (-1165.811) * (-1167.230) (-1164.734) [-1165.252] (-1166.207) -- 0:00:10
829000 -- (-1166.990) (-1165.869) (-1163.979) [-1165.637] * (-1165.337) [-1166.260] (-1165.856) (-1165.780) -- 0:00:10
829500 -- (-1167.465) [-1163.531] (-1163.720) (-1168.290) * (-1165.085) (-1167.163) (-1164.770) [-1164.837] -- 0:00:10
830000 -- (-1165.586) (-1174.079) [-1164.974] (-1165.224) * (-1169.660) [-1164.300] (-1165.111) (-1167.342) -- 0:00:10
Average standard deviation of split frequencies: 0.008229
830500 -- (-1167.711) [-1165.119] (-1166.828) (-1165.860) * [-1169.313] (-1165.225) (-1165.274) (-1164.705) -- 0:00:10
831000 -- (-1166.447) [-1165.599] (-1164.788) (-1164.118) * (-1169.470) [-1164.934] (-1164.818) (-1167.446) -- 0:00:10
831500 -- (-1167.922) (-1166.702) [-1164.677] (-1166.473) * [-1164.844] (-1164.049) (-1165.272) (-1166.459) -- 0:00:10
832000 -- [-1165.992] (-1167.535) (-1163.713) (-1167.476) * (-1165.894) [-1165.672] (-1164.753) (-1164.288) -- 0:00:10
832500 -- (-1164.871) (-1171.152) (-1164.748) [-1165.950] * (-1170.732) [-1171.790] (-1164.981) (-1165.046) -- 0:00:10
833000 -- (-1165.610) (-1167.181) [-1166.536] (-1167.198) * [-1166.055] (-1164.675) (-1165.252) (-1169.248) -- 0:00:10
833500 -- [-1169.266] (-1166.564) (-1167.862) (-1166.744) * (-1164.380) [-1164.110] (-1167.159) (-1164.651) -- 0:00:10
834000 -- [-1166.464] (-1165.880) (-1164.859) (-1169.194) * (-1165.521) (-1164.384) (-1168.809) [-1167.017] -- 0:00:10
834500 -- (-1165.713) (-1164.640) [-1167.690] (-1166.621) * [-1167.444] (-1164.166) (-1167.769) (-1167.756) -- 0:00:10
835000 -- (-1164.192) (-1165.615) (-1165.982) [-1164.419] * (-1165.985) [-1165.623] (-1166.443) (-1169.574) -- 0:00:10
Average standard deviation of split frequencies: 0.008106
835500 -- (-1166.215) (-1165.956) [-1163.975] (-1164.995) * (-1163.632) (-1167.922) [-1168.180] (-1167.765) -- 0:00:10
836000 -- (-1167.145) (-1165.359) (-1164.256) [-1164.164] * (-1166.892) [-1166.089] (-1166.859) (-1171.692) -- 0:00:10
836500 -- [-1169.105] (-1165.148) (-1165.983) (-1166.975) * (-1165.132) (-1164.220) (-1169.402) [-1169.864] -- 0:00:10
837000 -- (-1168.608) (-1167.591) (-1167.400) [-1166.165] * (-1164.310) (-1164.337) (-1165.907) [-1163.864] -- 0:00:10
837500 -- (-1166.861) (-1166.519) (-1163.974) [-1164.643] * (-1164.953) (-1166.046) [-1166.159] (-1164.507) -- 0:00:10
838000 -- (-1166.149) (-1164.810) (-1167.111) [-1166.687] * (-1167.303) (-1165.440) (-1169.658) [-1165.662] -- 0:00:10
838500 -- (-1165.646) (-1165.281) [-1167.539] (-1166.637) * (-1173.788) (-1165.538) (-1165.648) [-1163.864] -- 0:00:10
839000 -- [-1166.126] (-1170.987) (-1165.932) (-1165.704) * (-1170.880) (-1163.871) (-1166.492) [-1165.041] -- 0:00:09
839500 -- (-1167.816) (-1168.002) (-1164.217) [-1164.345] * (-1166.374) (-1164.071) (-1166.863) [-1167.905] -- 0:00:09
840000 -- (-1167.609) (-1166.351) [-1166.056] (-1165.507) * (-1164.798) [-1165.982] (-1165.909) (-1166.441) -- 0:00:09
Average standard deviation of split frequencies: 0.008236
840500 -- (-1165.448) [-1166.954] (-1165.455) (-1164.469) * (-1165.505) (-1169.156) (-1166.352) [-1165.089] -- 0:00:09
841000 -- (-1164.190) (-1168.253) [-1166.564] (-1166.961) * (-1169.649) (-1164.166) [-1165.738] (-1167.906) -- 0:00:09
841500 -- [-1163.882] (-1165.029) (-1166.456) (-1164.856) * [-1165.895] (-1163.475) (-1168.475) (-1168.353) -- 0:00:09
842000 -- (-1165.385) (-1170.095) [-1164.496] (-1167.740) * [-1164.819] (-1167.962) (-1167.515) (-1165.039) -- 0:00:09
842500 -- (-1165.510) [-1164.367] (-1165.406) (-1167.283) * (-1163.357) (-1166.174) (-1164.075) [-1165.102] -- 0:00:09
843000 -- (-1164.794) (-1167.346) (-1164.293) [-1164.732] * (-1164.265) [-1165.460] (-1164.741) (-1163.629) -- 0:00:09
843500 -- (-1166.057) [-1164.988] (-1164.255) (-1167.088) * (-1165.215) [-1164.467] (-1168.158) (-1164.679) -- 0:00:09
844000 -- (-1167.752) [-1165.630] (-1164.170) (-1164.929) * [-1166.194] (-1168.936) (-1165.769) (-1173.685) -- 0:00:09
844500 -- (-1164.290) (-1164.494) [-1164.711] (-1165.316) * (-1163.758) (-1164.754) [-1164.744] (-1164.245) -- 0:00:09
845000 -- (-1164.865) (-1166.535) (-1169.950) [-1165.253] * [-1163.811] (-1163.764) (-1164.786) (-1166.549) -- 0:00:09
Average standard deviation of split frequencies: 0.008184
845500 -- [-1164.852] (-1169.081) (-1168.360) (-1164.114) * [-1163.627] (-1165.840) (-1164.561) (-1164.190) -- 0:00:09
846000 -- (-1165.668) (-1164.559) (-1165.580) [-1164.746] * (-1164.768) (-1166.009) (-1167.250) [-1163.587] -- 0:00:09
846500 -- [-1166.325] (-1167.707) (-1166.346) (-1164.372) * (-1164.826) (-1164.780) [-1164.036] (-1164.830) -- 0:00:09
847000 -- (-1166.706) (-1165.923) [-1165.324] (-1163.754) * (-1164.806) (-1164.065) [-1167.407] (-1169.484) -- 0:00:09
847500 -- [-1166.999] (-1164.590) (-1165.883) (-1163.701) * (-1164.948) [-1168.724] (-1167.053) (-1165.636) -- 0:00:09
848000 -- (-1165.398) (-1164.641) (-1166.913) [-1165.306] * (-1170.664) (-1163.983) [-1165.654] (-1165.051) -- 0:00:09
848500 -- [-1163.589] (-1164.701) (-1168.682) (-1167.119) * [-1165.264] (-1163.906) (-1165.613) (-1166.109) -- 0:00:09
849000 -- (-1163.465) (-1163.839) (-1169.634) [-1164.011] * (-1165.684) (-1168.247) [-1165.136] (-1166.156) -- 0:00:09
849500 -- (-1165.570) [-1164.041] (-1168.458) (-1169.183) * (-1166.086) (-1168.338) (-1165.803) [-1168.006] -- 0:00:09
850000 -- (-1164.142) (-1163.770) (-1165.130) [-1167.362] * (-1167.395) (-1164.658) (-1165.312) [-1165.963] -- 0:00:09
Average standard deviation of split frequencies: 0.008278
850500 -- (-1163.834) (-1171.563) [-1164.532] (-1165.435) * (-1166.623) (-1170.574) [-1165.994] (-1165.680) -- 0:00:09
851000 -- (-1166.562) (-1170.547) (-1165.709) [-1164.806] * (-1166.375) (-1165.765) (-1165.435) [-1164.447] -- 0:00:09
851500 -- (-1164.206) [-1166.607] (-1164.837) (-1168.995) * [-1164.240] (-1166.991) (-1165.319) (-1167.708) -- 0:00:09
852000 -- (-1165.313) (-1169.453) (-1172.159) [-1164.883] * (-1165.152) (-1165.135) [-1163.968] (-1164.541) -- 0:00:09
852500 -- (-1163.949) (-1170.731) (-1167.633) [-1167.141] * (-1167.951) (-1167.264) [-1166.725] (-1164.869) -- 0:00:09
853000 -- (-1164.054) (-1167.262) [-1166.971] (-1167.840) * (-1166.543) [-1164.973] (-1166.695) (-1166.979) -- 0:00:09
853500 -- [-1168.366] (-1163.690) (-1165.928) (-1167.252) * (-1168.816) (-1169.512) [-1166.898] (-1165.100) -- 0:00:09
854000 -- (-1172.175) [-1165.377] (-1166.736) (-1169.305) * [-1166.870] (-1164.330) (-1165.141) (-1166.896) -- 0:00:09
854500 -- [-1166.616] (-1165.732) (-1164.528) (-1164.254) * [-1169.378] (-1167.490) (-1164.592) (-1166.102) -- 0:00:09
855000 -- (-1166.141) [-1167.974] (-1167.719) (-1164.272) * [-1168.382] (-1164.637) (-1164.302) (-1167.841) -- 0:00:08
Average standard deviation of split frequencies: 0.008364
855500 -- (-1166.481) (-1164.860) [-1164.365] (-1165.272) * [-1163.514] (-1163.993) (-1164.425) (-1167.653) -- 0:00:08
856000 -- (-1167.493) (-1165.657) [-1164.363] (-1167.019) * [-1163.637] (-1165.675) (-1164.499) (-1166.635) -- 0:00:08
856500 -- (-1164.325) [-1166.959] (-1164.446) (-1167.018) * [-1163.643] (-1168.188) (-1168.256) (-1163.495) -- 0:00:08
857000 -- (-1165.102) (-1165.061) (-1164.390) [-1168.969] * (-1165.475) (-1166.320) (-1166.272) [-1165.502] -- 0:00:08
857500 -- [-1166.322] (-1165.262) (-1167.239) (-1166.841) * (-1164.666) (-1166.684) [-1164.102] (-1170.149) -- 0:00:08
858000 -- (-1168.432) (-1172.873) [-1168.279] (-1167.463) * [-1163.520] (-1164.733) (-1164.103) (-1171.152) -- 0:00:08
858500 -- (-1166.956) (-1164.376) (-1165.916) [-1167.284] * [-1165.511] (-1167.527) (-1164.209) (-1171.920) -- 0:00:08
859000 -- (-1165.218) (-1165.131) [-1163.699] (-1166.127) * (-1168.146) (-1165.698) [-1164.604] (-1167.584) -- 0:00:08
859500 -- (-1165.340) [-1164.871] (-1169.118) (-1164.084) * (-1165.939) [-1165.331] (-1167.077) (-1168.510) -- 0:00:08
860000 -- (-1166.889) [-1163.671] (-1171.843) (-1164.011) * (-1167.274) (-1167.584) [-1165.252] (-1166.823) -- 0:00:08
Average standard deviation of split frequencies: 0.008070
860500 -- (-1165.164) [-1166.714] (-1172.732) (-1167.907) * (-1168.138) (-1164.544) (-1165.585) [-1167.634] -- 0:00:08
861000 -- [-1165.847] (-1164.223) (-1168.916) (-1164.549) * (-1164.165) (-1165.280) (-1167.252) [-1165.641] -- 0:00:08
861500 -- (-1163.796) (-1166.590) [-1163.665] (-1165.867) * [-1165.873] (-1164.824) (-1165.517) (-1165.699) -- 0:00:08
862000 -- (-1166.932) [-1164.569] (-1163.728) (-1164.787) * [-1166.572] (-1164.855) (-1165.033) (-1166.101) -- 0:00:08
862500 -- [-1165.032] (-1170.673) (-1164.572) (-1166.899) * (-1166.365) (-1164.069) [-1164.301] (-1167.323) -- 0:00:08
863000 -- (-1166.333) [-1169.119] (-1166.538) (-1165.576) * (-1165.565) (-1166.106) (-1165.623) [-1164.627] -- 0:00:08
863500 -- (-1169.290) [-1170.468] (-1166.988) (-1165.514) * (-1168.105) (-1167.324) [-1165.203] (-1165.495) -- 0:00:08
864000 -- [-1163.683] (-1167.018) (-1166.599) (-1167.783) * [-1163.783] (-1165.724) (-1165.461) (-1166.242) -- 0:00:08
864500 -- (-1166.197) (-1165.792) (-1163.915) [-1168.795] * [-1163.997] (-1164.861) (-1169.832) (-1164.583) -- 0:00:08
865000 -- (-1163.595) (-1171.158) [-1164.500] (-1168.318) * (-1167.744) (-1165.121) [-1165.676] (-1165.886) -- 0:00:08
Average standard deviation of split frequencies: 0.008029
865500 -- (-1169.201) (-1165.481) [-1164.268] (-1168.095) * (-1165.992) [-1165.645] (-1166.359) (-1167.229) -- 0:00:08
866000 -- (-1166.782) (-1163.854) (-1168.033) [-1171.501] * (-1174.188) [-1166.503] (-1167.708) (-1167.485) -- 0:00:08
866500 -- (-1165.783) (-1164.665) (-1165.276) [-1169.641] * (-1165.049) [-1165.432] (-1169.491) (-1167.174) -- 0:00:08
867000 -- (-1167.942) (-1164.440) (-1171.347) [-1164.945] * (-1165.621) [-1165.493] (-1167.114) (-1167.719) -- 0:00:08
867500 -- (-1166.241) (-1164.257) [-1166.151] (-1165.539) * [-1166.554] (-1166.563) (-1167.073) (-1169.593) -- 0:00:08
868000 -- (-1172.006) (-1164.260) (-1165.662) [-1166.170] * (-1166.405) (-1163.477) (-1167.505) [-1166.819] -- 0:00:08
868500 -- [-1165.213] (-1163.985) (-1166.857) (-1168.458) * (-1165.898) [-1164.563] (-1168.627) (-1165.606) -- 0:00:08
869000 -- [-1165.896] (-1164.040) (-1167.804) (-1165.793) * (-1164.902) [-1165.817] (-1166.734) (-1164.998) -- 0:00:08
869500 -- (-1165.833) (-1166.427) [-1165.673] (-1167.627) * (-1168.204) (-1166.180) (-1167.032) [-1164.725] -- 0:00:08
870000 -- [-1165.735] (-1166.090) (-1166.634) (-1166.463) * [-1167.585] (-1166.411) (-1164.289) (-1168.890) -- 0:00:08
Average standard deviation of split frequencies: 0.008257
870500 -- (-1167.082) [-1165.701] (-1165.764) (-1165.926) * (-1164.170) (-1164.335) [-1164.380] (-1165.374) -- 0:00:08
871000 -- (-1167.483) (-1164.782) (-1169.079) [-1165.850] * [-1173.669] (-1166.656) (-1169.091) (-1163.799) -- 0:00:07
871500 -- (-1164.131) (-1163.476) (-1165.055) [-1168.929] * [-1165.612] (-1169.120) (-1170.252) (-1164.632) -- 0:00:07
872000 -- (-1163.441) [-1165.490] (-1163.954) (-1165.041) * (-1166.012) [-1165.944] (-1168.902) (-1165.105) -- 0:00:07
872500 -- (-1164.883) (-1165.940) (-1167.112) [-1165.676] * (-1165.139) (-1167.339) (-1167.306) [-1167.568] -- 0:00:07
873000 -- [-1165.449] (-1164.292) (-1167.112) (-1163.988) * (-1164.955) [-1166.225] (-1168.957) (-1165.870) -- 0:00:07
873500 -- (-1169.882) [-1164.908] (-1164.896) (-1167.345) * [-1164.398] (-1164.975) (-1167.361) (-1166.010) -- 0:00:07
874000 -- [-1164.888] (-1165.270) (-1165.501) (-1166.857) * (-1164.152) [-1165.422] (-1167.284) (-1163.844) -- 0:00:07
874500 -- [-1165.086] (-1164.469) (-1163.581) (-1165.882) * (-1168.252) [-1164.791] (-1166.496) (-1164.049) -- 0:00:07
875000 -- (-1175.016) (-1163.861) (-1163.998) [-1166.466] * (-1169.916) [-1167.544] (-1166.929) (-1166.569) -- 0:00:07
Average standard deviation of split frequencies: 0.008359
875500 -- (-1170.025) [-1165.215] (-1170.960) (-1167.750) * (-1167.022) [-1163.848] (-1164.463) (-1166.332) -- 0:00:07
876000 -- (-1165.714) (-1166.948) (-1165.148) [-1165.190] * (-1165.879) [-1168.361] (-1165.822) (-1166.784) -- 0:00:07
876500 -- (-1165.151) (-1165.075) [-1167.347] (-1165.840) * (-1170.373) (-1165.966) (-1167.777) [-1166.110] -- 0:00:07
877000 -- [-1164.519] (-1168.317) (-1170.533) (-1163.876) * [-1166.010] (-1166.711) (-1164.538) (-1165.139) -- 0:00:07
877500 -- [-1165.910] (-1167.754) (-1168.520) (-1165.036) * (-1165.403) (-1169.243) [-1165.128] (-1167.872) -- 0:00:07
878000 -- [-1166.329] (-1164.892) (-1163.698) (-1165.360) * [-1166.916] (-1166.945) (-1163.650) (-1164.607) -- 0:00:07
878500 -- (-1166.406) (-1164.271) [-1163.486] (-1164.520) * [-1165.383] (-1169.290) (-1167.768) (-1166.004) -- 0:00:07
879000 -- (-1164.247) (-1165.790) [-1164.398] (-1166.181) * (-1166.865) [-1163.849] (-1167.057) (-1168.584) -- 0:00:07
879500 -- (-1164.557) (-1163.916) [-1164.741] (-1165.823) * (-1166.683) (-1163.873) (-1165.798) [-1163.661] -- 0:00:07
880000 -- (-1164.240) (-1167.484) [-1166.634] (-1166.290) * [-1164.530] (-1164.429) (-1166.480) (-1165.466) -- 0:00:07
Average standard deviation of split frequencies: 0.008065
880500 -- (-1164.429) [-1166.238] (-1165.059) (-1166.426) * (-1169.308) (-1164.364) [-1165.155] (-1168.365) -- 0:00:07
881000 -- [-1165.366] (-1166.180) (-1165.134) (-1164.996) * (-1166.764) [-1167.281] (-1171.786) (-1166.741) -- 0:00:07
881500 -- (-1168.869) [-1164.375] (-1168.869) (-1165.315) * [-1164.911] (-1164.773) (-1178.055) (-1170.670) -- 0:00:07
882000 -- [-1165.884] (-1169.127) (-1165.397) (-1166.203) * (-1163.836) (-1166.392) [-1165.071] (-1168.828) -- 0:00:07
882500 -- (-1167.673) (-1166.790) [-1165.850] (-1165.452) * (-1169.158) (-1165.272) [-1164.225] (-1164.604) -- 0:00:07
883000 -- (-1165.953) (-1166.033) (-1168.986) [-1166.291] * [-1164.417] (-1164.433) (-1167.271) (-1164.737) -- 0:00:07
883500 -- [-1167.058] (-1169.755) (-1165.577) (-1165.354) * (-1164.987) [-1164.221] (-1164.564) (-1164.798) -- 0:00:07
884000 -- [-1167.555] (-1169.808) (-1167.612) (-1164.254) * (-1164.275) (-1169.433) (-1165.804) [-1164.304] -- 0:00:07
884500 -- (-1164.590) (-1166.097) (-1167.895) [-1164.068] * [-1163.705] (-1166.317) (-1164.391) (-1163.801) -- 0:00:07
885000 -- (-1164.125) (-1167.536) [-1165.252] (-1165.538) * [-1164.849] (-1168.100) (-1164.153) (-1166.717) -- 0:00:07
Average standard deviation of split frequencies: 0.007981
885500 -- [-1165.529] (-1165.566) (-1164.418) (-1165.333) * [-1163.738] (-1167.639) (-1168.274) (-1163.923) -- 0:00:07
886000 -- (-1165.351) [-1165.895] (-1165.063) (-1166.102) * (-1167.507) [-1167.413] (-1169.156) (-1163.774) -- 0:00:07
886500 -- (-1169.240) (-1164.288) [-1168.960] (-1167.461) * (-1165.749) (-1165.687) (-1166.790) [-1163.830] -- 0:00:07
887000 -- (-1166.445) (-1164.328) (-1168.423) [-1166.970] * (-1165.467) [-1164.259] (-1165.489) (-1165.594) -- 0:00:07
887500 -- [-1163.643] (-1165.945) (-1167.700) (-1166.679) * (-1168.188) (-1164.488) (-1164.668) [-1164.991] -- 0:00:06
888000 -- (-1167.656) (-1170.083) [-1164.745] (-1164.316) * [-1166.884] (-1165.982) (-1164.928) (-1164.565) -- 0:00:06
888500 -- [-1167.104] (-1166.194) (-1164.698) (-1163.444) * (-1169.343) (-1165.389) (-1164.920) [-1165.458] -- 0:00:06
889000 -- [-1168.192] (-1164.556) (-1166.077) (-1163.606) * (-1167.451) [-1165.497] (-1164.261) (-1167.967) -- 0:00:06
889500 -- (-1164.789) (-1165.449) (-1166.253) [-1165.260] * (-1164.422) (-1166.649) [-1164.687] (-1165.420) -- 0:00:06
890000 -- (-1164.597) (-1165.733) [-1164.460] (-1165.692) * [-1165.093] (-1165.068) (-1168.156) (-1164.693) -- 0:00:06
Average standard deviation of split frequencies: 0.007904
890500 -- (-1165.216) (-1164.771) [-1165.188] (-1168.116) * (-1165.023) (-1166.698) (-1164.536) [-1166.226] -- 0:00:06
891000 -- (-1168.237) (-1166.199) (-1164.862) [-1169.658] * (-1164.745) (-1164.091) (-1166.211) [-1164.635] -- 0:00:06
891500 -- (-1164.149) (-1166.003) [-1163.344] (-1165.044) * [-1165.436] (-1164.056) (-1164.662) (-1163.917) -- 0:00:06
892000 -- [-1165.253] (-1169.010) (-1165.597) (-1166.967) * [-1164.465] (-1163.714) (-1165.669) (-1165.314) -- 0:00:06
892500 -- [-1166.221] (-1166.425) (-1165.159) (-1163.856) * (-1165.948) (-1164.646) [-1166.036] (-1164.927) -- 0:00:06
893000 -- (-1165.215) (-1168.928) [-1165.953] (-1164.718) * (-1164.868) (-1165.973) (-1167.695) [-1166.060] -- 0:00:06
893500 -- (-1165.894) [-1165.781] (-1167.276) (-1166.753) * (-1164.093) (-1166.077) [-1166.487] (-1166.549) -- 0:00:06
894000 -- (-1164.466) (-1167.943) [-1164.238] (-1172.431) * (-1164.565) [-1166.323] (-1167.725) (-1166.644) -- 0:00:06
894500 -- [-1163.768] (-1163.914) (-1165.657) (-1167.239) * (-1164.394) [-1167.615] (-1168.178) (-1168.746) -- 0:00:06
895000 -- (-1164.210) [-1165.554] (-1165.436) (-1166.514) * (-1172.850) [-1168.243] (-1165.067) (-1165.262) -- 0:00:06
Average standard deviation of split frequencies: 0.007787
895500 -- (-1164.263) (-1165.600) [-1168.381] (-1164.156) * (-1165.021) (-1165.317) [-1167.574] (-1165.870) -- 0:00:06
896000 -- (-1163.769) (-1167.203) [-1169.048] (-1164.529) * (-1163.875) (-1166.842) [-1165.498] (-1169.839) -- 0:00:06
896500 -- (-1164.276) [-1164.278] (-1166.650) (-1166.421) * (-1164.218) (-1165.646) (-1164.797) [-1164.823] -- 0:00:06
897000 -- (-1163.793) [-1168.059] (-1165.302) (-1167.746) * (-1163.793) (-1167.915) (-1164.625) [-1166.958] -- 0:00:06
897500 -- [-1165.544] (-1167.413) (-1170.536) (-1164.511) * (-1165.475) (-1170.830) (-1164.770) [-1164.648] -- 0:00:06
898000 -- (-1165.854) [-1163.827] (-1165.177) (-1169.058) * (-1165.410) (-1165.308) [-1169.270] (-1165.358) -- 0:00:06
898500 -- (-1168.351) [-1163.754] (-1164.878) (-1168.996) * (-1166.884) (-1165.782) [-1165.954] (-1166.365) -- 0:00:06
899000 -- (-1168.662) (-1164.194) [-1164.826] (-1166.714) * (-1167.311) (-1173.340) (-1164.935) [-1164.776] -- 0:00:06
899500 -- (-1166.314) [-1165.727] (-1167.806) (-1165.767) * [-1166.559] (-1170.804) (-1165.621) (-1164.875) -- 0:00:06
900000 -- (-1164.335) (-1164.841) [-1169.252] (-1165.621) * (-1169.568) (-1164.575) [-1164.234] (-1165.606) -- 0:00:06
Average standard deviation of split frequencies: 0.008235
900500 -- (-1165.264) (-1165.884) (-1166.494) [-1164.449] * (-1165.391) [-1165.879] (-1165.422) (-1166.313) -- 0:00:06
901000 -- (-1166.644) [-1166.053] (-1165.521) (-1165.346) * (-1163.864) [-1166.051] (-1164.599) (-1165.836) -- 0:00:06
901500 -- (-1164.267) (-1164.793) [-1166.120] (-1166.353) * (-1167.537) (-1165.389) [-1164.723] (-1165.204) -- 0:00:06
902000 -- (-1165.074) (-1165.465) (-1165.255) [-1166.065] * (-1164.437) [-1166.140] (-1167.144) (-1166.507) -- 0:00:06
902500 -- (-1164.996) (-1165.591) (-1165.077) [-1165.424] * (-1164.239) (-1166.990) (-1166.141) [-1164.473] -- 0:00:06
903000 -- (-1167.529) (-1168.913) [-1163.958] (-1167.394) * (-1165.255) (-1165.855) [-1165.229] (-1168.032) -- 0:00:06
903500 -- [-1167.886] (-1166.795) (-1165.202) (-1166.872) * (-1165.609) [-1167.668] (-1165.598) (-1164.192) -- 0:00:05
904000 -- (-1163.541) [-1165.257] (-1165.624) (-1166.058) * (-1167.647) (-1164.384) [-1164.144] (-1165.640) -- 0:00:05
904500 -- (-1169.568) [-1165.105] (-1165.270) (-1169.899) * [-1166.807] (-1168.726) (-1163.602) (-1164.675) -- 0:00:05
905000 -- [-1163.760] (-1168.194) (-1167.418) (-1170.457) * (-1163.877) (-1165.734) (-1163.876) [-1164.763] -- 0:00:05
Average standard deviation of split frequencies: 0.008488
905500 -- [-1163.654] (-1166.767) (-1165.105) (-1165.468) * [-1164.513] (-1166.274) (-1163.613) (-1164.745) -- 0:00:05
906000 -- (-1165.603) [-1166.222] (-1164.385) (-1169.958) * (-1165.003) (-1166.058) [-1164.917] (-1165.805) -- 0:00:05
906500 -- (-1165.559) [-1166.173] (-1165.603) (-1167.205) * (-1166.107) (-1164.129) (-1164.339) [-1164.894] -- 0:00:05
907000 -- (-1166.941) [-1166.123] (-1164.107) (-1166.816) * (-1163.492) (-1164.994) (-1166.624) [-1163.760] -- 0:00:05
907500 -- (-1164.327) (-1164.728) [-1164.491] (-1164.942) * (-1163.913) (-1166.539) (-1168.023) [-1165.143] -- 0:00:05
908000 -- (-1169.673) (-1164.251) (-1165.414) [-1165.593] * (-1164.320) (-1166.584) (-1166.738) [-1166.835] -- 0:00:05
908500 -- (-1167.102) [-1164.374] (-1164.750) (-1165.450) * (-1165.091) (-1164.421) [-1165.889] (-1164.335) -- 0:00:05
909000 -- (-1164.803) (-1166.490) (-1165.165) [-1165.279] * (-1169.056) (-1164.506) [-1169.202] (-1164.657) -- 0:00:05
909500 -- (-1167.099) [-1167.134] (-1167.051) (-1163.921) * (-1165.011) (-1171.675) (-1167.593) [-1166.011] -- 0:00:05
910000 -- (-1169.691) (-1166.887) (-1165.387) [-1166.273] * (-1163.321) (-1166.779) (-1164.847) [-1169.285] -- 0:00:05
Average standard deviation of split frequencies: 0.008627
910500 -- [-1163.735] (-1163.979) (-1164.411) (-1164.789) * (-1163.433) (-1167.718) [-1167.102] (-1165.012) -- 0:00:05
911000 -- (-1165.148) (-1163.687) [-1166.875] (-1165.463) * (-1167.051) (-1170.478) [-1168.254] (-1168.724) -- 0:00:05
911500 -- [-1168.067] (-1165.383) (-1165.200) (-1167.061) * [-1165.612] (-1163.837) (-1166.734) (-1169.604) -- 0:00:05
912000 -- (-1166.534) (-1164.796) [-1164.111] (-1165.141) * (-1166.376) (-1164.186) (-1167.683) [-1164.037] -- 0:00:05
912500 -- (-1167.816) (-1164.661) (-1163.863) [-1165.089] * (-1166.576) (-1165.050) (-1166.024) [-1167.396] -- 0:00:05
913000 -- (-1168.291) (-1165.751) (-1166.356) [-1164.529] * (-1164.928) [-1164.425] (-1166.761) (-1164.346) -- 0:00:05
913500 -- [-1164.319] (-1165.691) (-1163.390) (-1166.758) * [-1166.009] (-1169.561) (-1165.671) (-1164.524) -- 0:00:05
914000 -- (-1168.292) (-1167.747) (-1164.387) [-1166.712] * (-1164.045) [-1166.186] (-1164.490) (-1168.394) -- 0:00:05
914500 -- [-1165.609] (-1165.348) (-1168.033) (-1169.890) * (-1166.249) (-1164.849) (-1166.859) [-1163.936] -- 0:00:05
915000 -- (-1163.408) (-1167.347) [-1166.445] (-1163.794) * (-1164.295) [-1165.311] (-1164.814) (-1163.488) -- 0:00:05
Average standard deviation of split frequencies: 0.008440
915500 -- (-1163.408) [-1164.386] (-1165.756) (-1167.483) * [-1163.801] (-1166.113) (-1166.603) (-1164.119) -- 0:00:05
916000 -- (-1167.465) (-1164.330) [-1163.928] (-1165.639) * (-1165.955) [-1164.661] (-1167.862) (-1164.819) -- 0:00:05
916500 -- (-1169.971) (-1164.574) (-1164.753) [-1166.803] * (-1167.653) (-1165.158) (-1164.705) [-1164.588] -- 0:00:05
917000 -- (-1164.491) (-1168.375) (-1164.796) [-1165.679] * [-1166.521] (-1163.395) (-1164.844) (-1168.450) -- 0:00:05
917500 -- (-1164.895) [-1172.246] (-1165.338) (-1171.749) * (-1166.175) [-1165.415] (-1166.405) (-1167.257) -- 0:00:05
918000 -- (-1166.466) [-1165.765] (-1166.871) (-1165.229) * (-1168.450) (-1165.737) [-1165.821] (-1164.537) -- 0:00:05
918500 -- (-1165.372) [-1165.485] (-1167.335) (-1167.470) * (-1166.164) (-1164.667) (-1165.333) [-1165.088] -- 0:00:05
919000 -- (-1166.162) (-1167.514) (-1164.365) [-1164.657] * (-1166.168) (-1163.895) [-1169.220] (-1164.009) -- 0:00:05
919500 -- (-1165.645) [-1166.306] (-1165.419) (-1168.895) * [-1166.618] (-1164.113) (-1165.512) (-1163.563) -- 0:00:04
920000 -- (-1164.530) (-1165.521) [-1164.588] (-1165.132) * [-1165.738] (-1165.449) (-1169.831) (-1166.025) -- 0:00:04
Average standard deviation of split frequencies: 0.008670
920500 -- (-1165.670) [-1164.999] (-1164.587) (-1166.035) * (-1166.846) [-1165.026] (-1166.114) (-1164.250) -- 0:00:04
921000 -- [-1168.804] (-1166.330) (-1163.962) (-1163.304) * (-1164.997) (-1164.507) (-1164.607) [-1165.708] -- 0:00:04
921500 -- (-1168.380) (-1165.174) (-1164.825) [-1163.296] * (-1165.435) (-1165.927) (-1164.803) [-1165.440] -- 0:00:04
922000 -- [-1165.733] (-1165.392) (-1165.171) (-1163.760) * [-1165.125] (-1164.243) (-1165.046) (-1166.406) -- 0:00:04
922500 -- (-1167.185) (-1165.309) [-1167.698] (-1166.452) * [-1164.002] (-1170.824) (-1170.954) (-1167.410) -- 0:00:04
923000 -- (-1167.328) (-1165.596) (-1169.503) [-1164.399] * (-1164.407) (-1169.874) (-1163.630) [-1164.072] -- 0:00:04
923500 -- (-1164.922) (-1165.751) [-1164.347] (-1164.305) * (-1166.516) (-1165.612) [-1164.536] (-1167.849) -- 0:00:04
924000 -- (-1164.857) (-1164.114) (-1167.052) [-1166.691] * [-1167.106] (-1166.918) (-1165.771) (-1176.699) -- 0:00:04
924500 -- (-1168.613) (-1163.984) (-1167.976) [-1166.541] * (-1165.689) (-1166.065) [-1166.157] (-1163.964) -- 0:00:04
925000 -- (-1168.100) (-1166.050) [-1164.953] (-1166.333) * (-1171.450) (-1165.351) [-1164.693] (-1167.310) -- 0:00:04
Average standard deviation of split frequencies: 0.008858
925500 -- [-1167.121] (-1164.702) (-1165.149) (-1170.759) * (-1169.597) [-1165.307] (-1165.126) (-1165.932) -- 0:00:04
926000 -- (-1166.682) (-1165.022) (-1170.013) [-1165.369] * (-1164.645) (-1164.903) [-1165.126] (-1171.078) -- 0:00:04
926500 -- [-1167.429] (-1164.747) (-1165.483) (-1164.668) * (-1166.406) (-1166.643) [-1165.046] (-1166.394) -- 0:00:04
927000 -- (-1166.902) [-1163.648] (-1166.215) (-1165.521) * [-1169.309] (-1166.017) (-1163.320) (-1164.980) -- 0:00:04
927500 -- (-1165.975) (-1163.866) [-1166.070] (-1165.059) * [-1167.919] (-1164.899) (-1164.211) (-1165.904) -- 0:00:04
928000 -- (-1166.568) (-1166.383) [-1168.561] (-1165.783) * [-1168.553] (-1168.157) (-1164.783) (-1167.197) -- 0:00:04
928500 -- (-1165.441) (-1166.251) (-1164.599) [-1165.785] * (-1166.709) (-1166.958) [-1164.819] (-1165.575) -- 0:00:04
929000 -- (-1165.625) (-1165.609) [-1163.722] (-1163.892) * (-1167.090) (-1165.221) (-1166.958) [-1164.460] -- 0:00:04
929500 -- (-1165.067) [-1164.791] (-1164.373) (-1165.024) * [-1164.661] (-1170.436) (-1165.256) (-1164.831) -- 0:00:04
930000 -- (-1164.533) (-1164.708) [-1164.529] (-1166.978) * (-1166.765) (-1166.728) (-1163.909) [-1163.665] -- 0:00:04
Average standard deviation of split frequencies: 0.008543
930500 -- [-1166.593] (-1166.168) (-1167.176) (-1168.791) * (-1164.216) [-1164.281] (-1167.515) (-1166.448) -- 0:00:04
931000 -- [-1164.070] (-1170.165) (-1165.183) (-1168.462) * (-1165.028) [-1166.663] (-1166.318) (-1166.117) -- 0:00:04
931500 -- [-1164.020] (-1164.151) (-1167.795) (-1164.744) * [-1166.839] (-1166.751) (-1164.475) (-1166.468) -- 0:00:04
932000 -- (-1166.140) [-1164.279] (-1165.833) (-1167.208) * (-1165.849) (-1164.083) [-1165.530] (-1166.732) -- 0:00:04
932500 -- [-1165.460] (-1165.806) (-1166.200) (-1167.337) * (-1164.920) [-1165.136] (-1165.125) (-1166.622) -- 0:00:04
933000 -- (-1163.606) [-1167.698] (-1167.952) (-1164.657) * [-1167.060] (-1164.930) (-1169.848) (-1166.343) -- 0:00:04
933500 -- (-1165.562) (-1164.392) (-1168.694) [-1165.359] * (-1166.883) (-1164.178) (-1165.790) [-1164.590] -- 0:00:04
934000 -- (-1165.912) (-1164.281) [-1168.585] (-1167.276) * (-1169.713) (-1163.483) (-1166.578) [-1163.557] -- 0:00:04
934500 -- [-1166.457] (-1165.726) (-1167.290) (-1168.476) * (-1169.347) (-1163.461) [-1165.874] (-1164.306) -- 0:00:04
935000 -- (-1164.330) [-1164.216] (-1166.768) (-1165.576) * (-1164.759) (-1163.428) [-1165.365] (-1168.066) -- 0:00:04
Average standard deviation of split frequencies: 0.008830
935500 -- (-1164.949) (-1166.234) (-1166.210) [-1164.641] * (-1164.995) (-1165.695) (-1165.177) [-1169.716] -- 0:00:03
936000 -- (-1164.511) [-1170.055] (-1164.735) (-1164.874) * [-1164.928] (-1167.392) (-1166.421) (-1168.975) -- 0:00:03
936500 -- [-1165.689] (-1164.763) (-1167.437) (-1164.072) * [-1166.504] (-1166.457) (-1165.698) (-1164.413) -- 0:00:03
937000 -- (-1164.342) [-1166.271] (-1168.364) (-1165.692) * (-1171.903) (-1165.132) [-1165.456] (-1165.465) -- 0:00:03
937500 -- (-1167.938) (-1164.359) (-1166.278) [-1165.333] * (-1164.622) (-1166.563) [-1165.696] (-1164.299) -- 0:00:03
938000 -- (-1168.616) [-1164.725] (-1168.922) (-1167.091) * [-1165.270] (-1167.719) (-1164.773) (-1164.802) -- 0:00:03
938500 -- (-1167.211) (-1165.497) [-1165.173] (-1165.039) * (-1165.755) (-1168.552) (-1164.660) [-1164.476] -- 0:00:03
939000 -- (-1164.100) (-1168.244) (-1164.657) [-1167.007] * (-1165.483) [-1165.724] (-1168.862) (-1165.229) -- 0:00:03
939500 -- (-1165.284) (-1164.043) [-1165.887] (-1166.644) * (-1165.317) (-1163.810) (-1166.040) [-1166.431] -- 0:00:03
940000 -- (-1165.979) [-1165.138] (-1170.403) (-1165.869) * (-1166.550) (-1165.913) (-1165.588) [-1165.508] -- 0:00:03
Average standard deviation of split frequencies: 0.008720
940500 -- (-1165.697) (-1166.480) (-1168.537) [-1165.723] * (-1164.879) [-1166.253] (-1167.175) (-1163.464) -- 0:00:03
941000 -- (-1164.837) [-1166.788] (-1166.195) (-1165.508) * (-1167.056) (-1164.290) [-1163.393] (-1164.589) -- 0:00:03
941500 -- [-1164.402] (-1170.474) (-1164.539) (-1166.674) * (-1165.444) (-1166.193) [-1163.828] (-1165.384) -- 0:00:03
942000 -- (-1172.423) (-1164.990) [-1164.132] (-1165.367) * [-1164.701] (-1164.959) (-1164.114) (-1163.913) -- 0:00:03
942500 -- (-1165.202) [-1167.226] (-1166.731) (-1164.406) * [-1164.243] (-1164.141) (-1164.635) (-1163.982) -- 0:00:03
943000 -- (-1167.214) (-1164.822) (-1168.530) [-1164.100] * (-1163.602) (-1164.361) (-1164.369) [-1165.100] -- 0:00:03
943500 -- (-1166.018) (-1167.039) [-1167.148] (-1163.649) * (-1166.119) [-1164.159] (-1164.768) (-1165.238) -- 0:00:03
944000 -- [-1165.750] (-1172.620) (-1165.587) (-1163.671) * [-1165.020] (-1165.351) (-1165.737) (-1165.926) -- 0:00:03
944500 -- (-1166.798) (-1165.588) [-1165.284] (-1165.311) * (-1164.827) (-1167.000) [-1165.079] (-1173.691) -- 0:00:03
945000 -- (-1167.642) (-1168.019) [-1166.399] (-1165.681) * (-1167.482) (-1164.539) (-1164.964) [-1164.884] -- 0:00:03
Average standard deviation of split frequencies: 0.008637
945500 -- [-1164.306] (-1167.376) (-1163.683) (-1164.950) * [-1168.432] (-1169.406) (-1164.738) (-1167.404) -- 0:00:03
946000 -- [-1164.163] (-1165.539) (-1165.815) (-1165.010) * (-1163.623) (-1169.062) [-1164.141] (-1165.936) -- 0:00:03
946500 -- (-1165.063) [-1163.603] (-1170.658) (-1167.931) * (-1166.274) [-1165.292] (-1165.876) (-1164.206) -- 0:00:03
947000 -- (-1165.400) (-1168.611) [-1166.648] (-1163.962) * (-1171.089) (-1167.661) [-1169.132] (-1163.758) -- 0:00:03
947500 -- [-1164.194] (-1165.434) (-1164.619) (-1164.161) * [-1165.272] (-1168.632) (-1165.850) (-1164.160) -- 0:00:03
948000 -- [-1167.731] (-1164.294) (-1164.973) (-1168.684) * [-1163.974] (-1169.685) (-1164.788) (-1164.807) -- 0:00:03
948500 -- (-1165.841) (-1165.843) (-1164.666) [-1165.886] * [-1165.427] (-1164.192) (-1167.077) (-1168.664) -- 0:00:03
949000 -- (-1167.197) (-1163.757) [-1168.290] (-1166.879) * (-1164.847) (-1166.055) (-1169.584) [-1165.947] -- 0:00:03
949500 -- (-1167.206) [-1166.548] (-1165.965) (-1169.055) * (-1164.848) [-1165.919] (-1165.842) (-1167.418) -- 0:00:03
950000 -- (-1168.501) (-1166.623) (-1165.926) [-1164.713] * [-1163.564] (-1165.004) (-1165.414) (-1163.471) -- 0:00:03
Average standard deviation of split frequencies: 0.008364
950500 -- (-1169.164) (-1163.575) [-1163.538] (-1164.798) * (-1164.161) [-1163.669] (-1165.828) (-1163.484) -- 0:00:03
951000 -- [-1166.398] (-1163.590) (-1169.296) (-1165.270) * (-1164.672) (-1164.304) [-1163.697] (-1163.786) -- 0:00:03
951500 -- (-1165.927) (-1164.315) [-1164.913] (-1168.153) * (-1164.617) (-1165.974) (-1164.364) [-1164.976] -- 0:00:03
952000 -- [-1164.510] (-1167.887) (-1165.530) (-1164.894) * (-1164.935) [-1165.310] (-1166.183) (-1164.588) -- 0:00:02
952500 -- (-1166.437) (-1165.614) [-1167.256] (-1164.163) * (-1167.806) [-1166.993] (-1167.375) (-1169.657) -- 0:00:02
953000 -- (-1165.649) (-1171.501) (-1168.323) [-1164.878] * (-1164.093) (-1167.260) (-1164.979) [-1166.062] -- 0:00:02
953500 -- (-1165.233) (-1168.018) (-1167.985) [-1166.956] * (-1165.881) [-1169.309] (-1169.198) (-1165.873) -- 0:00:02
954000 -- (-1167.580) (-1164.455) (-1165.515) [-1164.377] * (-1166.767) (-1168.327) [-1166.060] (-1164.628) -- 0:00:02
954500 -- (-1169.791) (-1166.403) (-1164.874) [-1164.144] * [-1164.484] (-1164.983) (-1164.339) (-1164.678) -- 0:00:02
955000 -- (-1164.254) (-1164.453) (-1165.326) [-1166.879] * (-1165.558) (-1165.155) (-1167.077) [-1167.888] -- 0:00:02
Average standard deviation of split frequencies: 0.008317
955500 -- (-1165.111) (-1170.809) (-1169.774) [-1164.821] * (-1166.633) [-1165.353] (-1165.176) (-1164.728) -- 0:00:02
956000 -- (-1166.249) [-1164.081] (-1165.776) (-1164.057) * [-1166.753] (-1165.970) (-1170.840) (-1164.797) -- 0:00:02
956500 -- [-1164.942] (-1166.931) (-1164.827) (-1164.351) * (-1166.309) (-1168.311) [-1164.231] (-1164.923) -- 0:00:02
957000 -- (-1165.878) (-1168.577) (-1169.020) [-1165.478] * (-1164.687) (-1166.533) (-1164.247) [-1165.602] -- 0:00:02
957500 -- [-1167.682] (-1169.189) (-1167.878) (-1164.450) * (-1167.889) (-1164.775) (-1164.282) [-1165.188] -- 0:00:02
958000 -- (-1164.748) [-1168.593] (-1165.063) (-1165.268) * [-1163.518] (-1164.737) (-1164.529) (-1165.362) -- 0:00:02
958500 -- (-1166.265) [-1168.110] (-1167.426) (-1165.931) * (-1165.926) (-1164.649) [-1164.849] (-1169.151) -- 0:00:02
959000 -- (-1165.484) (-1165.626) (-1165.391) [-1164.984] * (-1165.455) (-1164.829) [-1163.806] (-1164.173) -- 0:00:02
959500 -- [-1163.752] (-1171.260) (-1165.415) (-1165.535) * (-1165.360) (-1165.301) (-1165.907) [-1167.212] -- 0:00:02
960000 -- [-1167.324] (-1165.838) (-1164.155) (-1165.745) * (-1166.178) (-1163.485) [-1164.672] (-1166.132) -- 0:00:02
Average standard deviation of split frequencies: 0.007982
960500 -- (-1165.128) [-1164.816] (-1164.791) (-1166.107) * (-1163.634) (-1163.526) (-1164.130) [-1165.143] -- 0:00:02
961000 -- (-1164.439) (-1163.750) (-1166.346) [-1167.208] * (-1164.480) [-1168.921] (-1163.906) (-1169.740) -- 0:00:02
961500 -- (-1166.814) (-1164.885) (-1166.941) [-1165.527] * (-1166.066) [-1164.886] (-1165.796) (-1164.449) -- 0:00:02
962000 -- [-1166.696] (-1164.505) (-1164.827) (-1166.131) * (-1166.787) (-1166.467) [-1164.981] (-1166.360) -- 0:00:02
962500 -- (-1168.180) (-1163.793) (-1167.646) [-1165.716] * [-1166.473] (-1164.470) (-1163.868) (-1168.542) -- 0:00:02
963000 -- (-1165.188) (-1163.647) [-1165.628] (-1165.787) * (-1164.275) (-1165.106) (-1164.172) [-1164.509] -- 0:00:02
963500 -- (-1169.339) (-1163.854) (-1165.950) [-1164.034] * (-1164.894) [-1166.743] (-1164.929) (-1165.976) -- 0:00:02
964000 -- [-1165.860] (-1167.212) (-1166.824) (-1169.865) * (-1170.551) (-1164.001) [-1165.378] (-1164.683) -- 0:00:02
964500 -- (-1165.152) [-1167.299] (-1165.313) (-1164.600) * (-1166.619) (-1164.510) [-1164.919] (-1167.365) -- 0:00:02
965000 -- [-1166.097] (-1167.592) (-1169.083) (-1170.541) * (-1169.887) [-1164.596] (-1163.332) (-1167.533) -- 0:00:02
Average standard deviation of split frequencies: 0.008361
965500 -- [-1165.066] (-1166.301) (-1164.329) (-1166.003) * (-1167.723) (-1173.107) (-1163.782) [-1166.112] -- 0:00:02
966000 -- (-1165.162) (-1166.743) (-1166.331) [-1163.910] * [-1164.483] (-1164.504) (-1164.860) (-1165.894) -- 0:00:02
966500 -- [-1164.492] (-1165.659) (-1169.266) (-1168.606) * (-1165.130) [-1166.854] (-1165.724) (-1165.406) -- 0:00:02
967000 -- (-1164.931) (-1167.465) (-1167.762) [-1167.546] * (-1165.691) [-1166.414] (-1164.652) (-1171.130) -- 0:00:02
967500 -- (-1165.437) (-1164.878) (-1168.327) [-1166.222] * (-1165.001) (-1164.744) [-1164.122] (-1168.480) -- 0:00:02
968000 -- (-1167.673) [-1163.870] (-1164.323) (-1165.429) * [-1166.025] (-1169.487) (-1165.049) (-1164.449) -- 0:00:01
968500 -- (-1164.680) [-1168.114] (-1166.495) (-1166.431) * (-1167.500) [-1169.625] (-1165.122) (-1164.427) -- 0:00:01
969000 -- [-1164.851] (-1164.302) (-1166.133) (-1166.918) * [-1168.453] (-1167.903) (-1163.470) (-1164.925) -- 0:00:01
969500 -- (-1166.006) [-1167.149] (-1164.685) (-1167.615) * (-1165.786) (-1168.146) (-1165.529) [-1165.922] -- 0:00:01
970000 -- (-1165.540) (-1166.372) [-1165.911] (-1165.730) * (-1174.559) [-1167.347] (-1165.013) (-1164.786) -- 0:00:01
Average standard deviation of split frequencies: 0.008450
970500 -- [-1165.755] (-1164.357) (-1168.331) (-1165.839) * [-1165.876] (-1165.585) (-1164.996) (-1166.031) -- 0:00:01
971000 -- (-1168.257) [-1166.367] (-1165.359) (-1165.934) * (-1166.567) (-1165.049) (-1166.268) [-1165.601] -- 0:00:01
971500 -- (-1165.526) (-1165.047) [-1166.546] (-1165.947) * (-1164.849) (-1169.131) (-1165.237) [-1166.164] -- 0:00:01
972000 -- (-1168.528) [-1164.294] (-1165.308) (-1164.548) * (-1164.657) (-1166.454) (-1165.741) [-1164.914] -- 0:00:01
972500 -- (-1167.931) (-1164.486) [-1164.061] (-1165.619) * (-1169.954) (-1164.345) (-1167.616) [-1164.788] -- 0:00:01
973000 -- (-1164.416) (-1164.085) [-1163.974] (-1163.608) * (-1165.318) (-1164.605) [-1164.376] (-1165.230) -- 0:00:01
973500 -- [-1165.679] (-1164.906) (-1163.790) (-1164.535) * (-1167.341) (-1165.937) [-1165.409] (-1166.143) -- 0:00:01
974000 -- (-1166.303) (-1168.161) [-1164.437] (-1166.907) * (-1164.679) (-1166.443) (-1164.253) [-1165.521] -- 0:00:01
974500 -- (-1167.313) (-1165.048) [-1163.734] (-1164.067) * (-1166.827) (-1165.489) [-1164.693] (-1168.668) -- 0:00:01
975000 -- [-1169.619] (-1166.659) (-1163.668) (-1164.271) * (-1164.192) (-1165.175) [-1164.303] (-1164.944) -- 0:00:01
Average standard deviation of split frequencies: 0.008340
975500 -- (-1166.305) (-1166.418) [-1163.893] (-1164.243) * (-1166.647) (-1165.678) [-1165.746] (-1166.382) -- 0:00:01
976000 -- (-1164.366) (-1165.687) (-1164.352) [-1166.844] * (-1164.367) (-1169.435) [-1165.352] (-1168.496) -- 0:00:01
976500 -- (-1164.766) (-1169.089) (-1165.060) [-1165.564] * [-1164.137] (-1163.895) (-1165.225) (-1169.664) -- 0:00:01
977000 -- (-1165.157) (-1168.701) [-1163.956] (-1165.142) * [-1166.157] (-1165.091) (-1167.353) (-1166.194) -- 0:00:01
977500 -- (-1165.304) (-1173.408) [-1166.153] (-1164.394) * (-1163.489) (-1167.792) [-1167.051] (-1167.231) -- 0:00:01
978000 -- (-1164.162) [-1167.432] (-1166.809) (-1163.884) * (-1163.576) [-1163.896] (-1164.763) (-1166.150) -- 0:00:01
978500 -- (-1166.623) (-1164.203) (-1168.967) [-1163.998] * (-1166.187) (-1163.716) (-1164.944) [-1167.058] -- 0:00:01
979000 -- (-1164.174) (-1165.683) (-1165.255) [-1165.115] * (-1167.588) (-1163.890) (-1165.105) [-1164.019] -- 0:00:01
979500 -- [-1164.508] (-1165.571) (-1165.965) (-1163.790) * (-1168.409) (-1163.813) (-1164.723) [-1164.986] -- 0:00:01
980000 -- [-1165.300] (-1164.994) (-1163.501) (-1165.323) * (-1169.551) (-1163.797) (-1167.644) [-1165.117] -- 0:00:01
Average standard deviation of split frequencies: 0.008108
980500 -- (-1164.894) (-1165.401) [-1167.107] (-1166.965) * (-1167.847) [-1164.933] (-1165.398) (-1164.121) -- 0:00:01
981000 -- (-1164.746) (-1166.753) (-1164.615) [-1165.201] * (-1164.551) (-1168.009) [-1164.888] (-1164.450) -- 0:00:01
981500 -- [-1165.242] (-1167.131) (-1163.706) (-1165.312) * (-1164.380) (-1169.028) (-1163.893) [-1164.295] -- 0:00:01
982000 -- (-1164.028) (-1164.479) (-1167.863) [-1166.659] * [-1164.380] (-1166.323) (-1168.513) (-1166.964) -- 0:00:01
982500 -- [-1164.598] (-1165.964) (-1165.691) (-1164.576) * (-1164.360) [-1165.395] (-1164.878) (-1163.495) -- 0:00:01
983000 -- [-1167.635] (-1164.123) (-1164.408) (-1167.266) * (-1164.110) (-1163.400) (-1165.864) [-1164.663] -- 0:00:01
983500 -- [-1164.780] (-1168.071) (-1168.482) (-1169.407) * (-1164.460) (-1164.775) (-1181.630) [-1166.117] -- 0:00:01
984000 -- (-1164.504) (-1164.389) (-1166.632) [-1167.383] * (-1167.662) [-1164.871] (-1175.210) (-1166.896) -- 0:00:00
984500 -- (-1165.083) [-1167.388] (-1167.074) (-1168.394) * (-1165.113) [-1163.289] (-1167.444) (-1166.416) -- 0:00:00
985000 -- [-1167.437] (-1165.463) (-1164.366) (-1167.827) * [-1164.568] (-1165.600) (-1165.551) (-1165.511) -- 0:00:00
Average standard deviation of split frequencies: 0.008064
985500 -- (-1165.115) [-1165.895] (-1164.682) (-1169.909) * (-1163.225) [-1163.907] (-1166.240) (-1165.150) -- 0:00:00
986000 -- (-1167.426) (-1168.327) (-1168.488) [-1166.004] * (-1165.290) (-1164.998) (-1167.169) [-1165.127] -- 0:00:00
986500 -- (-1165.619) (-1167.159) (-1166.524) [-1167.131] * (-1165.914) [-1169.241] (-1165.191) (-1164.797) -- 0:00:00
987000 -- (-1165.214) [-1165.196] (-1164.474) (-1163.852) * [-1164.480] (-1168.422) (-1168.598) (-1164.529) -- 0:00:00
987500 -- (-1167.476) [-1164.631] (-1167.616) (-1164.931) * (-1164.411) (-1167.015) [-1163.667] (-1164.084) -- 0:00:00
988000 -- [-1168.996] (-1165.839) (-1166.031) (-1168.124) * [-1165.710] (-1165.113) (-1163.398) (-1167.057) -- 0:00:00
988500 -- (-1168.461) (-1165.606) (-1166.414) [-1164.163] * (-1164.577) (-1164.170) [-1166.744] (-1167.280) -- 0:00:00
989000 -- (-1165.966) [-1165.461] (-1163.816) (-1168.275) * [-1163.970] (-1166.884) (-1168.250) (-1166.089) -- 0:00:00
989500 -- [-1164.562] (-1165.754) (-1167.001) (-1170.458) * (-1164.844) [-1164.394] (-1166.587) (-1167.148) -- 0:00:00
990000 -- (-1165.091) (-1168.451) [-1164.806] (-1166.900) * (-1167.825) [-1164.170] (-1163.265) (-1164.241) -- 0:00:00
Average standard deviation of split frequencies: 0.007899
990500 -- (-1165.186) [-1169.518] (-1167.138) (-1166.650) * (-1167.949) (-1165.295) (-1164.968) [-1163.613] -- 0:00:00
991000 -- [-1166.807] (-1167.406) (-1165.539) (-1171.456) * (-1166.700) (-1163.944) [-1164.624] (-1165.568) -- 0:00:00
991500 -- (-1166.618) (-1166.373) [-1167.271] (-1166.540) * (-1166.770) (-1165.243) (-1164.257) [-1165.555] -- 0:00:00
992000 -- (-1167.376) (-1173.615) (-1164.223) [-1163.836] * (-1167.687) (-1164.047) [-1165.487] (-1165.558) -- 0:00:00
992500 -- (-1167.703) (-1167.675) (-1166.255) [-1166.664] * [-1168.483] (-1168.582) (-1166.443) (-1164.565) -- 0:00:00
993000 -- [-1163.513] (-1165.021) (-1167.401) (-1166.478) * (-1167.695) [-1163.935] (-1168.726) (-1165.707) -- 0:00:00
993500 -- (-1166.162) (-1165.812) [-1166.023] (-1165.414) * [-1169.736] (-1163.942) (-1167.985) (-1163.827) -- 0:00:00
994000 -- (-1163.373) (-1165.139) [-1170.167] (-1163.869) * (-1167.947) [-1164.796] (-1171.079) (-1165.175) -- 0:00:00
994500 -- (-1164.739) (-1164.480) (-1166.706) [-1164.591] * (-1168.752) (-1164.988) (-1167.589) [-1165.088] -- 0:00:00
995000 -- [-1163.767] (-1167.406) (-1164.930) (-1164.565) * (-1163.910) [-1164.337] (-1169.231) (-1164.303) -- 0:00:00
Average standard deviation of split frequencies: 0.007794
995500 -- (-1166.788) (-1165.851) [-1166.771] (-1164.805) * (-1163.686) (-1165.700) [-1164.492] (-1163.513) -- 0:00:00
996000 -- [-1164.991] (-1166.461) (-1170.858) (-1164.224) * (-1168.941) (-1165.653) [-1164.359] (-1166.986) -- 0:00:00
996500 -- (-1166.146) (-1167.355) (-1167.216) [-1165.030] * (-1166.738) [-1165.116] (-1168.588) (-1165.187) -- 0:00:00
997000 -- (-1169.096) [-1170.468] (-1167.571) (-1166.566) * [-1164.371] (-1165.571) (-1168.607) (-1170.767) -- 0:00:00
997500 -- (-1167.450) (-1168.565) (-1165.801) [-1166.646] * (-1164.776) [-1167.225] (-1165.388) (-1165.595) -- 0:00:00
998000 -- (-1168.885) (-1165.822) [-1166.041] (-1165.383) * (-1166.794) (-1169.301) [-1164.800] (-1168.279) -- 0:00:00
998500 -- (-1167.656) (-1166.560) (-1166.056) [-1163.523] * (-1168.872) (-1167.571) (-1165.345) [-1164.985] -- 0:00:00
999000 -- (-1168.710) [-1165.332] (-1168.292) (-1165.087) * [-1167.567] (-1169.681) (-1164.359) (-1164.696) -- 0:00:00
999500 -- (-1167.762) (-1167.103) [-1165.908] (-1164.139) * [-1168.075] (-1169.941) (-1165.016) (-1163.810) -- 0:00:00
1000000 -- (-1167.729) (-1166.502) (-1166.815) [-1164.462] * (-1167.265) (-1168.358) (-1169.031) [-1164.251] -- 0:00:00
Average standard deviation of split frequencies: 0.008166
Analysis completed in 1 mins 2 seconds
Analysis used 60.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1163.16
Likelihood of best state for "cold" chain of run 2 was -1163.16
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 60 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.6 % ( 31 %) Dirichlet(Pi{all})
28.7 % ( 34 %) Slider(Pi{all})
78.3 % ( 43 %) Multiplier(Alpha{1,2})
78.2 % ( 57 %) Multiplier(Alpha{3})
18.7 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.6 % ( 22 %) Dirichlet(Pi{all})
29.3 % ( 21 %) Slider(Pi{all})
79.0 % ( 55 %) Multiplier(Alpha{1,2})
77.9 % ( 55 %) Multiplier(Alpha{3})
19.3 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.3 % ( 95 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166808 0.82 0.67
3 | 166173 166607 0.84
4 | 166897 166640 166875
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166722 0.82 0.67
3 | 166865 166521 0.84
4 | 166284 166305 167303
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1164.87
| 2 1 2 2 |
| 11 2 |
| 1 1 1 2 2 2 |
| 2 2 1 2 1 2 |
| 1 2 2 2 1 *1 1 221 1 1 2 21 2|
| 2 11 1 112 2 2 22 2 2 1 22 2 |
| 22 * * 1 2 12 2 2 2 1 2 1 11 11 |
| 1 1 * 1 2 1 21 21* 2 |
| 2 2 1 1 1* 22 1 1|
|2 2 1 1 1 1 1 2 1 |
| 1 2 2 1 2 12 |
| 1 1 |
| 1 |
| |
|1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1166.74
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1164.93 -1169.55
2 -1164.84 -1168.20
--------------------------------------
TOTAL -1164.88 -1169.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894183 0.092012 0.384396 1.499102 0.857381 1475.74 1488.37 1.000
r(A<->C){all} 0.167116 0.019030 0.000020 0.444038 0.131117 170.04 247.98 1.002
r(A<->G){all} 0.178841 0.021408 0.000017 0.468611 0.142210 194.28 237.71 1.004
r(A<->T){all} 0.161668 0.018238 0.000149 0.439781 0.128312 264.00 279.40 1.006
r(C<->G){all} 0.165204 0.020866 0.000020 0.453568 0.124922 162.04 195.89 1.000
r(C<->T){all} 0.166362 0.020202 0.000036 0.446721 0.128749 184.98 244.23 1.004
r(G<->T){all} 0.160808 0.019539 0.000057 0.444188 0.124227 206.38 214.99 1.000
pi(A){all} 0.177923 0.000171 0.152149 0.202559 0.177740 1215.37 1252.64 1.000
pi(C){all} 0.273617 0.000226 0.244997 0.302071 0.273587 1262.51 1339.52 1.000
pi(G){all} 0.338830 0.000258 0.308343 0.371267 0.338696 967.72 1138.50 1.000
pi(T){all} 0.209630 0.000193 0.178553 0.233995 0.209841 1249.17 1301.56 1.000
alpha{1,2} 0.419285 0.218805 0.000222 1.321084 0.252686 1358.48 1429.74 1.000
alpha{3} 0.461833 0.237063 0.000153 1.439187 0.300807 1133.10 1134.86 1.000
pinvar{all} 0.998262 0.000004 0.994386 0.999999 0.998942 988.89 1086.94 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..*.*.
9 -- ..****
10 -- .*.***
11 -- .*..*.
12 -- .*.*..
13 -- ..**..
14 -- ..*..*
15 -- ...*.*
16 -- .****.
17 -- ...**.
18 -- .***.*
19 -- ....**
20 -- .**.**
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 459 0.152898 0.014604 0.142572 0.163225 2
8 447 0.148901 0.008951 0.142572 0.155230 2
9 445 0.148235 0.005182 0.144570 0.151899 2
10 438 0.145903 0.003769 0.143238 0.148568 2
11 437 0.145570 0.008951 0.139241 0.151899 2
12 433 0.144237 0.011777 0.135909 0.152565 2
13 430 0.143238 0.008480 0.137242 0.149234 2
14 430 0.143238 0.005653 0.139241 0.147235 2
15 425 0.141572 0.013662 0.131912 0.151233 2
16 421 0.140240 0.003298 0.137908 0.142572 2
17 418 0.139241 0.012248 0.130580 0.147901 2
18 416 0.138574 0.008480 0.132578 0.144570 2
19 415 0.138241 0.012719 0.129247 0.147235 2
20 413 0.137575 0.004240 0.134577 0.140573 2
21 405 0.134910 0.000471 0.134577 0.135243 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/nadC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100276 0.010604 0.000000 0.313712 0.068264 1.000 2
length{all}[2] 0.097745 0.009499 0.000033 0.283408 0.069053 1.000 2
length{all}[3] 0.097261 0.009619 0.000083 0.293446 0.066857 1.000 2
length{all}[4] 0.099889 0.009926 0.000005 0.300698 0.068712 1.000 2
length{all}[5] 0.101336 0.010435 0.000001 0.304976 0.069047 1.000 2
length{all}[6] 0.101383 0.010947 0.000150 0.310640 0.069448 1.000 2
length{all}[7] 0.101486 0.011423 0.000168 0.316260 0.067573 1.004 2
length{all}[8] 0.088085 0.007187 0.000007 0.253402 0.062094 1.001 2
length{all}[9] 0.096030 0.010425 0.000448 0.315846 0.062843 1.000 2
length{all}[10] 0.103794 0.009686 0.000218 0.310019 0.077238 1.003 2
length{all}[11] 0.097587 0.010251 0.000420 0.316527 0.063454 1.003 2
length{all}[12] 0.107789 0.011311 0.000065 0.344218 0.070359 0.998 2
length{all}[13] 0.095605 0.009969 0.000043 0.282068 0.067305 1.000 2
length{all}[14] 0.090796 0.009240 0.000160 0.275460 0.062948 1.004 2
length{all}[15] 0.100955 0.010167 0.000370 0.311687 0.070770 1.005 2
length{all}[16] 0.101476 0.009854 0.000172 0.315421 0.069251 1.002 2
length{all}[17] 0.094805 0.009960 0.000144 0.301796 0.067337 0.998 2
length{all}[18] 0.089858 0.008084 0.000278 0.244391 0.061780 1.001 2
length{all}[19] 0.111274 0.011844 0.000170 0.337052 0.079312 0.998 2
length{all}[20] 0.096810 0.008854 0.000519 0.264404 0.066302 0.998 2
length{all}[21] 0.105936 0.010907 0.000223 0.293495 0.075660 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008166
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 858
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 286 / 286 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 286 / 286 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069873 0.109346 0.053619 0.044758 0.033710 0.068352 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1226.719003
Iterating by ming2
Initial: fx= 1226.719003
x= 0.06987 0.10935 0.05362 0.04476 0.03371 0.06835 0.30000 1.30000
1 h-m-p 0.0000 0.0001 686.8158 ++ 1170.151908 m 0.0001 13 | 1/8
2 h-m-p 0.0017 0.0110 44.4544 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 630.3005 ++ 1154.537444 m 0.0000 45 | 2/8
4 h-m-p 0.0007 0.0292 32.6822 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 564.2857 ++ 1144.484885 m 0.0000 76 | 3/8
6 h-m-p 0.0006 0.0509 25.9839 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 488.8347 ++ 1131.898576 m 0.0001 107 | 4/8
8 h-m-p 0.0011 0.0714 19.5832 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 399.7138 ++ 1131.030579 m 0.0000 138 | 5/8
10 h-m-p 0.0002 0.1071 13.0668 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 281.6478 ++ 1119.719943 m 0.0001 168 | 6/8
12 h-m-p 0.5201 8.0000 0.0000 ++ 1119.719943 m 8.0000 179 | 6/8
13 h-m-p 0.1124 8.0000 0.0009 -----Y 1119.719943 0 0.0000 197 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1119.719943 m 8.0000 213 | 6/8
15 h-m-p 0.0005 0.2486 1.2118 --------C 1119.719943 0 0.0000 234 | 6/8
16 h-m-p 0.1873 8.0000 0.0000 ----Y 1119.719943 0 0.0002 249 | 6/8
17 h-m-p 0.0234 8.0000 0.0000 Y 1119.719943 0 0.0234 262
Out..
lnL = -1119.719943
263 lfun, 263 eigenQcodon, 1578 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049083 0.032054 0.061942 0.078067 0.021360 0.019668 0.300256 0.670208 0.225925
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.506014
np = 9
lnL0 = -1191.137532
Iterating by ming2
Initial: fx= 1191.137532
x= 0.04908 0.03205 0.06194 0.07807 0.02136 0.01967 0.30026 0.67021 0.22593
1 h-m-p 0.0000 0.0001 647.2011 ++ 1159.719243 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 241.4647 ++ 1157.357813 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 875.3301 ++ 1147.158292 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 2351.8856 ++ 1133.293499 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 31034.4749 ++ 1125.415322 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 1316622.7641 ++ 1123.039336 m 0.0000 74 | 6/9
7 h-m-p 0.0008 0.0216 14.9540 -----------.. | 6/9
8 h-m-p 0.0000 0.0000 277.5247 ++ 1119.719868 m 0.0000 107 | 7/9
9 h-m-p 1.2467 8.0000 0.0000 ++ 1119.719868 m 8.0000 119 | 7/9
10 h-m-p 0.4630 8.0000 0.0001 +++ 1119.719868 m 8.0000 134 | 7/9
11 h-m-p 0.0121 6.0589 0.1386 -----Y 1119.719868 0 0.0000 153 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 C 1119.719868 0 0.0160 167 | 7/9
13 h-m-p 0.0160 8.0000 0.0004 +++++ 1119.719868 m 8.0000 184 | 7/9
14 h-m-p 0.0175 1.6024 0.1839 +++Y 1119.719868 0 0.9337 201 | 7/9
15 h-m-p 1.6000 8.0000 0.0005 Y 1119.719868 0 0.8904 215 | 7/9
16 h-m-p 1.6000 8.0000 0.0001 +Y 1119.719868 0 6.4000 230 | 7/9
17 h-m-p 0.7040 8.0000 0.0014 C 1119.719868 0 0.7040 244 | 7/9
18 h-m-p 1.6000 8.0000 0.0006 +C 1119.719868 0 5.6687 259 | 7/9
19 h-m-p 1.6000 8.0000 0.0002 ++ 1119.719868 m 8.0000 273 | 7/9
20 h-m-p 0.0160 8.0000 0.1052 +++C 1119.719868 0 1.0300 290 | 7/9
21 h-m-p 1.6000 8.0000 0.0018 ++ 1119.719867 m 8.0000 304 | 7/9
22 h-m-p 0.0408 3.2721 0.3563 -----------C 1119.719867 0 0.0000 329 | 7/9
23 h-m-p 0.0001 0.0315 10.0547 +++++ 1119.719776 m 0.0315 346 | 8/9
24 h-m-p 0.4672 2.3359 0.1354 ++ 1119.719704 m 2.3359 358 | 9/9
25 h-m-p 0.0160 8.0000 0.0000 Y 1119.719704 0 0.0160 371
Out..
lnL = -1119.719704
372 lfun, 1116 eigenQcodon, 4464 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018396 0.106348 0.043810 0.036002 0.049366 0.086349 0.000100 1.467386 0.455472 0.156190 1.422086
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.474620
np = 11
lnL0 = -1208.625020
Iterating by ming2
Initial: fx= 1208.625020
x= 0.01840 0.10635 0.04381 0.03600 0.04937 0.08635 0.00011 1.46739 0.45547 0.15619 1.42209
1 h-m-p 0.0000 0.0000 598.6784 ++ 1208.012735 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 351.7225 +++ 1179.596466 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0002 242.6863 ++ 1161.063807 m 0.0002 45 | 3/11
4 h-m-p 0.0001 0.0005 92.7771 ++ 1153.481147 m 0.0005 59 | 4/11
5 h-m-p 0.0002 0.0008 138.5917 ++ 1140.859783 m 0.0008 73 | 5/11
6 h-m-p 0.0000 0.0001 1238.2567 ++ 1130.218092 m 0.0001 87 | 6/11
7 h-m-p 0.0001 0.0004 311.6990 ++ 1123.990624 m 0.0004 101 | 7/11
8 h-m-p 0.0022 0.0108 2.8503 ++ 1119.719869 m 0.0108 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0006 ++ 1119.719869 m 8.0000 129 | 8/11
10 h-m-p 0.0072 0.7348 0.6555 ++++ 1119.719858 m 0.7348 148 | 9/11
11 h-m-p 0.1167 8.0000 0.4917 ++++ 1119.719728 m 8.0000 167 | 9/11
12 h-m-p 1.6000 8.0000 1.1424 ++ 1119.719705 m 8.0000 183 | 9/11
13 h-m-p 1.6000 8.0000 0.0663 ++ 1119.719704 m 8.0000 197 | 9/11
14 h-m-p 0.0546 8.0000 9.7222 -------Y 1119.719704 0 0.0000 220 | 9/11
15 h-m-p 1.6000 8.0000 0.0000 N 1119.719704 0 1.6000 234 | 9/11
16 h-m-p 0.0160 8.0000 0.0000 Y 1119.719704 0 0.0160 250
Out..
lnL = -1119.719704
251 lfun, 1004 eigenQcodon, 4518 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1119.767553 S = -1119.720669 -0.018100
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:03
did 20 / 55 patterns 0:03
did 30 / 55 patterns 0:03
did 40 / 55 patterns 0:03
did 50 / 55 patterns 0:03
did 55 / 55 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012564 0.025997 0.096393 0.062091 0.072335 0.051315 0.000100 0.769890 1.720762
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.699660
np = 9
lnL0 = -1206.087634
Iterating by ming2
Initial: fx= 1206.087634
x= 0.01256 0.02600 0.09639 0.06209 0.07234 0.05131 0.00011 0.76989 1.72076
1 h-m-p 0.0000 0.0000 638.8010 ++ 1205.402100 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0078 59.5394 +++++ 1187.509414 m 0.0078 29 | 2/9
3 h-m-p 0.0000 0.0001 353.6611 ++ 1182.557881 m 0.0001 41 | 3/9
4 h-m-p 0.0000 0.0013 737.8515 +++ 1150.748872 m 0.0013 54 | 4/9
5 h-m-p 0.0001 0.0005 355.7951 ++ 1146.909294 m 0.0005 66 | 5/9
6 h-m-p 0.0000 0.0002 674.0348 ++ 1138.683053 m 0.0002 78 | 6/9
7 h-m-p 0.0047 0.6816 34.1352 ------------.. | 6/9
8 h-m-p 0.0000 0.0003 272.2623 +++ 1119.719871 m 0.0003 113 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 1119.719871 m 8.0000 125 | 7/9
10 h-m-p 0.0511 8.0000 0.0012 ++++ 1119.719871 m 8.0000 141 | 7/9
11 h-m-p 0.0160 8.0000 1.2173 +++++ 1119.719857 m 8.0000 158 | 7/9
12 h-m-p 1.6000 8.0000 0.3257 ++ 1119.719857 m 8.0000 170 | 7/9
13 h-m-p 0.2607 8.0000 9.9964 +++ 1119.719854 m 8.0000 185 | 7/9
14 h-m-p 1.6000 8.0000 7.9323 ----------Y 1119.719854 0 0.0000 207 | 7/9
15 h-m-p 0.3383 8.0000 0.0000 C 1119.719854 0 0.0846 219
Out..
lnL = -1119.719854
220 lfun, 2420 eigenQcodon, 13200 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.040895 0.100704 0.074093 0.056948 0.052398 0.010166 0.000100 0.900000 0.879262 1.927918 1.299901
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.454627
np = 11
lnL0 = -1208.715806
Iterating by ming2
Initial: fx= 1208.715806
x= 0.04090 0.10070 0.07409 0.05695 0.05240 0.01017 0.00011 0.90000 0.87926 1.92792 1.29990
1 h-m-p 0.0000 0.0000 619.6934 ++ 1208.063392 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 230.4907 +++ 1192.373840 m 0.0003 31 | 2/11
3 h-m-p 0.0001 0.0005 208.9469 ++ 1150.652334 m 0.0005 45 | 3/11
4 h-m-p 0.0004 0.0019 95.6128 ++ 1140.144212 m 0.0019 59 | 4/11
5 h-m-p 0.0000 0.0000 1450117.4123 ++ 1136.884191 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 339011.3242 ++ 1128.140351 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 48103.9451 ++ 1119.719895 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 1119.719895 m 8.0000 115 | 7/11
9 h-m-p 0.0094 1.9825 0.1836 ---------C 1119.719895 0 0.0000 142 | 7/11
10 h-m-p 0.0160 8.0000 0.0010 +++++ 1119.719894 m 8.0000 163 | 7/11
11 h-m-p 0.0052 0.9980 1.4932 -----------Y 1119.719894 0 0.0000 192 | 7/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 1119.719894 m 8.0000 209 | 7/11
13 h-m-p 0.0016 0.8165 1.6817 -----------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0003 +++++ 1119.719894 m 8.0000 253 | 7/11
15 h-m-p 0.0101 3.5854 0.2140 ----------N 1119.719894 0 0.0000 281 | 7/11
16 h-m-p 0.0160 8.0000 0.0007 +++++ 1119.719892 m 8.0000 302 | 7/11
17 h-m-p 0.0195 1.6573 0.2982 ----------C 1119.719892 0 0.0000 330 | 7/11
18 h-m-p 0.0160 8.0000 0.0204 +++++ 1119.719839 m 8.0000 351 | 7/11
19 h-m-p 0.3447 1.7236 0.3381 -------------N 1119.719839 0 0.0000 382 | 7/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 1119.719839 m 8.0000 403 | 7/11
21 h-m-p 0.0114 5.6954 0.1706 -----------N 1119.719839 0 0.0000 432 | 7/11
22 h-m-p 0.0160 8.0000 0.0011 +++++ 1119.719834 m 8.0000 453 | 7/11
23 h-m-p 0.0494 4.5828 0.1811 -------------N 1119.719834 0 0.0000 484 | 7/11
24 h-m-p 0.0160 8.0000 0.0000 ----C 1119.719834 0 0.0000 506 | 7/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 1119.719834 m 8.0000 527 | 7/11
26 h-m-p 0.0123 6.1265 0.2565 -------------.. | 7/11
27 h-m-p 0.0160 8.0000 0.0006 +++++ 1119.719831 m 8.0000 577 | 7/11
28 h-m-p 0.0306 6.0447 0.1535 -----------Y 1119.719831 0 0.0000 606 | 7/11
29 h-m-p 0.0160 8.0000 0.0031 +++++ 1119.719817 m 8.0000 627 | 7/11
30 h-m-p 0.1472 6.8353 0.1660 ------------Y 1119.719817 0 0.0000 657 | 7/11
31 h-m-p 0.0160 8.0000 0.0024 +++++ 1119.719805 m 8.0000 678 | 7/11
32 h-m-p 0.1126 7.7223 0.1671 ---------------.. | 7/11
33 h-m-p 0.0160 8.0000 0.0008 +++++ 1119.719800 m 8.0000 730 | 7/11
34 h-m-p 0.0484 7.3672 0.1317 --------------.. | 7/11
35 h-m-p 0.0160 8.0000 0.0008 +++++ 1119.719794 m 8.0000 781 | 7/11
36 h-m-p 0.0521 7.6016 0.1285 -----------C 1119.719794 0 0.0000 810 | 7/11
37 h-m-p 0.0160 8.0000 0.0008 +++++ 1119.719791 m 8.0000 831 | 7/11
38 h-m-p 0.0307 2.0393 0.2086 ------------Y 1119.719791 0 0.0000 861 | 7/11
39 h-m-p 0.0160 8.0000 0.0012 +++++ 1119.719789 m 8.0000 882 | 7/11
40 h-m-p 0.0268 3.3595 0.3438 ------------Y 1119.719789 0 0.0000 912 | 7/11
41 h-m-p 0.0063 3.1595 0.0401 +++++ 1119.719750 m 3.1595 933 | 8/11
42 h-m-p 1.0995 8.0000 0.1108 ------------Y 1119.719750 0 0.0000 963 | 8/11
43 h-m-p 0.0160 8.0000 0.0004 -------------.. | 8/11
44 h-m-p 0.0160 8.0000 0.0003 +++++ 1119.719749 m 8.0000 1011 | 8/11
45 h-m-p 0.0160 8.0000 0.3398 ----------Y 1119.719749 0 0.0000 1038 | 8/11
46 h-m-p 0.0160 8.0000 0.0011 +++++ 1119.719747 m 8.0000 1058 | 8/11
47 h-m-p 0.0211 8.0000 0.4294 -----------Y 1119.719747 0 0.0000 1086 | 8/11
48 h-m-p 0.0160 8.0000 0.0001 -----N 1119.719747 0 0.0000 1108 | 8/11
49 h-m-p 0.0160 8.0000 0.0000 +++++ 1119.719747 m 8.0000 1128 | 8/11
50 h-m-p 0.0160 8.0000 0.3229 ----------Y 1119.719747 0 0.0000 1155 | 8/11
51 h-m-p 0.0160 8.0000 0.0002 +++++ 1119.719747 m 8.0000 1175 | 8/11
52 h-m-p 0.0160 8.0000 0.3667 ----------C 1119.719747 0 0.0000 1202 | 8/11
53 h-m-p 0.0160 8.0000 0.0001 -----C 1119.719747 0 0.0000 1224 | 8/11
54 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
55 h-m-p 0.0160 8.0000 0.0003 +++++ 1119.719746 m 8.0000 1272 | 8/11
56 h-m-p 0.0160 8.0000 0.3310 ----------C 1119.719746 0 0.0000 1299 | 8/11
57 h-m-p 0.0160 8.0000 0.0001 -----------Y 1119.719746 0 0.0000 1327 | 8/11
58 h-m-p 0.0160 8.0000 0.0001 +++++ 1119.719746 m 8.0000 1347 | 8/11
59 h-m-p 0.0006 0.2902 4.9847 +++++ 1119.719713 m 0.2902 1367 | 8/11
60 h-m-p -0.0000 -0.0000 3.0899
h-m-p: -0.00000000e+00 -0.00000000e+00 3.08991413e+00 1119.719713
.. | 8/11
61 h-m-p 0.0160 8.0000 0.0003 +++++ 1119.719712 m 8.0000 1395 | 9/11
62 h-m-p 0.0160 8.0000 0.5170 ----------Y 1119.719712 0 0.0000 1422 | 9/11
63 h-m-p 0.0160 8.0000 1.5604 -------------.. | 9/11
64 h-m-p 0.0160 8.0000 0.0003 +++++ 1119.719712 m 8.0000 1466 | 9/11
65 h-m-p 0.0035 0.0632 0.6035 ++
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
+ 1119.719704 m 0.0632 1483
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01722) = 8.126842e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01693) = 8.127747e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127294e-161 2000 rounds
| 10/11
66 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127298e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
N 1119.719704 0 1.6000 1499
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.411016e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01722) = 8.126843e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01693) = 8.127748e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
| 10/11
67 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
N 1119.719704 0 0.1000 1515
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
Out..
lnL = -1119.719704
1516 lfun, 18192 eigenQcodon, 100056 P(t)
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1119.781673 S = -1119.720673 -0.027115
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:30
did 20 / 55 patterns 0:31
did 30 / 55 patterns 0:31
did 40 / 55 patterns 0:31
did 50 / 55 patterns 0:31
did 55 / 55 patterns 0:31
QuantileBeta(0.15, 0.00500, 3.01707) = 8.127295e-161 2000 rounds
Time used: 0:31
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/10res/nadC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 286
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 3 3 3 3 3 3 | TAC 5 5 5 5 5 5 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 9 9 9 9 9 9 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 4 4 4 4 4 4 | His CAT 3 3 3 3 3 3 | Arg CGT 5 5 5 5 5 5
CTC 8 8 8 8 8 8 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 4 4 4 4 4 4 | CGA 7 7 7 7 7 7
CTG 17 17 17 17 17 17 | CCG 3 3 3 3 3 3 | CAG 5 5 5 5 5 5 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 7 7 7 7 7 7 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 6 6 6 6 6 6 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 6 6 6 6 6 6 | Asp GAT 9 9 9 9 9 9 | Gly GGT 9 9 9 9 9 9
GTC 10 10 10 10 10 10 | GCC 12 12 12 12 12 12 | GAC 12 12 12 12 12 12 | GGC 7 7 7 7 7 7
GTA 4 4 4 4 4 4 | GCA 5 5 5 5 5 5 | Glu GAA 5 5 5 5 5 5 | GGA 1 1 1 1 1 1
GTG 16 16 16 16 16 16 | GCG 12 12 12 12 12 12 | GAG 10 10 10 10 10 10 | GGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908210_1_1287_MLBR_RS06060
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
#2: NC_002677_1_NP_301889_1_761_nadC
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
#3: NZ_LVXE01000044_1_WP_010908210_1_1916_A3216_RS10815
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
#4: NZ_LYPH01000049_1_WP_010908210_1_1891_A8144_RS09025
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
#5: NZ_CP029543_1_WP_010908210_1_1309_DIJ64_RS06645
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
#6: NZ_AP014567_1_WP_010908210_1_1339_JK2ML_RS06795
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 18 | TAC 30 | TGC 18
Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 24 | His H CAT 18 | Arg R CGT 30
CTC 48 | CCC 6 | CAC 12 | CGC 18
CTA 12 | CCA 12 | Gln Q CAA 24 | CGA 42
CTG 102 | CCG 18 | CAG 30 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 12 | Ser S AGT 0
ATC 42 | ACC 42 | AAC 18 | AGC 6
ATA 12 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 30 | ACG 36 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 36 | Asp D GAT 54 | Gly G GGT 54
GTC 60 | GCC 72 | GAC 72 | GGC 42
GTA 24 | GCA 30 | Glu E GAA 30 | GGA 6
GTG 96 | GCG 72 | GAG 60 | GGG 48
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11189 C:0.26224 A:0.16783 G:0.45804
position 2: T:0.32867 C:0.25524 A:0.23077 G:0.18531
position 3: T:0.18881 C:0.30420 A:0.13287 G:0.37413
Average T:0.20979 C:0.27389 A:0.17716 G:0.33916
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1119.719943 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300256 1.299901
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908210_1_1287_MLBR_RS06060: 0.000004, NC_002677_1_NP_301889_1_761_nadC: 0.000004, NZ_LVXE01000044_1_WP_010908210_1_1916_A3216_RS10815: 0.000004, NZ_LYPH01000049_1_WP_010908210_1_1891_A8144_RS09025: 0.000004, NZ_CP029543_1_WP_010908210_1_1309_DIJ64_RS06645: 0.000004, NZ_AP014567_1_WP_010908210_1_1339_JK2ML_RS06795: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30026
omega (dN/dS) = 1.29990
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 625.9 232.1 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 625.9 232.1 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 625.9 232.1 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 625.9 232.1 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 625.9 232.1 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 625.9 232.1 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1119.719704 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908210_1_1287_MLBR_RS06060: 0.000004, NC_002677_1_NP_301889_1_761_nadC: 0.000004, NZ_LVXE01000044_1_WP_010908210_1_1916_A3216_RS10815: 0.000004, NZ_LYPH01000049_1_WP_010908210_1_1891_A8144_RS09025: 0.000004, NZ_CP029543_1_WP_010908210_1_1309_DIJ64_RS06645: 0.000004, NZ_AP014567_1_WP_010908210_1_1339_JK2ML_RS06795: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1119.719704 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999801 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908210_1_1287_MLBR_RS06060: 0.000004, NC_002677_1_NP_301889_1_761_nadC: 0.000004, NZ_LVXE01000044_1_WP_010908210_1_1916_A3216_RS10815: 0.000004, NZ_LYPH01000049_1_WP_010908210_1_1891_A8144_RS09025: 0.000004, NZ_CP029543_1_WP_010908210_1_1309_DIJ64_RS06645: 0.000004, NZ_AP014567_1_WP_010908210_1_1339_JK2ML_RS06795: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99980 0.00000 0.00020
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 633.1 224.9 0.0002 0.0000 0.0000 0.0 0.0
7..2 0.000 633.1 224.9 0.0002 0.0000 0.0000 0.0 0.0
7..3 0.000 633.1 224.9 0.0002 0.0000 0.0000 0.0 0.0
7..4 0.000 633.1 224.9 0.0002 0.0000 0.0000 0.0 0.0
7..5 0.000 633.1 224.9 0.0002 0.0000 0.0000 0.0 0.0
7..6 0.000 633.1 224.9 0.0002 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908210_1_1287_MLBR_RS06060)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1119.719854 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 42.338271 84.351417
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908210_1_1287_MLBR_RS06060: 0.000004, NC_002677_1_NP_301889_1_761_nadC: 0.000004, NZ_LVXE01000044_1_WP_010908210_1_1916_A3216_RS10815: 0.000004, NZ_LYPH01000049_1_WP_010908210_1_1891_A8144_RS09025: 0.000004, NZ_CP029543_1_WP_010908210_1_1309_DIJ64_RS06645: 0.000004, NZ_AP014567_1_WP_010908210_1_1339_JK2ML_RS06795: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 42.33827 q = 84.35142
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.26701 0.29086 0.30544 0.31728 0.32806 0.33860 0.34961 0.36199 0.37766 0.40435
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 633.1 224.9 0.3341 0.0000 0.0000 0.0 0.0
7..2 0.000 633.1 224.9 0.3341 0.0000 0.0000 0.0 0.0
7..3 0.000 633.1 224.9 0.3341 0.0000 0.0000 0.0 0.0
7..4 0.000 633.1 224.9 0.3341 0.0000 0.0000 0.0 0.0
7..5 0.000 633.1 224.9 0.3341 0.0000 0.0000 0.0 0.0
7..6 0.000 633.1 224.9 0.3341 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1119.719704 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 3.017073 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908210_1_1287_MLBR_RS06060: 0.000004, NC_002677_1_NP_301889_1_761_nadC: 0.000004, NZ_LVXE01000044_1_WP_010908210_1_1916_A3216_RS10815: 0.000004, NZ_LYPH01000049_1_WP_010908210_1_1891_A8144_RS09025: 0.000004, NZ_CP029543_1_WP_010908210_1_1309_DIJ64_RS06645: 0.000004, NZ_AP014567_1_WP_010908210_1_1339_JK2ML_RS06795: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 3.01707
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 633.1 224.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908210_1_1287_MLBR_RS06060)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:31