--- EXPERIMENT NOTES
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken
#
### General parameters ###
#
# The maximum number of sequences to use for the master file
sequence_limit=90
# The random seed
random_seed=3976763
#
### Alignment ###
#
# The alignment method: clustalw, muscle, kalign, t_coffee, or amap
align_method=muscle
# Minimum support value for amino acid positions in the alignment
tcoffee_min_score=3
#
### MrBayes ###
#
# Number of iterations in MrBayes
mrbayes_generations=1000000
# MrBayes burnin
mrbayes_burnin=2500
#
### FUBAR ###
#
# The maximum number of sequences to be used by FUBAR.
fubar_sequence_limit=90
# The number of FUBAR runs
fubar_runs=1
#
### codeML ###
#
# The maximum number of sequences to be used by CodeML
codeml_sequence_limit=30
# The number of CodeML runs
codeml_runs=1
# The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'.
codeml_models=1 2 7 8
#
### OmegaMap ###
#
# The maximum number of sequences to use in OmegaMap
omegamap_sequence_limit=90
# The number of OmegaMap runs
omegamap_runs=1
# The number of OmegaMap iterations
omegamap_iterations=2500
--- EXPERIMENT PROPERTIES
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1083.87 -1101.42
2 -1083.62 -1098.60
--------------------------------------
TOTAL -1083.74 -1100.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.098867 0.000926 0.045031 0.157211 0.094133 1335.05 1418.03 1.000
r(A<->C){all} 0.058271 0.001967 0.000004 0.142653 0.048044 483.12 541.15 1.000
r(A<->G){all} 0.267152 0.009609 0.096600 0.463915 0.254519 280.59 363.58 1.003
r(A<->T){all} 0.037752 0.000809 0.000014 0.093311 0.031202 702.96 766.43 1.000
r(C<->G){all} 0.033026 0.001124 0.000005 0.100338 0.022616 358.83 458.24 1.000
r(C<->T){all} 0.515192 0.010926 0.315603 0.713932 0.514288 348.18 350.54 1.005
r(G<->T){all} 0.088607 0.002054 0.013070 0.176698 0.081664 508.40 574.91 1.002
pi(A){all} 0.241928 0.000268 0.208806 0.273077 0.241804 831.11 1017.22 1.000
pi(C){all} 0.184106 0.000220 0.154269 0.211773 0.183782 1054.89 1170.95 1.000
pi(G){all} 0.204859 0.000239 0.175444 0.235277 0.204906 920.43 1169.14 1.000
pi(T){all} 0.369107 0.000341 0.334938 0.406509 0.368456 1090.31 1159.59 1.000
alpha{1,2} 0.125280 0.033237 0.000087 0.399204 0.076807 1086.59 1207.83 1.000
alpha{3} 1.935802 1.370690 0.227649 4.331500 1.673914 1113.73 1271.87 1.000
pinvar{all} 0.797703 0.005015 0.663103 0.909071 0.809955 1162.83 1200.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
--- CODEML SUMMARY
-- Starting log on Thu Oct 20 00:46:19 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=218
C1 MTGLFQTSFGDSVQAGVQHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C2 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C3 MTGLFQTSFGDSVQAGVHHLVEKLPLPDAHFQHALPLANFLMTSVFVIYF
C4 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C5 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C6 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C7 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C8 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
********* *******:**********.*********************
C1 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLM
C2 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C3 AMYKASSVRNNCIMLGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C4 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C5 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C6 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C7 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C8 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
**************:**********************************:
C1 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C2 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C3 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C4 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C5 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C6 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C7 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C8 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
**************************************************
C1 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C2 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C3 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C4 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C5 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C6 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C7 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C8 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
**************************************************
C1 NMCFSELRLCEEVEVQSD
C2 NMCFSELRLCEEVEVQSD
C3 NMCFSELRLCEEVEVQSD
C4 NMCFSELRLCEEVEVQSD
C5 NMCFSKLRLCEEVEVQSD
C6 NMCFSELRLCEEVEVQSD
C7 NMCFSELRLCEEVEVQSD
C8 NMCFSELRLCEEVEVQSD
*****:************
-- Starting log on Thu Oct 20 00:46:37 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.08 sec, SCORE=1000, Nseq=8, Len=218
C1 MTGLFQTSFGDSVQAGVQHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C2 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C3 MTGLFQTSFGDSVQAGVHHLVEKLPLPDAHFQHALPLANFLMTSVFVIYF
C4 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C5 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C6 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C7 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C8 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
********* *******:**********.*********************
C1 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLM
C2 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C3 AMYKASSVRNNCIMLGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C4 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C5 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C6 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C7 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C8 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
**************:**********************************:
C1 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C2 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C3 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C4 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C5 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C6 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C7 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C8 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
**************************************************
C1 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C2 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C3 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C4 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C5 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C6 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C7 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C8 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
**************************************************
C1 NMCFSELRLCEEVEVQSD
C2 NMCFSELRLCEEVEVQSD
C3 NMCFSELRLCEEVEVQSD
C4 NMCFSELRLCEEVEVQSD
C5 NMCFSKLRLCEEVEVQSD
C6 NMCFSELRLCEEVEVQSD
C7 NMCFSELRLCEEVEVQSD
C8 NMCFSELRLCEEVEVQSD
*****:************
-- Starting log on Thu Oct 20 00:46:19 GMT 2022 --
-- Iteration: /working_dir/input/2_modified/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result--
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=218
C1 MTGLFQTSFGDSVQAGVQHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C2 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C3 MTGLFQTSFGDSVQAGVHHLVEKLPLPDAHFQHALPLANFLMTSVFVIYF
C4 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C5 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C6 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C7 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
C8 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
********* *******:**********.*********************
C1 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLM
C2 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C3 AMYKASSVRNNCIMLGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C4 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C5 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
C6 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C7 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
C8 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
**************:**********************************:
C1 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C2 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C3 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C4 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C5 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C6 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C7 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
C8 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
**************************************************
C1 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C2 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C3 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C4 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C5 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C6 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C7 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
C8 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
**************************************************
C1 NMCFSELRLCEEVEVQSD
C2 NMCFSELRLCEEVEVQSD
C3 NMCFSELRLCEEVEVQSD
C4 NMCFSELRLCEEVEVQSD
C5 NMCFSKLRLCEEVEVQSD
C6 NMCFSELRLCEEVEVQSD
C7 NMCFSELRLCEEVEVQSD
C8 NMCFSELRLCEEVEVQSD
*****:************
-- Starting log on Thu Oct 20 00:56:01 GMT 2022 --
-- Iteration: /working_dir/pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/fubar,175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1--
MrBayes v3.2.6 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/mrbayes_input.nex"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 654 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1666227365
Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called 'first_pos'
Defining charset called 'second_pos'
Defining charset called 'third_pos'
Defining partition called 'by_codon'
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1408240035
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5197109330
Seed = 1778330943
Swapseed = 1666227365
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
The distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Shape parameter is exponentially
distributed with parameter (1.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Active parameters:
Partition(s)
Parameters 1 2 3
---------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
---------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(1.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
0.91 % Dirichlet(Revmat{all})
0.91 % Slider(Revmat{all})
0.91 % Dirichlet(Pi{all})
0.91 % Slider(Pi{all})
1.82 % Multiplier(Alpha{1,2})
1.82 % Multiplier(Alpha{3})
1.82 % Slider(Pinvar{all})
9.09 % ExtSPR(Tau{all},V{all})
9.09 % ExtTBR(Tau{all},V{all})
9.09 % NNI(Tau{all},V{all})
9.09 % ParsSPR(Tau{all},V{all})
36.36 % Multiplier(V{all})
12.73 % Nodeslider(V{all})
5.45 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 23 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1281.806712 -- 29.153684
Chain 2 -- -1299.124978 -- 29.153684
Chain 3 -- -1353.800114 -- 29.153684
Chain 4 -- -1346.763337 -- 29.153684
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1346.763491 -- 29.153684
Chain 2 -- -1304.455293 -- 29.153684
Chain 3 -- -1287.292271 -- 29.153684
Chain 4 -- -1316.231520 -- 29.153684
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1281.807] (-1299.125) (-1353.800) (-1346.763) * [-1346.763] (-1304.455) (-1287.292) (-1316.232)
1000 -- (-1119.603) (-1118.916) [-1111.893] (-1120.025) * (-1108.247) (-1123.955) [-1109.548] (-1114.330) -- 0:16:39
2000 -- (-1110.919) (-1110.490) [-1098.324] (-1110.947) * [-1105.408] (-1116.543) (-1109.040) (-1109.001) -- 0:08:19
3000 -- (-1098.632) [-1095.313] (-1101.281) (-1105.635) * (-1100.074) (-1123.397) [-1097.438] (-1102.482) -- 0:05:32
4000 -- (-1105.272) [-1093.791] (-1100.420) (-1103.258) * (-1093.275) (-1112.457) (-1100.147) [-1105.654] -- 0:04:09
5000 -- [-1091.697] (-1092.149) (-1095.513) (-1112.511) * (-1097.598) (-1103.537) (-1102.603) [-1106.119] -- 0:03:19
Average standard deviation of split frequencies: 0.101015
6000 -- (-1094.426) [-1086.222] (-1096.656) (-1100.118) * (-1092.954) (-1104.816) [-1093.039] (-1108.732) -- 0:05:31
7000 -- (-1090.217) (-1091.143) (-1115.656) [-1095.318] * (-1087.853) (-1106.640) (-1099.321) [-1099.366] -- 0:04:43
8000 -- (-1093.204) (-1098.364) (-1093.273) [-1089.752] * [-1085.645] (-1095.163) (-1099.181) (-1095.249) -- 0:04:08
9000 -- (-1087.897) (-1087.869) (-1099.260) [-1086.755] * (-1088.533) [-1091.203] (-1104.424) (-1104.239) -- 0:03:40
10000 -- [-1088.265] (-1095.961) (-1097.939) (-1086.617) * [-1084.955] (-1091.715) (-1100.569) (-1096.015) -- 0:03:18
Average standard deviation of split frequencies: 0.054393
11000 -- [-1094.322] (-1092.076) (-1099.661) (-1084.595) * [-1090.433] (-1096.570) (-1102.444) (-1104.608) -- 0:04:29
12000 -- (-1084.229) (-1092.725) (-1091.547) [-1082.212] * [-1093.597] (-1088.042) (-1101.182) (-1104.357) -- 0:04:07
13000 -- (-1092.380) (-1084.728) [-1098.010] (-1089.586) * (-1086.748) (-1092.802) [-1096.245] (-1103.585) -- 0:03:47
14000 -- (-1090.633) [-1088.522] (-1089.486) (-1095.327) * (-1087.828) [-1091.741] (-1098.127) (-1099.106) -- 0:03:31
15000 -- [-1088.862] (-1096.532) (-1086.891) (-1093.391) * (-1091.008) [-1090.202] (-1104.301) (-1101.237) -- 0:03:17
Average standard deviation of split frequencies: 0.038528
16000 -- (-1089.129) (-1089.430) [-1090.225] (-1092.609) * (-1086.605) (-1087.992) (-1095.443) [-1096.714] -- 0:04:06
17000 -- (-1090.099) (-1086.708) [-1088.483] (-1088.482) * (-1082.480) [-1091.946] (-1094.143) (-1098.944) -- 0:03:51
18000 -- [-1087.875] (-1087.455) (-1094.557) (-1086.527) * [-1089.263] (-1086.442) (-1094.877) (-1106.342) -- 0:03:38
19000 -- [-1085.755] (-1091.144) (-1084.149) (-1087.127) * [-1090.389] (-1087.802) (-1089.760) (-1108.214) -- 0:03:26
20000 -- (-1095.061) (-1095.550) [-1087.336] (-1084.656) * (-1094.628) [-1091.091] (-1088.953) (-1105.448) -- 0:03:16
Average standard deviation of split frequencies: 0.038601
21000 -- (-1084.409) (-1088.090) (-1085.259) [-1087.715] * [-1082.092] (-1086.137) (-1087.821) (-1102.626) -- 0:03:53
22000 -- (-1090.194) (-1098.087) [-1090.365] (-1087.060) * (-1097.549) (-1089.869) [-1088.151] (-1099.956) -- 0:03:42
23000 -- (-1095.194) [-1092.631] (-1092.653) (-1091.049) * (-1088.706) (-1088.720) [-1099.170] (-1106.775) -- 0:03:32
24000 -- (-1088.062) (-1088.420) [-1091.005] (-1088.713) * (-1089.838) (-1088.702) [-1089.032] (-1098.123) -- 0:03:23
25000 -- (-1093.265) (-1098.870) (-1086.535) [-1092.930] * (-1093.556) [-1088.540] (-1091.239) (-1101.754) -- 0:03:15
Average standard deviation of split frequencies: 0.041841
26000 -- (-1083.208) (-1099.476) (-1084.704) [-1092.473] * (-1085.001) [-1091.485] (-1097.007) (-1096.263) -- 0:03:07
27000 -- (-1091.959) (-1098.976) (-1086.181) [-1086.450] * (-1093.287) [-1078.569] (-1083.367) (-1097.174) -- 0:03:36
28000 -- (-1085.439) [-1095.309] (-1091.253) (-1084.740) * (-1088.061) (-1095.964) (-1086.530) [-1093.306] -- 0:03:28
29000 -- [-1089.449] (-1090.438) (-1097.928) (-1088.103) * (-1093.795) (-1090.074) [-1088.569] (-1099.623) -- 0:03:20
30000 -- (-1089.801) (-1094.321) (-1087.641) [-1095.801] * (-1091.405) [-1083.705] (-1089.955) (-1103.892) -- 0:03:14
Average standard deviation of split frequencies: 0.042568
31000 -- (-1089.820) (-1093.265) (-1092.224) [-1090.687] * (-1089.368) [-1087.519] (-1091.582) (-1091.990) -- 0:03:07
32000 -- (-1097.698) (-1097.788) (-1090.462) [-1088.119] * (-1085.921) [-1091.163] (-1089.967) (-1093.069) -- 0:03:31
33000 -- (-1091.859) [-1096.859] (-1092.885) (-1085.544) * (-1091.075) (-1083.641) [-1083.779] (-1091.446) -- 0:03:25
34000 -- [-1086.125] (-1098.980) (-1086.970) (-1093.056) * [-1095.003] (-1086.964) (-1092.994) (-1089.713) -- 0:03:18
35000 -- (-1092.551) (-1094.311) (-1090.407) [-1090.384] * (-1095.673) [-1090.131] (-1085.649) (-1091.514) -- 0:03:13
Average standard deviation of split frequencies: 0.043313
36000 -- (-1095.001) (-1094.863) (-1085.833) [-1087.591] * [-1091.062] (-1085.064) (-1085.767) (-1089.733) -- 0:03:07
37000 -- (-1087.133) [-1092.780] (-1086.260) (-1093.848) * [-1090.011] (-1091.149) (-1092.177) (-1088.236) -- 0:03:02
38000 -- [-1085.424] (-1099.730) (-1098.041) (-1095.070) * (-1087.695) (-1088.336) [-1087.232] (-1087.072) -- 0:03:22
39000 -- (-1095.582) (-1094.256) [-1095.449] (-1090.695) * [-1079.955] (-1088.730) (-1088.736) (-1086.295) -- 0:03:17
40000 -- (-1090.231) [-1096.650] (-1088.172) (-1088.627) * (-1082.569) (-1089.787) [-1088.184] (-1087.279) -- 0:03:12
Average standard deviation of split frequencies: 0.034776
41000 -- (-1090.671) [-1091.248] (-1086.900) (-1092.436) * [-1098.622] (-1088.221) (-1085.892) (-1089.279) -- 0:03:07
42000 -- (-1092.390) [-1093.436] (-1093.307) (-1092.459) * (-1089.907) (-1082.044) [-1087.414] (-1094.878) -- 0:03:02
43000 -- (-1087.304) [-1099.547] (-1087.861) (-1086.187) * (-1095.909) (-1086.435) [-1085.247] (-1092.995) -- 0:03:20
44000 -- (-1091.004) (-1097.563) [-1086.244] (-1093.044) * (-1090.735) (-1089.142) (-1092.746) [-1087.059] -- 0:03:15
45000 -- (-1093.291) [-1097.415] (-1087.907) (-1101.341) * [-1088.801] (-1088.113) (-1088.810) (-1106.878) -- 0:03:11
Average standard deviation of split frequencies: 0.032320
46000 -- (-1084.115) (-1097.819) (-1082.781) [-1097.552] * (-1089.635) (-1095.500) [-1090.135] (-1091.136) -- 0:03:06
47000 -- [-1082.679] (-1101.569) (-1088.953) (-1085.619) * (-1095.107) (-1085.428) [-1085.907] (-1083.859) -- 0:03:02
48000 -- (-1088.863) (-1099.180) (-1087.734) [-1089.045] * (-1096.983) (-1090.548) [-1093.424] (-1090.512) -- 0:03:18
49000 -- [-1086.403] (-1096.788) (-1088.517) (-1096.772) * (-1087.451) [-1084.826] (-1093.600) (-1086.687) -- 0:03:14
50000 -- (-1090.397) (-1097.122) [-1091.964] (-1081.288) * (-1089.535) (-1097.768) [-1090.731] (-1095.714) -- 0:03:10
Average standard deviation of split frequencies: 0.026481
51000 -- (-1087.243) [-1103.381] (-1084.181) (-1089.720) * (-1091.972) (-1085.740) (-1088.580) [-1089.722] -- 0:03:06
52000 -- [-1084.767] (-1095.248) (-1086.684) (-1087.967) * [-1089.959] (-1090.768) (-1087.285) (-1095.626) -- 0:03:02
53000 -- (-1092.608) [-1085.935] (-1089.208) (-1089.039) * (-1087.272) [-1087.729] (-1088.265) (-1093.079) -- 0:02:58
54000 -- (-1095.290) [-1093.475] (-1088.186) (-1092.484) * [-1083.645] (-1092.142) (-1086.743) (-1091.058) -- 0:03:12
55000 -- (-1093.444) [-1084.928] (-1083.733) (-1087.109) * [-1093.063] (-1083.917) (-1088.957) (-1092.528) -- 0:03:09
Average standard deviation of split frequencies: 0.033672
56000 -- [-1091.302] (-1096.258) (-1079.619) (-1088.331) * [-1087.875] (-1086.924) (-1083.013) (-1091.065) -- 0:03:05
57000 -- (-1096.685) (-1089.998) (-1096.578) [-1088.270] * (-1089.796) (-1085.412) [-1095.834] (-1095.178) -- 0:03:01
58000 -- [-1087.529] (-1087.176) (-1082.786) (-1085.474) * (-1096.799) (-1097.581) [-1085.923] (-1098.618) -- 0:02:58
59000 -- [-1086.038] (-1091.991) (-1088.536) (-1098.498) * (-1096.251) (-1089.119) (-1095.388) [-1091.767] -- 0:03:11
60000 -- (-1083.035) (-1090.119) (-1090.605) [-1086.269] * [-1088.219] (-1090.933) (-1095.947) (-1088.666) -- 0:03:08
Average standard deviation of split frequencies: 0.025702
61000 -- (-1096.628) (-1090.455) [-1095.095] (-1093.987) * [-1091.153] (-1090.712) (-1089.668) (-1087.107) -- 0:03:04
62000 -- (-1092.331) [-1091.608] (-1096.752) (-1103.641) * (-1093.222) [-1085.519] (-1099.844) (-1095.127) -- 0:03:01
63000 -- (-1095.797) (-1092.445) [-1090.460] (-1093.407) * (-1097.641) [-1088.214] (-1089.597) (-1091.385) -- 0:02:58
64000 -- (-1090.855) (-1083.475) (-1084.756) [-1084.727] * (-1098.777) (-1086.772) (-1092.500) [-1092.514] -- 0:03:10
65000 -- (-1090.276) (-1083.195) [-1086.305] (-1089.529) * [-1091.210] (-1094.441) (-1082.463) (-1101.649) -- 0:03:07
Average standard deviation of split frequencies: 0.021427
66000 -- (-1090.649) (-1094.084) (-1092.538) [-1084.572] * [-1090.878] (-1096.816) (-1094.893) (-1097.474) -- 0:03:03
67000 -- (-1092.732) [-1091.574] (-1091.515) (-1085.320) * (-1086.726) [-1091.130] (-1087.382) (-1094.884) -- 0:03:01
68000 -- (-1089.386) [-1088.969] (-1092.782) (-1098.322) * (-1093.833) (-1083.739) [-1090.765] (-1099.997) -- 0:02:58
69000 -- (-1101.648) (-1090.369) (-1093.245) [-1083.122] * (-1087.996) (-1086.166) [-1085.282] (-1097.859) -- 0:03:08
70000 -- [-1090.453] (-1089.793) (-1097.185) (-1087.517) * (-1089.424) (-1091.279) [-1087.491] (-1095.879) -- 0:03:06
Average standard deviation of split frequencies: 0.020012
71000 -- (-1093.500) (-1094.944) (-1096.765) [-1090.071] * (-1089.846) (-1090.479) (-1088.045) [-1090.021] -- 0:03:03
72000 -- (-1097.223) (-1091.488) [-1083.592] (-1087.249) * (-1086.228) (-1093.073) [-1089.260] (-1092.710) -- 0:03:00
73000 -- (-1086.853) (-1090.011) (-1085.300) [-1082.776] * (-1089.904) (-1091.551) (-1094.177) [-1094.383] -- 0:02:57
74000 -- [-1090.071] (-1086.946) (-1089.049) (-1086.248) * (-1090.274) (-1087.772) [-1087.006] (-1095.480) -- 0:03:07
75000 -- (-1085.041) (-1087.603) (-1090.249) [-1089.667] * [-1094.780] (-1092.397) (-1095.650) (-1092.194) -- 0:03:05
Average standard deviation of split frequencies: 0.021948
76000 -- (-1085.783) (-1093.847) (-1091.381) [-1087.930] * (-1091.433) (-1096.239) [-1087.431] (-1093.525) -- 0:03:02
77000 -- (-1108.636) [-1086.895] (-1089.802) (-1088.964) * (-1086.015) (-1089.527) [-1084.817] (-1093.738) -- 0:02:59
78000 -- [-1088.167] (-1092.991) (-1084.458) (-1093.602) * (-1082.826) (-1089.910) [-1085.472] (-1087.382) -- 0:02:57
79000 -- [-1083.322] (-1093.025) (-1090.773) (-1087.897) * (-1086.199) (-1092.783) [-1090.631] (-1088.918) -- 0:02:54
80000 -- [-1088.966] (-1094.232) (-1082.896) (-1093.259) * (-1086.465) (-1098.673) [-1087.982] (-1087.215) -- 0:03:04
Average standard deviation of split frequencies: 0.020678
81000 -- (-1091.776) (-1089.094) (-1084.926) [-1080.999] * (-1086.679) (-1093.147) (-1094.987) [-1092.643] -- 0:03:01
82000 -- (-1094.459) (-1090.723) [-1084.333] (-1083.799) * [-1086.216] (-1088.990) (-1083.363) (-1092.825) -- 0:02:59
83000 -- (-1098.135) (-1089.795) (-1090.221) [-1083.232] * [-1092.409] (-1093.058) (-1087.512) (-1088.315) -- 0:02:56
84000 -- [-1091.251] (-1087.531) (-1088.912) (-1092.844) * (-1088.158) (-1093.733) [-1086.518] (-1088.482) -- 0:02:54
85000 -- (-1090.532) (-1085.574) (-1089.768) [-1090.774] * (-1092.008) (-1089.953) (-1084.952) [-1088.694] -- 0:03:03
Average standard deviation of split frequencies: 0.018974
86000 -- (-1094.035) (-1096.983) (-1090.309) [-1079.458] * (-1093.917) (-1085.401) (-1087.695) [-1091.099] -- 0:03:00
87000 -- (-1094.676) (-1090.925) (-1088.431) [-1082.101] * [-1086.507] (-1090.436) (-1088.352) (-1087.747) -- 0:02:58
88000 -- (-1090.590) (-1085.018) [-1085.142] (-1090.451) * (-1091.131) (-1086.315) (-1090.200) [-1096.858] -- 0:02:56
89000 -- [-1085.263] (-1086.428) (-1086.338) (-1089.106) * (-1090.561) (-1085.036) (-1091.217) [-1086.487] -- 0:02:54
90000 -- (-1092.349) (-1084.780) (-1081.930) [-1081.729] * (-1100.922) [-1085.347] (-1089.760) (-1089.591) -- 0:03:02
Average standard deviation of split frequencies: 0.017598
91000 -- [-1091.242] (-1094.912) (-1087.330) (-1085.628) * (-1091.151) [-1088.173] (-1094.388) (-1088.791) -- 0:02:59
92000 -- (-1092.021) [-1087.558] (-1091.955) (-1088.092) * (-1099.382) [-1101.133] (-1090.110) (-1087.390) -- 0:02:57
93000 -- (-1086.290) (-1094.732) (-1088.119) [-1085.810] * (-1100.902) (-1096.398) (-1086.554) [-1091.124] -- 0:02:55
94000 -- (-1093.285) (-1090.166) (-1084.979) [-1085.620] * (-1093.881) (-1098.171) [-1087.026] (-1098.789) -- 0:02:53
95000 -- (-1092.717) (-1095.944) (-1089.964) [-1088.242] * (-1088.228) [-1091.130] (-1094.919) (-1093.092) -- 0:03:01
Average standard deviation of split frequencies: 0.017375
96000 -- [-1087.514] (-1097.829) (-1095.628) (-1087.942) * (-1084.437) (-1099.902) (-1089.237) [-1089.578] -- 0:02:58
97000 -- (-1092.336) (-1107.065) [-1084.497] (-1086.077) * (-1089.370) (-1096.305) (-1088.261) [-1091.903] -- 0:02:56
98000 -- (-1096.467) (-1094.273) (-1084.654) [-1086.944] * (-1087.035) (-1095.633) (-1092.400) [-1101.089] -- 0:02:54
99000 -- (-1084.592) (-1088.460) (-1090.657) [-1084.968] * (-1088.179) (-1094.802) [-1088.298] (-1101.113) -- 0:02:52
100000 -- (-1095.247) (-1093.428) (-1085.144) [-1085.561] * (-1082.411) [-1093.422] (-1093.077) (-1101.235) -- 0:02:51
Average standard deviation of split frequencies: 0.018011
101000 -- (-1097.694) (-1101.135) [-1085.649] (-1086.683) * (-1092.461) (-1103.569) [-1093.180] (-1093.948) -- 0:02:58
102000 -- (-1088.343) [-1092.639] (-1097.275) (-1090.400) * [-1088.647] (-1092.160) (-1098.999) (-1097.996) -- 0:02:56
103000 -- (-1095.821) [-1086.435] (-1081.670) (-1084.937) * (-1091.630) [-1094.599] (-1106.520) (-1096.623) -- 0:02:54
104000 -- (-1091.109) [-1088.094] (-1086.480) (-1086.154) * (-1085.832) [-1091.711] (-1093.022) (-1094.730) -- 0:02:52
105000 -- [-1092.170] (-1086.592) (-1099.975) (-1089.983) * (-1087.035) [-1084.734] (-1087.539) (-1089.488) -- 0:02:50
Average standard deviation of split frequencies: 0.017105
106000 -- [-1090.238] (-1082.215) (-1086.438) (-1088.706) * [-1092.133] (-1085.524) (-1094.404) (-1094.628) -- 0:02:57
107000 -- [-1086.782] (-1095.477) (-1089.109) (-1094.243) * [-1095.767] (-1096.692) (-1092.613) (-1090.899) -- 0:02:55
108000 -- (-1084.620) (-1110.311) [-1086.538] (-1084.520) * (-1095.726) (-1086.300) (-1089.888) [-1089.374] -- 0:02:53
109000 -- (-1095.964) [-1088.824] (-1093.686) (-1087.194) * [-1090.121] (-1086.837) (-1090.847) (-1082.585) -- 0:02:51
110000 -- (-1096.260) (-1099.855) [-1091.328] (-1090.088) * (-1095.997) [-1085.823] (-1087.080) (-1093.039) -- 0:02:49
Average standard deviation of split frequencies: 0.017366
111000 -- (-1089.762) [-1085.432] (-1090.472) (-1090.599) * [-1087.226] (-1083.061) (-1092.836) (-1092.043) -- 0:02:56
112000 -- (-1086.951) (-1093.092) (-1092.764) [-1086.487] * [-1088.084] (-1088.953) (-1087.508) (-1099.498) -- 0:02:54
113000 -- (-1090.736) (-1089.392) [-1082.206] (-1095.088) * (-1091.456) (-1085.017) [-1090.183] (-1097.463) -- 0:02:52
114000 -- (-1090.948) (-1089.264) (-1091.506) [-1087.031] * (-1091.418) (-1083.986) [-1088.941] (-1091.228) -- 0:02:50
115000 -- (-1090.195) (-1086.549) [-1082.135] (-1091.168) * (-1093.806) [-1084.205] (-1088.176) (-1094.899) -- 0:02:49
Average standard deviation of split frequencies: 0.017193
116000 -- [-1087.079] (-1089.342) (-1088.385) (-1096.060) * [-1087.643] (-1098.929) (-1099.764) (-1097.201) -- 0:02:55
117000 -- (-1087.221) [-1091.953] (-1088.495) (-1090.951) * (-1088.816) [-1082.912] (-1097.475) (-1091.348) -- 0:02:53
118000 -- (-1092.646) [-1084.112] (-1095.773) (-1091.685) * (-1104.239) (-1087.179) (-1094.590) [-1086.669] -- 0:02:51
119000 -- (-1092.039) [-1088.431] (-1093.081) (-1087.800) * (-1088.046) [-1085.404] (-1097.253) (-1090.991) -- 0:02:50
120000 -- [-1090.408] (-1093.042) (-1088.211) (-1092.653) * [-1083.892] (-1093.180) (-1088.592) (-1086.497) -- 0:02:48
Average standard deviation of split frequencies: 0.018031
121000 -- (-1089.685) (-1091.607) (-1085.287) [-1090.687] * (-1088.184) (-1093.083) (-1092.757) [-1085.180] -- 0:02:54
122000 -- [-1081.404] (-1090.300) (-1098.306) (-1091.448) * (-1084.146) (-1089.428) [-1094.484] (-1092.862) -- 0:02:52
123000 -- (-1089.062) [-1086.288] (-1087.891) (-1096.720) * [-1086.327] (-1090.371) (-1093.055) (-1092.530) -- 0:02:51
124000 -- [-1085.143] (-1094.876) (-1088.641) (-1094.595) * [-1088.734] (-1087.875) (-1092.288) (-1086.893) -- 0:02:49
125000 -- [-1086.027] (-1084.611) (-1083.136) (-1093.727) * (-1082.537) (-1088.594) (-1095.941) [-1089.324] -- 0:02:48
Average standard deviation of split frequencies: 0.018994
126000 -- (-1087.870) [-1082.298] (-1087.472) (-1089.251) * (-1089.308) (-1086.835) (-1095.636) [-1088.704] -- 0:02:46
127000 -- (-1088.383) (-1082.815) [-1087.017] (-1093.186) * (-1086.856) (-1091.146) [-1088.810] (-1090.952) -- 0:02:51
128000 -- (-1087.110) (-1092.019) (-1091.367) [-1090.636] * (-1082.285) [-1089.392] (-1089.128) (-1090.380) -- 0:02:50
129000 -- (-1089.073) (-1090.787) (-1092.772) [-1082.836] * (-1088.840) (-1094.480) [-1086.377] (-1087.102) -- 0:02:48
130000 -- (-1092.260) (-1089.248) [-1087.366] (-1102.614) * (-1084.507) (-1096.158) [-1088.815] (-1092.508) -- 0:02:47
Average standard deviation of split frequencies: 0.019981
131000 -- [-1081.250] (-1088.825) (-1080.785) (-1086.670) * [-1088.875] (-1088.766) (-1090.813) (-1098.446) -- 0:02:45
132000 -- (-1086.891) (-1094.833) (-1086.311) [-1087.040] * (-1092.693) [-1089.944] (-1089.697) (-1101.533) -- 0:02:50
133000 -- [-1092.863] (-1088.180) (-1082.285) (-1085.771) * [-1088.574] (-1089.690) (-1089.566) (-1090.163) -- 0:02:49
134000 -- (-1089.322) (-1094.429) (-1089.681) [-1084.900] * (-1097.276) (-1094.450) (-1095.631) [-1083.566] -- 0:02:48
135000 -- (-1084.440) (-1087.923) (-1095.630) [-1094.984] * (-1085.979) (-1097.333) [-1087.956] (-1095.910) -- 0:02:46
Average standard deviation of split frequencies: 0.020531
136000 -- (-1089.738) [-1093.046] (-1087.909) (-1088.788) * (-1093.632) (-1086.183) [-1087.045] (-1092.146) -- 0:02:45
137000 -- (-1092.219) (-1092.453) [-1090.085] (-1104.501) * [-1088.003] (-1088.253) (-1086.189) (-1084.984) -- 0:02:50
138000 -- (-1089.968) (-1090.065) [-1089.718] (-1094.376) * (-1094.829) [-1085.496] (-1088.202) (-1086.611) -- 0:02:48
139000 -- (-1085.082) [-1088.257] (-1092.344) (-1087.539) * [-1088.164] (-1093.913) (-1088.791) (-1086.707) -- 0:02:47
140000 -- (-1095.073) [-1084.023] (-1089.444) (-1096.105) * (-1088.157) [-1091.317] (-1095.329) (-1088.145) -- 0:02:45
Average standard deviation of split frequencies: 0.019850
141000 -- [-1088.101] (-1086.305) (-1090.460) (-1090.996) * (-1087.901) (-1093.995) (-1090.634) [-1088.513] -- 0:02:44
142000 -- (-1094.845) [-1085.394] (-1094.241) (-1093.320) * (-1094.154) [-1091.234] (-1093.267) (-1087.430) -- 0:02:49
143000 -- (-1097.215) [-1090.395] (-1091.537) (-1090.840) * (-1092.121) [-1092.737] (-1092.286) (-1095.480) -- 0:02:47
144000 -- (-1097.132) (-1084.374) [-1090.075] (-1092.235) * (-1085.481) (-1092.514) (-1097.344) [-1086.118] -- 0:02:46
145000 -- (-1091.214) [-1085.587] (-1090.722) (-1088.150) * (-1086.937) (-1095.111) (-1096.732) [-1096.540] -- 0:02:45
Average standard deviation of split frequencies: 0.019373
146000 -- [-1089.711] (-1097.054) (-1090.835) (-1088.708) * (-1092.791) [-1090.574] (-1100.876) (-1083.960) -- 0:02:43
147000 -- [-1092.828] (-1098.931) (-1093.668) (-1084.281) * [-1085.193] (-1089.620) (-1093.274) (-1086.128) -- 0:02:42
148000 -- [-1086.495] (-1091.771) (-1095.851) (-1087.774) * (-1087.878) [-1088.947] (-1094.891) (-1094.538) -- 0:02:46
149000 -- (-1092.776) (-1092.601) (-1091.389) [-1089.689] * (-1092.297) (-1091.309) [-1091.036] (-1088.261) -- 0:02:45
150000 -- [-1085.561] (-1091.679) (-1095.220) (-1086.125) * (-1088.237) [-1091.583] (-1090.293) (-1088.211) -- 0:02:44
Average standard deviation of split frequencies: 0.020217
151000 -- (-1090.494) (-1096.590) (-1095.171) [-1086.737] * (-1084.520) (-1093.588) (-1090.091) [-1087.834] -- 0:02:43
152000 -- [-1095.050] (-1100.330) (-1098.270) (-1087.724) * (-1086.436) (-1108.111) (-1092.021) [-1081.719] -- 0:02:41
153000 -- (-1101.098) [-1088.258] (-1089.333) (-1090.441) * (-1091.502) (-1097.677) [-1083.905] (-1086.848) -- 0:02:46
154000 -- (-1091.263) (-1085.721) [-1087.037] (-1089.293) * (-1088.615) [-1093.724] (-1093.952) (-1085.940) -- 0:02:44
155000 -- (-1096.106) [-1096.775] (-1092.601) (-1087.620) * (-1085.868) (-1088.944) [-1085.043] (-1090.714) -- 0:02:43
Average standard deviation of split frequencies: 0.016736
156000 -- (-1101.248) [-1096.495] (-1090.995) (-1089.790) * (-1093.256) [-1091.378] (-1101.052) (-1099.456) -- 0:02:42
157000 -- (-1104.432) (-1086.245) [-1088.791] (-1091.506) * (-1096.114) [-1090.105] (-1088.429) (-1081.175) -- 0:02:41
158000 -- (-1093.937) [-1093.555] (-1093.588) (-1093.175) * [-1086.961] (-1088.651) (-1090.382) (-1078.680) -- 0:02:45
159000 -- (-1091.736) [-1095.846] (-1095.184) (-1088.244) * (-1086.865) [-1082.179] (-1096.460) (-1080.942) -- 0:02:43
160000 -- (-1089.638) [-1083.515] (-1096.025) (-1097.797) * (-1092.016) (-1091.363) [-1086.574] (-1092.702) -- 0:02:42
Average standard deviation of split frequencies: 0.016927
161000 -- (-1091.069) (-1089.756) (-1085.166) [-1091.325] * (-1095.834) (-1093.101) [-1088.027] (-1084.439) -- 0:02:41
162000 -- (-1096.271) [-1092.503] (-1093.049) (-1096.379) * (-1090.570) [-1086.099] (-1092.378) (-1087.361) -- 0:02:40
163000 -- [-1081.436] (-1081.924) (-1084.819) (-1086.716) * (-1095.410) [-1084.604] (-1098.411) (-1092.021) -- 0:02:44
164000 -- (-1087.188) [-1078.229] (-1089.353) (-1091.424) * (-1094.472) [-1085.275] (-1089.805) (-1085.050) -- 0:02:43
165000 -- (-1091.200) [-1091.065] (-1094.963) (-1095.252) * (-1094.427) (-1090.466) [-1089.580] (-1089.320) -- 0:02:41
Average standard deviation of split frequencies: 0.017694
166000 -- [-1098.002] (-1094.542) (-1088.619) (-1088.165) * (-1096.448) (-1098.572) [-1093.848] (-1089.783) -- 0:02:40
167000 -- (-1086.748) (-1086.043) (-1084.667) [-1089.989] * (-1088.148) (-1086.536) (-1101.939) [-1093.363] -- 0:02:39
168000 -- (-1090.640) (-1086.948) (-1090.643) [-1090.578] * (-1087.097) (-1090.863) [-1086.209] (-1090.041) -- 0:02:43
169000 -- (-1088.183) (-1087.663) [-1088.652] (-1090.960) * (-1085.471) [-1086.590] (-1091.467) (-1094.729) -- 0:02:42
170000 -- (-1088.337) [-1086.361] (-1099.718) (-1092.338) * [-1091.443] (-1097.458) (-1088.607) (-1086.056) -- 0:02:41
Average standard deviation of split frequencies: 0.016148
171000 -- (-1084.095) (-1089.044) (-1089.225) [-1091.736] * [-1087.884] (-1095.746) (-1090.691) (-1089.552) -- 0:02:39
172000 -- (-1099.560) [-1090.195] (-1093.543) (-1092.092) * [-1089.821] (-1093.605) (-1087.934) (-1087.995) -- 0:02:38
173000 -- (-1093.454) [-1087.677] (-1082.306) (-1094.679) * (-1086.064) (-1091.946) (-1089.404) [-1087.173] -- 0:02:37
174000 -- (-1088.537) (-1091.550) (-1098.589) [-1088.043] * (-1096.619) (-1082.568) [-1090.448] (-1086.913) -- 0:02:41
175000 -- (-1084.463) (-1090.965) (-1084.680) [-1083.575] * (-1090.971) (-1090.638) [-1086.288] (-1090.296) -- 0:02:40
Average standard deviation of split frequencies: 0.016689
176000 -- (-1083.600) (-1080.547) (-1084.733) [-1092.368] * (-1090.411) (-1092.227) [-1085.774] (-1085.546) -- 0:02:39
177000 -- (-1092.891) (-1085.507) [-1086.089] (-1098.136) * (-1089.500) (-1091.516) (-1088.513) [-1082.855] -- 0:02:38
178000 -- (-1085.969) [-1081.638] (-1084.847) (-1091.118) * (-1095.178) (-1087.205) (-1084.807) [-1085.919] -- 0:02:37
179000 -- [-1088.373] (-1090.114) (-1088.531) (-1085.559) * (-1095.516) (-1093.828) [-1099.371] (-1085.467) -- 0:02:40
180000 -- (-1094.230) [-1088.036] (-1093.197) (-1099.488) * (-1090.622) (-1092.779) (-1090.697) [-1089.027] -- 0:02:39
Average standard deviation of split frequencies: 0.015856
181000 -- (-1091.747) (-1088.306) [-1085.716] (-1095.355) * [-1085.616] (-1085.000) (-1089.727) (-1089.475) -- 0:02:38
182000 -- [-1086.992] (-1094.377) (-1096.312) (-1090.390) * [-1092.528] (-1089.309) (-1091.122) (-1093.941) -- 0:02:37
183000 -- (-1088.439) (-1087.835) (-1090.671) [-1085.221] * (-1099.077) (-1095.340) (-1088.400) [-1082.583] -- 0:02:36
184000 -- (-1087.944) (-1089.867) (-1089.268) [-1087.880] * (-1092.056) [-1084.320] (-1090.053) (-1088.931) -- 0:02:39
185000 -- (-1089.489) (-1086.386) [-1095.705] (-1093.191) * (-1099.785) (-1082.050) [-1083.251] (-1089.925) -- 0:02:38
Average standard deviation of split frequencies: 0.014817
186000 -- (-1091.796) (-1086.112) (-1095.804) [-1086.970] * (-1088.055) (-1091.761) [-1084.753] (-1082.400) -- 0:02:37
187000 -- (-1106.354) [-1086.121] (-1095.151) (-1089.649) * (-1092.493) (-1092.561) [-1084.646] (-1090.564) -- 0:02:36
188000 -- (-1095.063) (-1088.134) [-1090.520] (-1091.646) * (-1093.842) [-1088.234] (-1089.514) (-1090.720) -- 0:02:35
189000 -- (-1088.877) (-1088.535) [-1090.336] (-1094.900) * (-1097.499) (-1088.826) (-1091.823) [-1090.208] -- 0:02:38
190000 -- (-1093.282) (-1088.701) (-1088.065) [-1081.768] * (-1095.591) (-1095.220) (-1091.957) [-1097.460] -- 0:02:37
Average standard deviation of split frequencies: 0.012362
191000 -- (-1093.332) [-1084.011] (-1088.271) (-1091.177) * (-1083.316) (-1099.667) [-1087.883] (-1092.185) -- 0:02:36
192000 -- (-1087.985) [-1091.579] (-1089.550) (-1092.654) * (-1089.178) [-1093.052] (-1092.587) (-1091.724) -- 0:02:35
193000 -- (-1088.933) (-1089.916) [-1092.041] (-1088.589) * [-1086.438] (-1090.194) (-1085.699) (-1091.704) -- 0:02:34
194000 -- (-1089.198) (-1093.050) (-1093.987) [-1086.186] * [-1083.448] (-1085.388) (-1087.345) (-1094.020) -- 0:02:37
195000 -- (-1091.990) [-1086.515] (-1090.155) (-1083.321) * [-1087.871] (-1086.804) (-1083.892) (-1096.299) -- 0:02:36
Average standard deviation of split frequencies: 0.015171
196000 -- (-1091.580) (-1094.431) [-1088.528] (-1085.931) * (-1086.713) [-1088.376] (-1095.121) (-1107.145) -- 0:02:35
197000 -- (-1093.902) [-1089.343] (-1089.994) (-1092.547) * (-1085.449) (-1095.111) [-1091.114] (-1104.361) -- 0:02:34
198000 -- (-1085.218) [-1089.815] (-1091.659) (-1084.019) * (-1105.385) [-1085.118] (-1096.791) (-1115.523) -- 0:02:33
199000 -- (-1091.394) (-1090.490) (-1094.103) [-1085.971] * (-1085.018) [-1088.907] (-1092.893) (-1098.004) -- 0:02:36
200000 -- [-1086.114] (-1085.073) (-1103.948) (-1090.940) * [-1083.978] (-1087.983) (-1094.872) (-1104.723) -- 0:02:36
Average standard deviation of split frequencies: 0.014457
201000 -- (-1101.972) (-1092.825) [-1091.212] (-1093.920) * (-1085.999) (-1100.591) [-1093.564] (-1087.422) -- 0:02:35
202000 -- [-1089.061] (-1095.010) (-1089.401) (-1087.297) * [-1087.658] (-1087.602) (-1090.598) (-1087.994) -- 0:02:34
203000 -- (-1088.034) (-1088.073) (-1085.230) [-1088.951] * (-1091.255) (-1096.649) [-1089.995] (-1091.059) -- 0:02:33
204000 -- (-1091.319) (-1090.511) (-1082.609) [-1083.772] * (-1087.882) (-1084.114) [-1090.855] (-1092.989) -- 0:02:32
205000 -- (-1084.427) (-1091.003) [-1090.525] (-1090.771) * (-1092.791) (-1095.886) [-1086.786] (-1088.931) -- 0:02:35
Average standard deviation of split frequencies: 0.013202
206000 -- (-1086.418) (-1095.087) (-1099.816) [-1087.497] * (-1093.683) (-1085.488) (-1086.797) [-1086.739] -- 0:02:34
207000 -- (-1094.539) (-1106.239) [-1091.101] (-1097.216) * (-1094.562) (-1088.060) (-1088.410) [-1086.354] -- 0:02:33
208000 -- [-1092.112] (-1096.512) (-1085.887) (-1087.139) * (-1090.415) (-1101.978) [-1086.995] (-1091.348) -- 0:02:32
209000 -- [-1083.659] (-1100.249) (-1094.041) (-1085.795) * (-1086.974) [-1087.692] (-1087.048) (-1084.400) -- 0:02:31
210000 -- (-1085.663) (-1087.470) (-1093.188) [-1092.629] * [-1084.256] (-1088.553) (-1095.193) (-1091.443) -- 0:02:34
Average standard deviation of split frequencies: 0.012565
211000 -- (-1088.242) [-1091.277] (-1086.832) (-1094.251) * (-1091.829) (-1086.759) (-1095.155) [-1084.124] -- 0:02:33
212000 -- (-1086.590) (-1099.086) (-1091.304) [-1094.278] * [-1083.028] (-1085.199) (-1086.847) (-1096.078) -- 0:02:32
213000 -- (-1088.495) [-1088.983] (-1088.957) (-1106.391) * (-1092.488) [-1089.037] (-1088.331) (-1087.478) -- 0:02:31
214000 -- [-1082.642] (-1096.047) (-1090.079) (-1097.799) * [-1091.625] (-1088.150) (-1090.888) (-1094.042) -- 0:02:30
215000 -- (-1090.726) [-1089.958] (-1089.681) (-1092.779) * (-1083.040) (-1092.098) (-1091.062) [-1090.053] -- 0:02:33
Average standard deviation of split frequencies: 0.012927
216000 -- (-1089.914) (-1089.632) [-1087.597] (-1090.526) * (-1093.964) (-1094.012) [-1087.014] (-1088.816) -- 0:02:32
217000 -- (-1087.689) (-1092.784) (-1098.818) [-1093.958] * [-1090.461] (-1086.532) (-1090.503) (-1087.724) -- 0:02:31
218000 -- (-1089.240) (-1094.091) [-1089.702] (-1091.590) * (-1082.910) (-1088.819) [-1085.254] (-1097.864) -- 0:02:30
219000 -- (-1088.083) [-1088.811] (-1092.928) (-1094.805) * [-1088.491] (-1088.506) (-1092.474) (-1093.719) -- 0:02:29
220000 -- (-1087.190) [-1087.325] (-1092.598) (-1091.447) * [-1084.990] (-1096.012) (-1091.309) (-1095.833) -- 0:02:32
Average standard deviation of split frequencies: 0.013311
221000 -- (-1085.365) [-1084.795] (-1092.034) (-1099.504) * (-1105.094) (-1088.569) [-1086.041] (-1086.093) -- 0:02:31
222000 -- (-1092.886) (-1088.100) [-1086.023] (-1105.063) * (-1085.516) (-1084.013) (-1086.767) [-1094.057] -- 0:02:30
223000 -- [-1094.462] (-1087.879) (-1088.612) (-1089.308) * (-1085.450) (-1095.569) [-1090.402] (-1085.086) -- 0:02:29
224000 -- (-1088.384) (-1083.975) (-1092.223) [-1088.347] * (-1085.954) (-1089.259) [-1088.268] (-1095.169) -- 0:02:28
225000 -- (-1092.488) (-1085.651) (-1090.784) [-1084.620] * (-1084.505) [-1088.012] (-1089.524) (-1089.383) -- 0:02:31
Average standard deviation of split frequencies: 0.016045
226000 -- (-1087.197) [-1087.360] (-1091.332) (-1092.543) * (-1089.804) [-1088.114] (-1090.524) (-1094.390) -- 0:02:30
227000 -- (-1089.520) (-1088.111) (-1091.685) [-1090.142] * [-1091.031] (-1089.795) (-1101.944) (-1091.445) -- 0:02:29
228000 -- (-1090.034) (-1096.131) [-1084.897] (-1098.568) * (-1084.223) (-1085.159) [-1097.426] (-1090.150) -- 0:02:28
229000 -- [-1090.003] (-1093.101) (-1089.381) (-1085.253) * (-1086.672) (-1086.214) (-1089.027) [-1086.204] -- 0:02:28
230000 -- [-1093.050] (-1096.668) (-1098.355) (-1089.327) * (-1086.349) (-1117.383) (-1088.118) [-1095.085] -- 0:02:30
Average standard deviation of split frequencies: 0.017607
231000 -- (-1088.381) (-1089.928) (-1087.989) [-1085.691] * [-1084.834] (-1086.521) (-1095.577) (-1088.848) -- 0:02:29
232000 -- (-1100.473) (-1089.492) [-1085.936] (-1091.544) * [-1094.704] (-1093.010) (-1092.628) (-1080.829) -- 0:02:28
233000 -- (-1092.984) (-1092.585) [-1091.744] (-1093.532) * [-1090.803] (-1087.910) (-1094.707) (-1085.104) -- 0:02:28
234000 -- (-1090.511) [-1086.642] (-1090.389) (-1093.811) * (-1088.674) (-1095.522) (-1081.693) [-1086.124] -- 0:02:27
235000 -- (-1094.534) (-1084.647) [-1092.240] (-1086.941) * (-1088.065) [-1085.554] (-1088.701) (-1091.641) -- 0:02:26
Average standard deviation of split frequencies: 0.017055
236000 -- (-1087.916) (-1082.325) (-1084.720) [-1090.033] * (-1087.735) (-1081.006) (-1099.628) [-1083.949] -- 0:02:28
237000 -- (-1083.814) [-1083.590] (-1088.574) (-1091.572) * (-1085.431) (-1092.242) [-1087.864] (-1090.703) -- 0:02:28
238000 -- [-1083.377] (-1089.801) (-1087.714) (-1094.101) * [-1089.501] (-1093.567) (-1093.361) (-1091.072) -- 0:02:27
239000 -- (-1080.997) (-1088.999) [-1092.344] (-1095.693) * (-1097.968) (-1086.785) [-1091.570] (-1088.960) -- 0:02:26
240000 -- [-1092.414] (-1101.694) (-1093.148) (-1087.912) * (-1088.963) (-1096.111) [-1081.529] (-1088.572) -- 0:02:25
Average standard deviation of split frequencies: 0.016423
241000 -- (-1088.988) (-1101.586) (-1088.348) [-1096.368] * (-1095.154) (-1087.390) [-1084.839] (-1091.659) -- 0:02:28
242000 -- (-1098.661) [-1097.535] (-1094.091) (-1090.119) * (-1090.701) (-1091.055) [-1086.810] (-1093.277) -- 0:02:27
243000 -- [-1082.701] (-1098.019) (-1089.797) (-1085.345) * (-1089.331) (-1085.356) [-1082.507] (-1090.952) -- 0:02:26
244000 -- [-1085.365] (-1098.139) (-1093.650) (-1093.236) * (-1092.130) (-1095.853) [-1090.932] (-1090.936) -- 0:02:25
245000 -- [-1084.573] (-1097.908) (-1095.079) (-1094.972) * (-1081.257) [-1086.125] (-1091.726) (-1090.303) -- 0:02:24
Average standard deviation of split frequencies: 0.016657
246000 -- (-1084.746) [-1084.007] (-1090.977) (-1092.360) * [-1083.227] (-1092.027) (-1091.289) (-1085.686) -- 0:02:27
247000 -- (-1096.025) (-1085.579) (-1088.767) [-1090.236] * (-1086.994) (-1099.827) (-1095.050) [-1091.056] -- 0:02:26
248000 -- (-1096.533) (-1098.118) (-1094.067) [-1089.001] * (-1097.860) (-1093.137) [-1092.268] (-1088.641) -- 0:02:25
249000 -- [-1090.634] (-1090.594) (-1093.475) (-1092.257) * [-1089.495] (-1096.221) (-1100.566) (-1085.422) -- 0:02:24
250000 -- (-1094.468) (-1098.890) (-1096.462) [-1090.313] * (-1096.199) [-1093.522] (-1079.419) (-1096.869) -- 0:02:24
Average standard deviation of split frequencies: 0.015189
251000 -- (-1091.240) [-1094.427] (-1094.227) (-1089.816) * (-1091.227) [-1102.349] (-1086.255) (-1090.452) -- 0:02:26
252000 -- (-1092.647) [-1094.235] (-1090.794) (-1084.584) * [-1085.945] (-1094.567) (-1082.224) (-1097.907) -- 0:02:25
253000 -- (-1084.341) [-1093.437] (-1102.069) (-1101.807) * (-1101.453) (-1092.372) [-1095.594] (-1090.527) -- 0:02:24
254000 -- (-1087.108) (-1093.121) [-1082.074] (-1092.463) * (-1100.774) (-1092.693) [-1089.395] (-1092.070) -- 0:02:23
255000 -- (-1088.763) (-1090.145) (-1089.551) [-1087.847] * [-1093.203] (-1089.530) (-1095.458) (-1090.143) -- 0:02:23
Average standard deviation of split frequencies: 0.014448
256000 -- [-1083.804] (-1093.760) (-1096.793) (-1094.263) * (-1089.649) [-1090.112] (-1088.950) (-1095.762) -- 0:02:25
257000 -- (-1094.785) (-1089.101) [-1088.007] (-1099.656) * (-1090.465) (-1097.253) [-1080.381] (-1103.394) -- 0:02:24
258000 -- [-1084.310] (-1095.442) (-1092.831) (-1093.590) * (-1090.891) (-1102.620) (-1085.576) [-1088.479] -- 0:02:23
259000 -- [-1089.576] (-1089.054) (-1089.523) (-1090.089) * (-1087.110) (-1093.760) [-1084.575] (-1100.734) -- 0:02:23
260000 -- (-1088.967) [-1088.089] (-1100.949) (-1088.867) * (-1085.788) (-1098.397) (-1092.369) [-1085.945] -- 0:02:22
Average standard deviation of split frequencies: 0.016137
261000 -- (-1095.054) [-1092.709] (-1095.016) (-1088.345) * (-1090.825) (-1093.978) (-1088.581) [-1097.184] -- 0:02:21
262000 -- (-1094.410) (-1095.065) (-1081.231) [-1099.686] * [-1081.546] (-1090.867) (-1098.498) (-1093.365) -- 0:02:23
263000 -- (-1094.172) [-1083.385] (-1086.915) (-1098.117) * (-1087.771) (-1098.612) (-1091.585) [-1089.983] -- 0:02:22
264000 -- (-1093.963) [-1083.982] (-1087.871) (-1102.667) * (-1090.802) (-1092.631) (-1093.478) [-1095.358] -- 0:02:22
265000 -- (-1088.697) (-1094.238) [-1085.467] (-1096.585) * (-1093.380) [-1100.338] (-1088.733) (-1098.618) -- 0:02:21
Average standard deviation of split frequencies: 0.014996
266000 -- [-1087.981] (-1089.947) (-1097.672) (-1093.024) * (-1093.134) (-1096.873) [-1078.972] (-1093.080) -- 0:02:20
267000 -- [-1084.140] (-1093.504) (-1095.082) (-1095.090) * [-1096.927] (-1089.061) (-1093.073) (-1094.477) -- 0:02:22
268000 -- [-1090.509] (-1088.070) (-1088.506) (-1096.525) * [-1090.170] (-1089.998) (-1094.686) (-1090.801) -- 0:02:22
269000 -- (-1087.959) (-1097.174) (-1090.808) [-1087.756] * (-1090.557) (-1095.795) [-1082.360] (-1098.161) -- 0:02:21
270000 -- [-1082.543] (-1088.468) (-1085.689) (-1095.729) * [-1087.103] (-1093.352) (-1090.246) (-1102.364) -- 0:02:20
Average standard deviation of split frequencies: 0.014603
271000 -- [-1098.029] (-1099.843) (-1088.295) (-1091.759) * [-1085.288] (-1100.399) (-1084.540) (-1085.676) -- 0:02:19
272000 -- [-1088.548] (-1089.675) (-1088.107) (-1086.181) * (-1092.810) [-1094.550] (-1090.509) (-1095.208) -- 0:02:21
273000 -- (-1091.109) (-1083.447) (-1089.721) [-1090.262] * [-1089.001] (-1111.555) (-1086.664) (-1091.395) -- 0:02:21
274000 -- (-1093.988) [-1090.466] (-1095.432) (-1087.044) * (-1089.892) (-1090.737) (-1083.598) [-1090.472] -- 0:02:20
275000 -- (-1089.345) [-1098.788] (-1094.845) (-1086.941) * (-1089.325) (-1086.993) [-1095.367] (-1093.355) -- 0:02:19
Average standard deviation of split frequencies: 0.013533
276000 -- [-1091.147] (-1092.737) (-1085.344) (-1086.869) * (-1093.310) [-1088.719] (-1092.621) (-1087.071) -- 0:02:19
277000 -- (-1089.745) [-1087.101] (-1090.388) (-1088.529) * (-1091.527) (-1093.028) (-1093.508) [-1086.626] -- 0:02:20
278000 -- (-1084.485) [-1085.884] (-1090.766) (-1088.928) * (-1085.219) [-1082.504] (-1089.077) (-1091.798) -- 0:02:20
279000 -- (-1085.530) (-1092.461) [-1087.514] (-1096.417) * (-1091.475) (-1088.265) [-1084.137] (-1092.192) -- 0:02:19
280000 -- [-1089.444] (-1083.352) (-1109.523) (-1093.877) * [-1087.344] (-1098.606) (-1082.604) (-1093.592) -- 0:02:18
Average standard deviation of split frequencies: 0.010207
281000 -- (-1099.491) (-1086.441) [-1099.515] (-1099.060) * (-1086.617) [-1082.783] (-1090.181) (-1089.241) -- 0:02:18
282000 -- [-1097.617] (-1081.991) (-1092.405) (-1096.277) * (-1089.867) [-1087.320] (-1086.085) (-1094.363) -- 0:02:20
283000 -- (-1091.584) (-1096.359) [-1083.192] (-1089.268) * (-1099.365) (-1088.667) [-1086.647] (-1087.591) -- 0:02:19
284000 -- (-1089.647) (-1088.976) [-1083.280] (-1092.261) * [-1087.806] (-1088.147) (-1090.821) (-1090.431) -- 0:02:18
285000 -- (-1090.504) [-1088.047] (-1087.033) (-1101.107) * (-1093.046) [-1086.202] (-1088.419) (-1091.974) -- 0:02:17
Average standard deviation of split frequencies: 0.010524
286000 -- (-1094.091) [-1084.966] (-1091.298) (-1088.429) * (-1091.983) [-1085.796] (-1082.698) (-1096.493) -- 0:02:17
287000 -- (-1094.920) [-1085.755] (-1086.859) (-1085.412) * (-1088.744) (-1091.196) (-1093.319) [-1087.123] -- 0:02:16
288000 -- (-1090.693) [-1088.163] (-1099.366) (-1090.048) * (-1092.099) (-1101.881) (-1088.160) [-1086.703] -- 0:02:18
289000 -- [-1091.670] (-1090.843) (-1088.882) (-1087.693) * (-1086.856) [-1087.888] (-1089.558) (-1091.998) -- 0:02:17
290000 -- [-1087.801] (-1085.008) (-1092.752) (-1088.668) * (-1088.881) [-1083.103] (-1090.528) (-1083.293) -- 0:02:17
Average standard deviation of split frequencies: 0.009731
291000 -- [-1092.098] (-1091.191) (-1090.942) (-1089.975) * (-1094.216) [-1085.392] (-1093.580) (-1084.603) -- 0:02:16
292000 -- [-1093.517] (-1093.426) (-1094.928) (-1091.468) * (-1097.848) [-1083.588] (-1094.000) (-1091.938) -- 0:02:15
293000 -- (-1103.613) [-1092.329] (-1088.816) (-1100.469) * [-1089.863] (-1086.474) (-1098.105) (-1088.477) -- 0:02:17
294000 -- (-1094.495) (-1095.688) [-1083.843] (-1092.660) * (-1086.926) [-1088.071] (-1090.325) (-1092.695) -- 0:02:16
295000 -- (-1089.725) (-1090.686) [-1084.632] (-1089.139) * (-1096.689) [-1087.509] (-1097.759) (-1087.495) -- 0:02:16
Average standard deviation of split frequencies: 0.010046
296000 -- (-1093.753) (-1093.316) (-1095.537) [-1083.107] * (-1080.962) (-1082.378) [-1095.282] (-1084.525) -- 0:02:15
297000 -- (-1083.658) (-1088.613) [-1087.037] (-1090.801) * (-1087.754) (-1089.024) (-1103.658) [-1091.871] -- 0:02:14
298000 -- (-1095.716) (-1082.075) [-1087.152] (-1085.959) * (-1097.637) [-1083.253] (-1111.793) (-1093.580) -- 0:02:16
299000 -- (-1088.598) [-1090.566] (-1098.233) (-1089.606) * [-1094.307] (-1091.301) (-1086.631) (-1086.004) -- 0:02:15
300000 -- (-1095.699) (-1094.497) (-1092.415) [-1087.710] * [-1086.511] (-1093.788) (-1088.092) (-1083.510) -- 0:02:15
Average standard deviation of split frequencies: 0.011216
301000 -- (-1085.313) (-1090.883) (-1090.599) [-1084.692] * (-1092.565) (-1086.891) (-1090.787) [-1086.518] -- 0:02:14
302000 -- (-1084.206) (-1100.959) [-1091.592] (-1092.304) * (-1088.364) [-1084.453] (-1092.020) (-1089.100) -- 0:02:14
303000 -- [-1085.616] (-1088.993) (-1090.105) (-1089.969) * (-1088.522) (-1097.536) [-1085.894] (-1089.444) -- 0:02:15
304000 -- (-1086.324) [-1086.664] (-1085.130) (-1085.272) * (-1093.873) [-1086.533] (-1090.405) (-1095.200) -- 0:02:15
305000 -- [-1089.297] (-1088.383) (-1088.765) (-1086.567) * (-1088.542) [-1088.467] (-1089.897) (-1082.209) -- 0:02:14
Average standard deviation of split frequencies: 0.012443
306000 -- (-1093.079) (-1086.390) [-1088.912] (-1095.843) * (-1088.283) [-1086.835] (-1096.920) (-1085.262) -- 0:02:13
307000 -- (-1082.348) (-1090.478) [-1090.102] (-1087.900) * (-1095.475) [-1086.009] (-1091.412) (-1092.894) -- 0:02:13
308000 -- (-1088.692) [-1085.108] (-1086.743) (-1089.986) * (-1087.836) (-1091.104) (-1092.211) [-1084.777] -- 0:02:12
309000 -- (-1092.206) [-1083.394] (-1088.318) (-1097.194) * (-1097.929) (-1089.488) (-1087.799) [-1085.818] -- 0:02:14
310000 -- (-1089.747) (-1088.607) [-1085.285] (-1086.792) * [-1093.307] (-1099.738) (-1103.568) (-1093.030) -- 0:02:13
Average standard deviation of split frequencies: 0.012956
311000 -- (-1085.732) (-1085.887) [-1084.494] (-1091.767) * (-1091.054) (-1100.223) [-1088.113] (-1087.833) -- 0:02:12
312000 -- [-1086.429] (-1094.957) (-1088.010) (-1091.664) * (-1089.090) (-1090.070) [-1084.576] (-1084.065) -- 0:02:12
313000 -- [-1096.750] (-1098.495) (-1092.200) (-1087.596) * (-1094.972) (-1091.504) (-1087.575) [-1087.614] -- 0:02:11
314000 -- [-1092.048] (-1103.034) (-1088.774) (-1089.415) * [-1086.433] (-1098.423) (-1083.535) (-1091.076) -- 0:02:13
315000 -- (-1097.307) [-1091.082] (-1086.588) (-1094.582) * [-1090.668] (-1089.459) (-1086.215) (-1091.299) -- 0:02:12
Average standard deviation of split frequencies: 0.014000
316000 -- (-1084.508) [-1084.115] (-1089.121) (-1095.273) * (-1092.908) [-1090.966] (-1085.370) (-1089.609) -- 0:02:12
317000 -- (-1089.760) [-1087.973] (-1092.359) (-1087.439) * (-1092.776) (-1086.483) [-1084.906] (-1089.403) -- 0:02:11
318000 -- (-1088.242) [-1085.480] (-1093.722) (-1089.323) * [-1081.521] (-1093.689) (-1087.658) (-1089.280) -- 0:02:10
319000 -- (-1095.367) [-1081.576] (-1088.685) (-1085.705) * (-1086.932) (-1083.953) (-1091.382) [-1090.653] -- 0:02:12
320000 -- [-1091.862] (-1082.940) (-1090.863) (-1083.739) * (-1091.051) [-1088.804] (-1088.684) (-1092.494) -- 0:02:11
Average standard deviation of split frequencies: 0.013231
321000 -- (-1086.337) (-1089.049) [-1088.569] (-1088.360) * (-1092.128) (-1090.006) (-1086.288) [-1087.301] -- 0:02:11
322000 -- (-1093.665) (-1088.759) [-1084.649] (-1090.007) * (-1088.906) (-1096.151) (-1094.724) [-1095.696] -- 0:02:10
323000 -- [-1085.969] (-1087.033) (-1098.386) (-1086.258) * (-1088.669) (-1087.601) [-1083.161] (-1089.106) -- 0:02:09
324000 -- (-1087.240) (-1086.006) [-1090.020] (-1086.746) * (-1085.827) (-1095.515) (-1084.031) [-1087.663] -- 0:02:11
325000 -- (-1086.980) (-1088.720) [-1087.492] (-1089.272) * (-1087.463) (-1088.849) [-1086.947] (-1092.292) -- 0:02:10
Average standard deviation of split frequencies: 0.013125
326000 -- (-1089.404) (-1095.416) (-1087.445) [-1086.463] * (-1088.067) (-1088.497) [-1080.303] (-1085.369) -- 0:02:10
327000 -- (-1088.854) (-1092.621) (-1087.542) [-1084.966] * (-1096.231) (-1087.855) [-1091.778] (-1084.783) -- 0:02:09
328000 -- [-1089.370] (-1084.280) (-1086.043) (-1088.433) * (-1088.318) [-1090.072] (-1096.959) (-1092.287) -- 0:02:09
329000 -- (-1090.712) (-1087.389) (-1090.075) [-1081.698] * (-1096.374) [-1092.395] (-1090.560) (-1089.305) -- 0:02:08
330000 -- (-1088.368) (-1086.289) [-1087.157] (-1094.751) * (-1090.048) (-1089.705) [-1087.573] (-1094.094) -- 0:02:09
Average standard deviation of split frequencies: 0.014037
331000 -- (-1095.122) (-1094.002) (-1087.629) [-1085.585] * [-1089.998] (-1088.304) (-1104.302) (-1088.392) -- 0:02:09
332000 -- (-1102.177) (-1088.478) (-1089.519) [-1090.004] * [-1090.676] (-1089.954) (-1086.153) (-1087.021) -- 0:02:08
333000 -- (-1087.512) (-1085.999) [-1092.387] (-1091.836) * (-1084.815) (-1086.395) (-1086.351) [-1085.151] -- 0:02:08
334000 -- (-1084.367) [-1085.707] (-1087.758) (-1087.847) * (-1092.011) [-1086.632] (-1095.610) (-1089.265) -- 0:02:07
335000 -- (-1084.415) (-1085.447) (-1089.318) [-1085.764] * (-1090.351) (-1087.080) (-1093.395) [-1087.737] -- 0:02:09
Average standard deviation of split frequencies: 0.014030
336000 -- (-1085.801) (-1085.870) [-1089.252] (-1104.688) * (-1083.072) (-1082.039) (-1089.954) [-1085.638] -- 0:02:08
337000 -- (-1087.728) (-1091.158) [-1085.756] (-1088.989) * (-1089.105) (-1088.251) [-1090.692] (-1084.123) -- 0:02:07
338000 -- (-1093.608) (-1090.684) (-1088.577) [-1089.777] * (-1091.283) (-1088.447) (-1090.446) [-1091.281] -- 0:02:07
339000 -- (-1091.346) (-1095.120) [-1086.343] (-1091.764) * (-1087.140) (-1084.393) (-1085.619) [-1088.148] -- 0:02:06
340000 -- (-1085.924) (-1094.089) (-1098.529) [-1086.853] * (-1091.391) [-1090.721] (-1088.317) (-1092.165) -- 0:02:08
Average standard deviation of split frequencies: 0.013093
341000 -- [-1088.766] (-1086.698) (-1088.385) (-1091.886) * (-1086.668) (-1089.165) (-1087.264) [-1094.884] -- 0:02:07
342000 -- (-1090.244) [-1088.297] (-1103.637) (-1089.107) * [-1083.553] (-1089.658) (-1089.592) (-1093.489) -- 0:02:06
343000 -- [-1089.157] (-1091.806) (-1090.320) (-1090.633) * [-1083.870] (-1085.646) (-1089.027) (-1094.871) -- 0:02:06
344000 -- (-1098.736) (-1088.922) [-1097.767] (-1087.764) * [-1087.014] (-1095.126) (-1091.104) (-1085.899) -- 0:02:05
345000 -- (-1099.158) (-1092.299) (-1087.385) [-1081.949] * (-1093.515) [-1082.849] (-1090.159) (-1095.489) -- 0:02:07
Average standard deviation of split frequencies: 0.012052
346000 -- (-1081.676) [-1090.348] (-1090.412) (-1096.378) * (-1091.522) (-1093.091) (-1090.612) [-1089.464] -- 0:02:06
347000 -- (-1085.689) (-1087.754) (-1089.269) [-1090.111] * (-1087.581) [-1082.653] (-1094.034) (-1088.516) -- 0:02:06
348000 -- (-1086.938) (-1087.585) (-1094.210) [-1090.279] * (-1089.759) (-1088.710) (-1092.177) [-1086.774] -- 0:02:05
349000 -- (-1091.405) (-1088.713) [-1087.790] (-1092.551) * (-1090.618) [-1086.426] (-1092.829) (-1096.006) -- 0:02:04
350000 -- (-1088.078) [-1082.944] (-1097.381) (-1090.113) * (-1083.208) (-1091.467) [-1091.980] (-1091.743) -- 0:02:04
Average standard deviation of split frequencies: 0.011065
351000 -- [-1083.878] (-1090.908) (-1088.176) (-1089.191) * [-1087.442] (-1085.154) (-1101.367) (-1088.040) -- 0:02:05
352000 -- (-1090.402) (-1089.206) [-1088.126] (-1084.876) * (-1089.666) [-1084.480] (-1092.035) (-1087.481) -- 0:02:05
353000 -- (-1087.904) [-1088.399] (-1087.036) (-1098.078) * [-1087.582] (-1092.603) (-1089.580) (-1097.284) -- 0:02:04
354000 -- (-1091.686) (-1084.435) (-1090.800) [-1090.394] * [-1097.050] (-1091.244) (-1092.184) (-1084.851) -- 0:02:04
355000 -- (-1097.406) [-1087.647] (-1083.563) (-1093.416) * (-1093.669) (-1091.101) (-1089.093) [-1083.402] -- 0:02:03
Average standard deviation of split frequencies: 0.010084
356000 -- [-1088.001] (-1082.460) (-1086.643) (-1090.092) * (-1090.614) (-1093.324) (-1104.517) [-1087.032] -- 0:02:04
357000 -- (-1093.476) (-1093.519) [-1081.635] (-1085.098) * (-1088.757) (-1094.285) (-1088.898) [-1088.478] -- 0:02:04
358000 -- (-1086.145) [-1083.883] (-1089.647) (-1089.453) * [-1085.249] (-1093.293) (-1089.822) (-1087.822) -- 0:02:03
359000 -- [-1085.858] (-1093.504) (-1091.933) (-1088.471) * [-1084.319] (-1098.693) (-1094.865) (-1085.559) -- 0:02:03
360000 -- [-1087.256] (-1086.000) (-1093.425) (-1088.703) * (-1087.720) [-1086.222] (-1096.164) (-1082.970) -- 0:02:02
Average standard deviation of split frequencies: 0.009954
361000 -- (-1082.792) [-1086.362] (-1098.333) (-1086.598) * (-1086.465) (-1087.110) [-1085.170] (-1084.948) -- 0:02:03
362000 -- (-1090.967) (-1087.690) (-1101.755) [-1090.954] * (-1085.852) [-1084.724] (-1086.786) (-1092.112) -- 0:02:03
363000 -- (-1091.664) (-1082.997) [-1094.365] (-1089.995) * (-1097.045) (-1090.512) (-1090.813) [-1091.953] -- 0:02:02
364000 -- (-1088.014) [-1088.669] (-1091.890) (-1085.211) * (-1097.603) (-1091.206) (-1087.033) [-1082.617] -- 0:02:02
365000 -- (-1090.111) (-1099.248) [-1093.470] (-1086.923) * (-1083.303) (-1089.904) (-1092.311) [-1091.730] -- 0:02:01
Average standard deviation of split frequencies: 0.009511
366000 -- (-1088.794) (-1087.048) (-1087.665) [-1090.016] * (-1093.855) [-1088.524] (-1092.687) (-1093.450) -- 0:02:02
367000 -- (-1087.709) (-1089.921) (-1096.029) [-1085.954] * (-1092.230) [-1084.728] (-1090.071) (-1088.940) -- 0:02:02
368000 -- (-1097.463) (-1085.459) (-1090.607) [-1085.151] * (-1091.444) [-1083.680] (-1092.345) (-1096.262) -- 0:02:01
369000 -- [-1084.702] (-1094.794) (-1092.709) (-1088.654) * (-1085.404) (-1087.669) [-1083.715] (-1089.833) -- 0:02:01
370000 -- (-1094.161) (-1087.869) (-1094.627) [-1090.402] * (-1098.314) [-1086.177] (-1092.014) (-1091.638) -- 0:02:00
Average standard deviation of split frequencies: 0.010663
371000 -- (-1085.040) [-1088.993] (-1098.103) (-1085.312) * [-1099.284] (-1088.680) (-1101.217) (-1089.028) -- 0:02:00
372000 -- (-1085.555) (-1090.339) (-1095.146) [-1090.655] * (-1088.333) (-1088.281) (-1100.415) [-1087.454] -- 0:02:01
373000 -- (-1090.282) (-1091.268) (-1084.631) [-1092.853] * [-1084.752] (-1093.308) (-1098.991) (-1108.951) -- 0:02:01
374000 -- [-1086.498] (-1097.678) (-1090.320) (-1086.234) * (-1088.922) (-1097.568) (-1105.109) [-1088.455] -- 0:02:00
375000 -- (-1088.551) [-1091.408] (-1098.128) (-1092.287) * (-1086.560) (-1081.644) (-1091.063) [-1092.828] -- 0:02:00
Average standard deviation of split frequencies: 0.011959
376000 -- (-1092.168) (-1094.152) (-1092.750) [-1088.899] * (-1095.401) (-1090.064) [-1091.653] (-1091.976) -- 0:01:59
377000 -- (-1094.875) [-1092.224] (-1083.535) (-1088.484) * (-1093.789) (-1092.628) (-1086.088) [-1089.914] -- 0:02:00
378000 -- (-1090.630) (-1092.656) [-1089.017] (-1087.704) * (-1089.686) (-1090.597) [-1098.767] (-1091.466) -- 0:02:00
379000 -- (-1096.732) [-1088.194] (-1094.115) (-1098.611) * [-1090.936] (-1088.248) (-1096.794) (-1092.697) -- 0:01:59
380000 -- (-1086.150) (-1086.362) [-1083.606] (-1089.478) * (-1094.303) (-1088.763) [-1082.724] (-1089.539) -- 0:01:59
Average standard deviation of split frequencies: 0.011431
381000 -- [-1088.408] (-1096.028) (-1084.735) (-1098.538) * (-1086.757) (-1087.999) [-1095.555] (-1096.405) -- 0:01:58
382000 -- (-1088.058) [-1087.857] (-1091.147) (-1087.612) * (-1089.466) [-1094.378] (-1093.811) (-1095.571) -- 0:01:59
383000 -- [-1095.034] (-1094.387) (-1085.756) (-1092.993) * (-1092.758) (-1097.142) (-1087.886) [-1088.699] -- 0:01:59
384000 -- [-1081.622] (-1095.686) (-1093.515) (-1086.893) * [-1083.693] (-1089.132) (-1099.724) (-1098.398) -- 0:01:58
385000 -- [-1088.498] (-1085.010) (-1090.670) (-1089.507) * (-1084.845) (-1082.254) [-1085.447] (-1111.155) -- 0:01:58
Average standard deviation of split frequencies: 0.011931
386000 -- (-1088.747) [-1091.026] (-1097.387) (-1083.015) * [-1085.387] (-1086.014) (-1090.176) (-1101.778) -- 0:01:57
387000 -- [-1089.713] (-1088.503) (-1087.199) (-1087.705) * (-1082.379) (-1092.298) [-1082.263] (-1101.096) -- 0:01:58
388000 -- (-1084.430) [-1083.388] (-1098.067) (-1092.509) * (-1084.173) (-1092.478) [-1084.420] (-1098.099) -- 0:01:58
389000 -- [-1089.294] (-1087.893) (-1098.095) (-1080.291) * (-1091.522) [-1084.863] (-1101.256) (-1090.687) -- 0:01:57
390000 -- (-1090.188) (-1094.353) (-1089.831) [-1084.639] * (-1093.563) (-1085.661) [-1086.495] (-1089.909) -- 0:01:57
Average standard deviation of split frequencies: 0.011603
391000 -- (-1092.903) (-1095.697) [-1090.959] (-1085.934) * (-1087.628) (-1092.055) (-1088.088) [-1088.544] -- 0:01:56
392000 -- (-1094.746) (-1096.085) (-1099.149) [-1086.072] * (-1094.274) (-1081.532) [-1086.483] (-1088.076) -- 0:01:56
393000 -- (-1090.002) (-1089.010) (-1096.026) [-1084.399] * (-1085.929) (-1084.892) [-1086.964] (-1089.056) -- 0:01:57
394000 -- (-1085.207) (-1094.153) (-1090.567) [-1087.135] * (-1086.721) (-1093.020) [-1087.651] (-1090.363) -- 0:01:56
395000 -- (-1089.561) (-1085.907) [-1094.515] (-1086.985) * (-1091.764) (-1094.370) [-1087.208] (-1086.688) -- 0:01:56
Average standard deviation of split frequencies: 0.011904
396000 -- [-1088.441] (-1088.092) (-1092.446) (-1097.348) * (-1100.929) (-1092.360) [-1084.677] (-1090.105) -- 0:01:55
397000 -- (-1085.521) (-1088.127) (-1094.414) [-1082.797] * (-1096.670) [-1086.805] (-1084.673) (-1091.386) -- 0:01:55
398000 -- [-1084.492] (-1088.178) (-1091.613) (-1088.462) * (-1091.906) [-1088.008] (-1097.205) (-1090.474) -- 0:01:56
399000 -- (-1088.060) (-1083.921) [-1092.066] (-1094.926) * [-1083.997] (-1095.425) (-1087.208) (-1093.262) -- 0:01:55
400000 -- (-1093.294) [-1080.635] (-1091.567) (-1097.196) * (-1086.496) (-1089.998) (-1084.486) [-1087.886] -- 0:01:55
Average standard deviation of split frequencies: 0.012761
401000 -- [-1095.302] (-1089.137) (-1089.693) (-1088.401) * (-1084.572) [-1088.938] (-1084.574) (-1100.579) -- 0:01:55
402000 -- (-1091.519) (-1080.803) (-1098.208) [-1090.631] * (-1102.978) (-1087.105) (-1088.884) [-1088.414] -- 0:01:54
403000 -- (-1089.258) (-1084.140) [-1091.299] (-1096.835) * [-1090.906] (-1085.986) (-1090.660) (-1085.082) -- 0:01:55
404000 -- (-1095.947) (-1084.079) (-1084.044) [-1091.873] * [-1088.442] (-1095.436) (-1097.512) (-1087.713) -- 0:01:55
405000 -- (-1096.834) [-1089.580] (-1091.730) (-1089.032) * (-1083.252) [-1087.184] (-1091.011) (-1090.833) -- 0:01:54
Average standard deviation of split frequencies: 0.012415
406000 -- (-1099.379) [-1085.535] (-1087.719) (-1086.800) * [-1085.364] (-1093.824) (-1098.062) (-1086.281) -- 0:01:54
407000 -- (-1090.837) (-1102.216) (-1082.660) [-1081.777] * (-1089.694) (-1088.642) (-1090.036) [-1085.864] -- 0:01:53
408000 -- (-1094.906) (-1087.542) (-1093.060) [-1089.372] * [-1086.777] (-1087.650) (-1082.999) (-1084.678) -- 0:01:54
409000 -- (-1088.985) [-1085.545] (-1090.720) (-1086.902) * (-1108.187) (-1093.025) [-1085.756] (-1098.045) -- 0:01:54
410000 -- [-1088.777] (-1088.829) (-1087.500) (-1085.280) * (-1091.959) [-1093.505] (-1091.889) (-1089.696) -- 0:01:53
Average standard deviation of split frequencies: 0.012450
411000 -- (-1084.892) (-1091.623) [-1087.964] (-1089.814) * (-1093.578) [-1087.332] (-1086.639) (-1085.640) -- 0:01:53
412000 -- (-1090.436) (-1095.195) (-1085.403) [-1089.319] * (-1088.115) (-1095.820) [-1089.028] (-1088.222) -- 0:01:52
413000 -- (-1089.014) (-1095.040) (-1084.140) [-1095.006] * [-1084.049] (-1092.544) (-1094.329) (-1082.421) -- 0:01:52
414000 -- (-1087.431) (-1095.184) [-1084.141] (-1107.174) * (-1101.060) (-1081.471) (-1091.793) [-1084.268] -- 0:01:53
415000 -- (-1090.529) (-1098.609) [-1087.741] (-1088.961) * (-1087.577) [-1088.272] (-1095.212) (-1088.546) -- 0:01:52
Average standard deviation of split frequencies: 0.012814
416000 -- (-1091.182) [-1089.350] (-1087.238) (-1085.456) * (-1084.179) (-1085.052) (-1098.293) [-1089.379] -- 0:01:52
417000 -- [-1086.064] (-1088.734) (-1085.432) (-1090.580) * (-1091.382) [-1089.993] (-1100.078) (-1086.214) -- 0:01:51
418000 -- [-1085.358] (-1087.781) (-1088.667) (-1098.549) * [-1082.081] (-1092.267) (-1087.829) (-1096.098) -- 0:01:51
419000 -- (-1080.431) [-1086.367] (-1099.203) (-1100.327) * (-1087.937) (-1090.471) [-1089.523] (-1108.033) -- 0:01:52
420000 -- (-1086.523) (-1092.149) [-1088.965] (-1092.934) * [-1087.682] (-1089.420) (-1090.483) (-1105.290) -- 0:01:51
Average standard deviation of split frequencies: 0.013189
421000 -- (-1093.506) (-1086.692) [-1088.252] (-1096.462) * (-1094.422) (-1089.216) [-1087.796] (-1085.072) -- 0:01:51
422000 -- (-1098.618) (-1093.308) [-1093.456] (-1097.513) * (-1093.066) (-1086.796) [-1089.846] (-1099.347) -- 0:01:50
423000 -- (-1096.631) (-1091.321) [-1085.127] (-1094.110) * (-1087.065) (-1088.353) (-1080.348) [-1089.861] -- 0:01:50
424000 -- (-1106.039) [-1088.778] (-1094.634) (-1102.652) * (-1094.899) (-1086.564) [-1087.656] (-1090.377) -- 0:01:51
425000 -- (-1098.107) [-1090.916] (-1090.341) (-1086.418) * [-1088.571] (-1095.971) (-1090.253) (-1084.662) -- 0:01:50
Average standard deviation of split frequencies: 0.013109
426000 -- (-1089.908) (-1087.681) (-1089.844) [-1086.129] * (-1087.486) [-1092.444] (-1095.818) (-1101.135) -- 0:01:50
427000 -- (-1090.297) (-1098.568) (-1093.989) [-1084.678] * [-1091.112] (-1087.230) (-1086.566) (-1102.884) -- 0:01:50
428000 -- (-1088.716) (-1097.005) [-1087.988] (-1092.258) * (-1087.881) [-1086.626] (-1092.997) (-1091.792) -- 0:01:49
429000 -- [-1084.692] (-1088.071) (-1092.261) (-1089.786) * (-1088.142) [-1081.627] (-1092.227) (-1100.145) -- 0:01:49
430000 -- (-1089.128) [-1081.123] (-1092.938) (-1087.008) * (-1090.345) (-1088.410) [-1088.355] (-1112.048) -- 0:01:50
Average standard deviation of split frequencies: 0.012041
431000 -- (-1088.686) (-1097.791) [-1086.234] (-1093.321) * (-1092.687) (-1082.605) (-1087.340) [-1096.083] -- 0:01:49
432000 -- [-1085.543] (-1092.015) (-1085.684) (-1089.363) * [-1083.091] (-1093.347) (-1093.999) (-1092.170) -- 0:01:49
433000 -- (-1090.803) (-1089.920) (-1084.624) [-1083.631] * (-1088.379) [-1086.012] (-1090.158) (-1094.333) -- 0:01:48
434000 -- (-1102.676) (-1086.628) [-1084.159] (-1095.634) * (-1090.674) [-1087.089] (-1086.543) (-1086.425) -- 0:01:48
435000 -- (-1100.011) (-1081.804) (-1087.312) [-1092.273] * (-1092.316) (-1087.048) [-1086.018] (-1095.415) -- 0:01:49
Average standard deviation of split frequencies: 0.011976
436000 -- (-1089.931) (-1095.027) (-1086.667) [-1096.732] * (-1082.399) (-1089.078) (-1085.056) [-1081.978] -- 0:01:48
437000 -- (-1095.129) [-1084.757] (-1092.563) (-1094.148) * (-1092.386) [-1092.674] (-1096.701) (-1090.620) -- 0:01:48
438000 -- (-1091.889) (-1088.893) (-1092.303) [-1084.264] * (-1088.290) [-1093.603] (-1086.706) (-1083.879) -- 0:01:47
439000 -- (-1085.936) (-1093.112) [-1090.536] (-1092.770) * (-1098.974) (-1090.729) [-1087.270] (-1089.344) -- 0:01:47
440000 -- [-1089.220] (-1089.347) (-1098.957) (-1098.536) * (-1090.953) [-1088.786] (-1087.012) (-1099.374) -- 0:01:48
Average standard deviation of split frequencies: 0.011685
441000 -- [-1087.793] (-1092.437) (-1093.286) (-1087.817) * (-1100.328) [-1095.898] (-1089.708) (-1082.425) -- 0:01:47
442000 -- (-1092.756) (-1094.631) (-1093.442) [-1088.405] * (-1092.226) (-1094.019) (-1084.848) [-1084.790] -- 0:01:47
443000 -- [-1093.550] (-1091.202) (-1103.073) (-1091.689) * (-1088.415) (-1093.506) [-1085.268] (-1087.777) -- 0:01:46
444000 -- (-1092.001) [-1085.234] (-1084.734) (-1085.771) * (-1089.834) [-1082.265] (-1084.953) (-1090.420) -- 0:01:46
445000 -- (-1094.782) (-1086.297) (-1096.058) [-1086.732] * (-1091.058) (-1084.672) [-1093.259] (-1085.568) -- 0:01:47
Average standard deviation of split frequencies: 0.011464
446000 -- (-1095.498) (-1089.458) [-1094.794] (-1089.452) * (-1086.105) (-1091.018) (-1088.662) [-1087.160] -- 0:01:46
447000 -- (-1096.376) (-1101.189) (-1085.803) [-1086.540] * [-1089.080] (-1091.267) (-1085.152) (-1089.168) -- 0:01:46
448000 -- [-1088.083] (-1099.947) (-1090.462) (-1095.270) * [-1088.576] (-1090.031) (-1085.453) (-1087.458) -- 0:01:45
449000 -- (-1093.397) (-1085.452) [-1090.405] (-1087.646) * (-1088.059) (-1092.440) [-1087.625] (-1092.106) -- 0:01:45
450000 -- (-1099.345) (-1085.854) (-1102.195) [-1086.955] * (-1095.661) [-1086.744] (-1089.526) (-1083.966) -- 0:01:46
Average standard deviation of split frequencies: 0.011506
451000 -- [-1093.975] (-1091.480) (-1090.519) (-1084.883) * (-1089.297) (-1092.275) (-1086.430) [-1083.045] -- 0:01:45
452000 -- (-1092.163) (-1089.523) [-1089.576] (-1086.033) * [-1090.961] (-1084.433) (-1095.182) (-1097.229) -- 0:01:45
453000 -- (-1091.795) (-1085.273) (-1098.457) [-1089.908] * (-1088.278) (-1089.605) [-1085.110] (-1087.447) -- 0:01:45
454000 -- (-1084.765) [-1088.670] (-1103.965) (-1090.225) * (-1095.517) [-1083.030] (-1087.706) (-1086.238) -- 0:01:44
455000 -- (-1088.937) (-1092.386) [-1100.221] (-1085.824) * (-1084.949) [-1095.959] (-1087.484) (-1091.621) -- 0:01:45
Average standard deviation of split frequencies: 0.011372
456000 -- (-1089.481) (-1093.460) [-1093.281] (-1092.590) * (-1087.734) (-1091.089) [-1085.009] (-1094.177) -- 0:01:44
457000 -- (-1084.457) (-1097.414) [-1091.578] (-1089.813) * (-1088.171) [-1096.252] (-1085.714) (-1094.514) -- 0:01:44
458000 -- (-1089.211) [-1089.037] (-1093.497) (-1092.436) * (-1090.858) (-1099.611) (-1087.616) [-1087.937] -- 0:01:44
459000 -- (-1092.026) (-1100.451) (-1088.709) [-1097.655] * (-1091.630) (-1089.349) (-1085.822) [-1091.995] -- 0:01:44
460000 -- [-1087.364] (-1090.546) (-1087.846) (-1101.636) * (-1096.341) [-1092.177] (-1089.192) (-1097.304) -- 0:01:44
Average standard deviation of split frequencies: 0.010312
461000 -- [-1087.256] (-1092.288) (-1087.527) (-1092.537) * (-1090.020) (-1096.234) (-1092.645) [-1085.591] -- 0:01:44
462000 -- (-1089.054) (-1090.293) (-1097.394) [-1088.286] * (-1092.631) (-1096.557) [-1085.240] (-1087.337) -- 0:01:43
463000 -- (-1095.839) (-1084.765) [-1083.585] (-1089.327) * (-1090.836) (-1090.191) [-1092.185] (-1096.760) -- 0:01:43
464000 -- (-1085.267) (-1089.696) (-1102.581) [-1086.174] * [-1087.702] (-1091.776) (-1089.376) (-1090.229) -- 0:01:43
465000 -- (-1088.997) (-1092.153) (-1096.269) [-1090.354] * (-1088.832) (-1099.909) (-1088.818) [-1090.224] -- 0:01:43
Average standard deviation of split frequencies: 0.011050
466000 -- (-1084.128) (-1089.126) [-1089.157] (-1088.624) * (-1090.844) (-1101.682) (-1092.550) [-1089.113] -- 0:01:43
467000 -- [-1088.464] (-1092.245) (-1107.521) (-1088.723) * (-1092.533) (-1095.125) [-1091.224] (-1091.637) -- 0:01:42
468000 -- (-1085.195) (-1094.045) [-1085.054] (-1083.089) * [-1089.408] (-1090.058) (-1095.229) (-1096.943) -- 0:01:42
469000 -- (-1090.470) (-1094.303) (-1099.950) [-1090.569] * (-1092.683) [-1093.956] (-1095.959) (-1087.372) -- 0:01:43
470000 -- (-1085.755) (-1088.194) [-1088.232] (-1089.032) * (-1097.738) (-1092.962) (-1093.532) [-1086.745] -- 0:01:42
Average standard deviation of split frequencies: 0.010093
471000 -- [-1087.724] (-1091.576) (-1086.414) (-1093.753) * (-1100.299) (-1087.298) [-1086.540] (-1092.002) -- 0:01:42
472000 -- (-1096.860) [-1092.173] (-1094.761) (-1091.155) * (-1096.349) [-1093.439] (-1096.248) (-1090.837) -- 0:01:41
473000 -- (-1093.917) [-1091.470] (-1086.549) (-1088.082) * (-1086.138) (-1091.078) [-1088.844] (-1098.122) -- 0:01:41
474000 -- (-1085.676) [-1089.842] (-1085.950) (-1087.491) * (-1090.822) (-1089.269) (-1091.021) [-1093.172] -- 0:01:42
475000 -- (-1093.411) (-1106.040) (-1084.509) [-1089.377] * (-1082.571) (-1098.788) [-1084.486] (-1091.857) -- 0:01:41
Average standard deviation of split frequencies: 0.010589
476000 -- (-1093.604) (-1087.092) [-1083.484] (-1091.499) * (-1089.420) (-1091.421) [-1084.899] (-1088.805) -- 0:01:41
477000 -- (-1089.117) (-1091.943) [-1088.382] (-1088.456) * (-1087.281) (-1097.079) [-1086.088] (-1084.470) -- 0:01:40
478000 -- (-1082.829) (-1090.740) (-1100.358) [-1082.384] * (-1089.824) (-1088.000) [-1085.360] (-1089.930) -- 0:01:40
479000 -- (-1092.405) (-1089.022) [-1091.648] (-1092.498) * (-1086.960) [-1089.100] (-1091.765) (-1087.020) -- 0:01:41
480000 -- (-1088.672) (-1092.683) (-1086.598) [-1092.535] * (-1086.511) (-1088.191) (-1093.085) [-1083.140] -- 0:01:40
Average standard deviation of split frequencies: 0.009732
481000 -- (-1084.798) [-1089.670] (-1089.284) (-1095.419) * (-1088.203) (-1086.670) (-1096.398) [-1086.139] -- 0:01:40
482000 -- (-1088.458) (-1098.105) (-1092.856) [-1087.479] * (-1098.879) (-1087.772) (-1106.255) [-1086.461] -- 0:01:39
483000 -- (-1087.924) [-1086.168] (-1087.627) (-1095.057) * (-1086.325) (-1084.669) [-1086.831] (-1096.288) -- 0:01:39
484000 -- [-1089.254] (-1100.158) (-1099.514) (-1094.892) * (-1083.701) (-1094.949) [-1088.995] (-1100.084) -- 0:01:40
485000 -- (-1094.866) (-1087.861) (-1084.064) [-1088.325] * [-1087.418] (-1088.528) (-1096.746) (-1092.318) -- 0:01:39
Average standard deviation of split frequencies: 0.009028
486000 -- [-1092.043] (-1083.824) (-1093.400) (-1089.479) * (-1090.611) (-1092.479) (-1092.392) [-1094.883] -- 0:01:39
487000 -- (-1092.658) [-1087.986] (-1104.400) (-1090.422) * (-1089.120) (-1098.805) (-1093.752) [-1085.809] -- 0:01:39
488000 -- (-1096.076) [-1087.889] (-1090.340) (-1094.069) * (-1093.111) (-1091.271) [-1087.834] (-1089.326) -- 0:01:38
489000 -- [-1086.533] (-1096.724) (-1093.052) (-1090.882) * [-1086.602] (-1095.976) (-1093.271) (-1098.829) -- 0:01:39
490000 -- (-1089.631) (-1092.607) (-1098.563) [-1086.512] * (-1091.854) (-1095.056) (-1095.128) [-1089.715] -- 0:01:38
Average standard deviation of split frequencies: 0.008942
491000 -- [-1088.344] (-1095.423) (-1088.259) (-1089.287) * (-1090.350) (-1084.810) (-1095.245) [-1091.640] -- 0:01:38
492000 -- [-1086.745] (-1096.801) (-1099.272) (-1095.262) * (-1088.277) (-1091.000) [-1088.396] (-1091.201) -- 0:01:38
493000 -- [-1086.441] (-1093.623) (-1091.567) (-1093.398) * (-1095.051) [-1084.969] (-1088.092) (-1089.334) -- 0:01:37
494000 -- [-1082.655] (-1093.623) (-1093.409) (-1092.910) * (-1092.428) [-1087.006] (-1090.912) (-1084.150) -- 0:01:38
495000 -- (-1094.432) (-1098.374) (-1088.908) [-1085.787] * [-1093.140] (-1086.419) (-1092.470) (-1087.774) -- 0:01:37
Average standard deviation of split frequencies: 0.008334
496000 -- [-1081.827] (-1095.122) (-1099.117) (-1090.016) * (-1098.081) (-1092.607) (-1096.125) [-1087.946] -- 0:01:37
497000 -- (-1094.098) (-1087.259) (-1102.172) [-1092.338] * (-1104.412) [-1088.949] (-1094.168) (-1088.635) -- 0:01:37
498000 -- [-1090.870] (-1093.184) (-1087.807) (-1089.412) * [-1086.471] (-1091.033) (-1096.425) (-1091.054) -- 0:01:36
499000 -- (-1088.138) [-1088.068] (-1090.019) (-1086.246) * (-1090.459) [-1090.888] (-1091.192) (-1092.267) -- 0:01:37
500000 -- (-1092.071) (-1088.947) [-1094.870] (-1085.689) * (-1092.680) (-1089.670) [-1091.744] (-1094.150) -- 0:01:37
Average standard deviation of split frequencies: 0.008546
501000 -- (-1088.550) (-1085.550) [-1089.327] (-1094.390) * (-1089.860) [-1084.031] (-1087.090) (-1085.397) -- 0:01:36
502000 -- [-1086.120] (-1086.273) (-1093.377) (-1100.963) * [-1090.768] (-1083.872) (-1091.842) (-1093.872) -- 0:01:36
503000 -- (-1091.882) (-1092.878) [-1091.854] (-1089.805) * (-1090.259) (-1087.495) (-1099.670) [-1086.069] -- 0:01:35
504000 -- (-1091.384) [-1086.609] (-1090.716) (-1088.314) * (-1098.550) (-1085.101) (-1092.063) [-1090.454] -- 0:01:36
505000 -- (-1094.909) (-1087.019) (-1095.813) [-1090.858] * (-1095.079) [-1085.339] (-1089.043) (-1092.736) -- 0:01:36
Average standard deviation of split frequencies: 0.009460
506000 -- (-1085.330) (-1086.524) [-1090.897] (-1091.102) * [-1085.989] (-1096.896) (-1091.810) (-1085.171) -- 0:01:35
507000 -- [-1086.619] (-1083.688) (-1088.792) (-1091.518) * (-1095.405) [-1087.720] (-1086.883) (-1087.206) -- 0:01:35
508000 -- (-1086.698) (-1089.950) (-1099.908) [-1087.972] * (-1099.317) [-1088.514] (-1089.710) (-1089.012) -- 0:01:34
509000 -- (-1098.415) (-1083.909) (-1099.934) [-1089.218] * [-1089.371] (-1089.637) (-1086.171) (-1090.522) -- 0:01:34
510000 -- (-1095.931) [-1089.542] (-1087.550) (-1084.642) * (-1091.847) (-1097.967) (-1096.056) [-1087.814] -- 0:01:35
Average standard deviation of split frequencies: 0.008734
511000 -- [-1083.818] (-1088.109) (-1088.997) (-1086.627) * [-1097.251] (-1089.416) (-1093.541) (-1082.009) -- 0:01:34
512000 -- (-1081.807) (-1087.259) [-1087.084] (-1089.629) * (-1090.424) [-1084.353] (-1086.056) (-1085.464) -- 0:01:34
513000 -- (-1101.748) [-1084.794] (-1087.911) (-1088.932) * (-1097.458) (-1086.202) [-1095.932] (-1081.901) -- 0:01:33
514000 -- (-1084.688) (-1086.749) (-1088.959) [-1082.087] * (-1094.595) (-1091.872) [-1084.106] (-1085.133) -- 0:01:33
515000 -- (-1086.839) (-1092.719) [-1094.206] (-1091.097) * (-1088.607) (-1090.923) [-1085.584] (-1090.445) -- 0:01:34
Average standard deviation of split frequencies: 0.008503
516000 -- (-1091.863) (-1087.091) (-1097.355) [-1084.246] * (-1093.489) [-1087.785] (-1089.383) (-1086.002) -- 0:01:33
517000 -- (-1086.876) (-1087.637) (-1084.394) [-1090.830] * (-1092.795) (-1097.096) (-1085.838) [-1088.521] -- 0:01:33
518000 -- [-1085.650] (-1089.495) (-1094.228) (-1089.848) * (-1085.535) (-1093.638) (-1096.097) [-1085.642] -- 0:01:33
519000 -- (-1092.304) (-1087.440) (-1101.653) [-1085.363] * (-1096.301) [-1089.984] (-1088.235) (-1086.123) -- 0:01:32
520000 -- [-1086.037] (-1091.706) (-1088.625) (-1085.249) * [-1084.845] (-1100.151) (-1094.104) (-1098.396) -- 0:01:33
Average standard deviation of split frequencies: 0.009193
521000 -- (-1089.108) [-1094.371] (-1098.442) (-1092.027) * (-1088.363) (-1099.356) [-1085.679] (-1088.674) -- 0:01:32
522000 -- (-1092.165) (-1094.674) (-1099.006) [-1090.589] * [-1088.696] (-1092.458) (-1091.403) (-1095.822) -- 0:01:32
523000 -- (-1086.483) (-1087.605) [-1090.038] (-1098.188) * [-1088.128] (-1094.001) (-1083.862) (-1088.362) -- 0:01:32
524000 -- (-1089.419) (-1090.496) [-1087.465] (-1102.708) * (-1091.387) (-1089.193) [-1089.512] (-1085.082) -- 0:01:31
525000 -- [-1083.970] (-1099.443) (-1086.143) (-1091.183) * (-1088.325) [-1093.232] (-1084.454) (-1086.521) -- 0:01:32
Average standard deviation of split frequencies: 0.009376
526000 -- (-1084.971) (-1095.520) [-1082.820] (-1099.714) * (-1088.403) [-1093.495] (-1087.223) (-1096.668) -- 0:01:31
527000 -- [-1086.680] (-1098.629) (-1090.105) (-1088.014) * (-1091.588) (-1095.147) (-1085.277) [-1084.342] -- 0:01:31
528000 -- (-1090.565) [-1088.630] (-1095.321) (-1089.458) * (-1090.083) (-1096.816) (-1088.439) [-1085.716] -- 0:01:31
529000 -- (-1085.154) (-1089.790) (-1093.785) [-1090.589] * (-1084.585) (-1096.335) [-1090.048] (-1094.736) -- 0:01:30
530000 -- (-1086.536) (-1094.991) (-1087.608) [-1086.837] * [-1086.786] (-1100.100) (-1087.159) (-1087.274) -- 0:01:31
Average standard deviation of split frequencies: 0.008883
531000 -- (-1093.466) (-1097.407) (-1092.825) [-1086.038] * [-1084.957] (-1100.953) (-1082.818) (-1102.731) -- 0:01:30
532000 -- (-1085.699) (-1091.987) (-1093.822) [-1092.768] * [-1092.845] (-1099.903) (-1095.706) (-1091.021) -- 0:01:30
533000 -- (-1094.499) (-1089.485) (-1093.600) [-1087.907] * [-1087.615] (-1091.341) (-1094.072) (-1096.446) -- 0:01:30
534000 -- (-1094.136) (-1094.958) (-1091.258) [-1088.726] * (-1094.874) (-1091.727) [-1095.271] (-1089.535) -- 0:01:29
535000 -- (-1089.541) [-1083.847] (-1086.230) (-1096.747) * (-1095.125) (-1087.814) [-1093.801] (-1092.086) -- 0:01:30
Average standard deviation of split frequencies: 0.009065
536000 -- (-1104.790) [-1089.203] (-1089.911) (-1095.142) * (-1092.805) [-1095.469] (-1094.715) (-1086.084) -- 0:01:30
537000 -- (-1098.811) (-1086.200) (-1088.634) [-1095.243] * (-1082.727) (-1088.251) [-1091.442] (-1099.692) -- 0:01:29
538000 -- [-1089.701] (-1091.715) (-1091.327) (-1091.142) * (-1088.445) (-1090.624) (-1092.063) [-1091.487] -- 0:01:29
539000 -- (-1097.158) (-1095.799) [-1088.016] (-1092.036) * [-1087.630] (-1088.387) (-1097.679) (-1084.602) -- 0:01:28
540000 -- (-1094.109) (-1090.358) (-1086.134) [-1088.045] * (-1087.003) (-1094.932) [-1089.090] (-1085.538) -- 0:01:28
Average standard deviation of split frequencies: 0.009054
541000 -- [-1086.776] (-1089.037) (-1085.812) (-1088.111) * [-1090.109] (-1087.232) (-1085.205) (-1096.107) -- 0:01:29
542000 -- (-1092.036) (-1094.135) (-1081.647) [-1086.557] * (-1090.000) [-1090.164] (-1088.997) (-1093.158) -- 0:01:28
543000 -- (-1085.472) (-1092.957) (-1085.614) [-1089.271] * (-1092.048) (-1094.805) (-1088.251) [-1087.260] -- 0:01:28
544000 -- (-1096.099) (-1102.913) [-1093.899] (-1093.115) * (-1097.693) (-1085.795) (-1095.031) [-1090.407] -- 0:01:28
545000 -- (-1087.701) (-1085.978) (-1084.224) [-1088.305] * (-1091.861) (-1088.157) [-1085.313] (-1086.191) -- 0:01:27
Average standard deviation of split frequencies: 0.009165
546000 -- (-1093.926) (-1086.775) (-1089.987) [-1085.767] * [-1087.251] (-1087.941) (-1089.069) (-1096.027) -- 0:01:28
547000 -- (-1104.768) (-1084.592) (-1089.887) [-1086.581] * (-1085.845) [-1084.066] (-1091.904) (-1096.422) -- 0:01:27
548000 -- (-1098.762) (-1088.879) [-1081.239] (-1091.118) * (-1098.200) (-1093.297) (-1095.442) [-1088.084] -- 0:01:27
549000 -- (-1096.668) (-1096.289) [-1093.339] (-1091.077) * (-1094.942) [-1090.094] (-1089.973) (-1095.700) -- 0:01:27
550000 -- (-1102.385) [-1088.168] (-1090.612) (-1090.737) * [-1087.197] (-1090.073) (-1085.305) (-1089.133) -- 0:01:26
Average standard deviation of split frequencies: 0.009614
551000 -- (-1088.416) [-1087.850] (-1087.375) (-1093.058) * [-1090.616] (-1083.380) (-1092.847) (-1112.927) -- 0:01:27
552000 -- (-1087.867) (-1086.832) [-1090.752] (-1090.597) * [-1090.501] (-1089.542) (-1091.448) (-1093.876) -- 0:01:26
553000 -- (-1088.601) (-1089.666) (-1098.883) [-1085.549] * (-1090.008) [-1083.952] (-1097.495) (-1091.804) -- 0:01:26
554000 -- (-1097.658) (-1087.978) (-1085.614) [-1087.746] * (-1087.370) (-1093.752) (-1097.037) [-1088.539] -- 0:01:26
555000 -- [-1088.112] (-1084.784) (-1096.940) (-1097.110) * (-1086.272) (-1087.283) (-1090.789) [-1085.020] -- 0:01:25
Average standard deviation of split frequencies: 0.010305
556000 -- (-1086.780) (-1093.751) [-1087.923] (-1088.908) * (-1096.254) [-1085.369] (-1089.207) (-1086.269) -- 0:01:26
557000 -- (-1089.523) [-1080.552] (-1083.389) (-1087.673) * [-1092.850] (-1083.714) (-1087.740) (-1088.382) -- 0:01:25
558000 -- (-1092.373) [-1094.587] (-1090.822) (-1084.547) * (-1089.636) (-1093.193) [-1089.710] (-1089.146) -- 0:01:25
559000 -- (-1088.423) (-1088.642) (-1091.633) [-1087.656] * (-1090.539) [-1094.567] (-1088.019) (-1080.766) -- 0:01:25
560000 -- (-1083.547) (-1087.039) (-1084.376) [-1085.011] * (-1092.581) [-1084.822] (-1093.623) (-1088.074) -- 0:01:24
Average standard deviation of split frequencies: 0.010154
561000 -- (-1086.271) (-1086.924) (-1087.516) [-1099.237] * [-1086.069] (-1087.228) (-1086.809) (-1089.660) -- 0:01:25
562000 -- (-1108.538) (-1086.997) [-1091.360] (-1088.793) * (-1083.688) (-1093.225) [-1086.772] (-1090.035) -- 0:01:24
563000 -- (-1086.178) (-1088.921) [-1094.800] (-1093.650) * (-1089.725) (-1094.324) (-1085.788) [-1094.311] -- 0:01:24
564000 -- (-1094.497) (-1087.166) [-1090.988] (-1083.223) * (-1096.373) (-1087.436) [-1095.258] (-1092.085) -- 0:01:24
565000 -- (-1086.631) [-1092.519] (-1087.513) (-1091.235) * (-1088.847) (-1101.643) [-1090.014] (-1088.381) -- 0:01:23
Average standard deviation of split frequencies: 0.010443
566000 -- (-1095.746) [-1097.664] (-1098.735) (-1088.497) * (-1089.142) [-1089.754] (-1095.783) (-1090.274) -- 0:01:24
567000 -- (-1093.783) [-1085.984] (-1084.767) (-1102.628) * (-1090.728) (-1082.283) [-1086.911] (-1090.265) -- 0:01:24
568000 -- (-1098.477) (-1095.328) (-1097.790) [-1085.119] * (-1085.383) (-1093.020) [-1087.913] (-1085.999) -- 0:01:23
569000 -- (-1085.496) [-1092.406] (-1096.957) (-1090.510) * (-1089.566) [-1083.921] (-1088.646) (-1085.783) -- 0:01:23
570000 -- (-1090.738) (-1092.838) (-1089.897) [-1088.260] * (-1088.895) (-1097.717) (-1103.332) [-1087.095] -- 0:01:22
Average standard deviation of split frequencies: 0.011120
571000 -- (-1109.215) (-1092.044) (-1088.805) [-1082.955] * (-1089.832) [-1085.898] (-1105.011) (-1089.708) -- 0:01:22
572000 -- [-1084.528] (-1092.464) (-1085.709) (-1097.729) * (-1085.773) [-1088.409] (-1094.522) (-1083.920) -- 0:01:23
573000 -- (-1085.543) [-1084.419] (-1093.242) (-1103.088) * [-1088.101] (-1081.420) (-1088.879) (-1086.194) -- 0:01:22
574000 -- (-1095.234) [-1092.070] (-1089.398) (-1082.314) * (-1082.731) (-1085.369) (-1096.431) [-1090.368] -- 0:01:22
575000 -- (-1089.616) [-1091.849] (-1091.795) (-1094.134) * (-1087.405) [-1082.151] (-1089.835) (-1085.312) -- 0:01:22
Average standard deviation of split frequencies: 0.010576
576000 -- (-1094.632) (-1098.542) [-1088.052] (-1099.593) * [-1092.255] (-1096.758) (-1092.275) (-1091.132) -- 0:01:21
577000 -- (-1096.231) (-1096.645) [-1086.923] (-1094.673) * (-1089.448) [-1089.303] (-1086.273) (-1091.816) -- 0:01:22
578000 -- [-1088.811] (-1090.605) (-1094.204) (-1087.290) * (-1104.372) (-1086.369) (-1087.578) [-1086.529] -- 0:01:21
579000 -- (-1093.732) [-1095.588] (-1090.246) (-1105.416) * (-1096.567) [-1085.585] (-1087.039) (-1085.547) -- 0:01:21
580000 -- (-1084.619) (-1099.120) (-1086.532) [-1086.282] * (-1098.062) (-1093.612) [-1088.600] (-1091.015) -- 0:01:21
Average standard deviation of split frequencies: 0.009867
581000 -- [-1086.491] (-1094.379) (-1088.215) (-1086.433) * (-1093.813) [-1096.825] (-1091.271) (-1088.233) -- 0:01:20
582000 -- (-1085.663) (-1087.742) (-1089.047) [-1089.053] * [-1088.254] (-1086.273) (-1083.608) (-1087.613) -- 0:01:21
583000 -- [-1083.572] (-1096.212) (-1091.243) (-1089.026) * (-1097.490) (-1089.049) [-1083.750] (-1084.300) -- 0:01:20
584000 -- [-1085.662] (-1092.904) (-1080.282) (-1105.657) * (-1092.886) (-1088.082) [-1089.088] (-1086.192) -- 0:01:20
585000 -- (-1091.997) (-1099.396) (-1094.822) [-1082.087] * (-1094.420) (-1096.065) [-1081.390] (-1081.419) -- 0:01:20
Average standard deviation of split frequencies: 0.009096
586000 -- (-1087.781) (-1088.801) [-1094.840] (-1088.959) * (-1091.741) [-1087.097] (-1087.133) (-1088.092) -- 0:01:19
587000 -- (-1086.959) (-1090.436) [-1084.127] (-1096.784) * (-1089.651) (-1090.041) (-1089.690) [-1092.155] -- 0:01:20
588000 -- [-1094.000] (-1096.040) (-1086.878) (-1091.301) * (-1091.553) (-1088.999) (-1098.204) [-1087.237] -- 0:01:19
589000 -- (-1090.587) (-1090.972) (-1093.176) [-1088.943] * (-1089.873) [-1085.393] (-1087.525) (-1087.343) -- 0:01:19
590000 -- (-1088.222) [-1091.938] (-1097.085) (-1094.031) * (-1088.418) [-1085.884] (-1088.595) (-1089.628) -- 0:01:19
Average standard deviation of split frequencies: 0.008779
591000 -- (-1088.974) (-1097.742) [-1086.857] (-1089.954) * [-1092.327] (-1084.630) (-1089.655) (-1084.420) -- 0:01:18
592000 -- [-1090.057] (-1092.294) (-1085.479) (-1093.473) * (-1093.216) (-1086.179) (-1087.922) [-1088.042] -- 0:01:18
593000 -- [-1091.884] (-1095.303) (-1087.462) (-1098.178) * (-1090.968) [-1086.703] (-1093.577) (-1094.067) -- 0:01:18
594000 -- (-1086.323) (-1093.120) [-1089.957] (-1091.639) * [-1094.323] (-1090.050) (-1088.758) (-1090.293) -- 0:01:18
595000 -- (-1092.381) [-1088.774] (-1088.345) (-1096.454) * [-1087.084] (-1088.304) (-1093.230) (-1097.543) -- 0:01:18
Average standard deviation of split frequencies: 0.008822
596000 -- [-1084.582] (-1080.641) (-1108.386) (-1088.177) * (-1091.534) [-1098.462] (-1093.656) (-1090.842) -- 0:01:17
597000 -- (-1087.136) [-1093.431] (-1087.077) (-1094.058) * (-1090.761) (-1086.179) (-1098.254) [-1086.276] -- 0:01:17
598000 -- [-1090.512] (-1085.237) (-1089.430) (-1091.932) * (-1092.174) [-1093.825] (-1098.907) (-1096.188) -- 0:01:17
599000 -- (-1092.142) (-1091.423) [-1085.364] (-1085.311) * (-1096.323) (-1088.309) [-1091.090] (-1096.400) -- 0:01:17
600000 -- (-1090.949) (-1090.271) (-1090.795) [-1100.763] * (-1095.321) [-1089.128] (-1083.886) (-1095.702) -- 0:01:17
Average standard deviation of split frequencies: 0.008814
601000 -- (-1092.135) (-1089.191) (-1089.372) [-1093.925] * [-1089.018] (-1095.174) (-1086.561) (-1096.007) -- 0:01:17
602000 -- [-1095.875] (-1098.118) (-1088.893) (-1098.775) * [-1084.140] (-1094.115) (-1090.923) (-1093.153) -- 0:01:16
603000 -- (-1095.638) (-1089.140) (-1086.429) [-1096.120] * (-1094.314) [-1093.213] (-1092.388) (-1096.737) -- 0:01:17
604000 -- (-1099.535) (-1089.648) (-1091.902) [-1092.880] * (-1091.175) (-1091.976) [-1095.255] (-1092.019) -- 0:01:16
605000 -- [-1094.142] (-1096.103) (-1089.159) (-1088.741) * (-1092.000) (-1100.581) [-1091.355] (-1089.434) -- 0:01:16
Average standard deviation of split frequencies: 0.008317
606000 -- (-1097.190) (-1090.702) (-1093.053) [-1088.673] * [-1090.432] (-1088.197) (-1102.893) (-1090.923) -- 0:01:16
607000 -- (-1092.812) (-1095.726) (-1088.861) [-1091.119] * (-1094.107) (-1093.730) (-1100.281) [-1092.177] -- 0:01:15
608000 -- (-1096.010) (-1088.379) (-1091.842) [-1089.793] * [-1086.082] (-1087.638) (-1096.310) (-1098.119) -- 0:01:16
609000 -- (-1102.160) [-1085.524] (-1090.922) (-1093.879) * (-1081.493) (-1081.694) (-1095.488) [-1086.215] -- 0:01:15
610000 -- (-1098.886) (-1089.313) (-1088.018) [-1097.327] * [-1084.136] (-1089.790) (-1090.603) (-1086.248) -- 0:01:15
Average standard deviation of split frequencies: 0.007066
611000 -- (-1088.232) (-1092.912) [-1089.340] (-1097.731) * (-1083.182) [-1091.921] (-1090.561) (-1103.383) -- 0:01:15
612000 -- (-1097.134) (-1089.789) (-1084.517) [-1088.301] * [-1093.421] (-1096.433) (-1097.900) (-1084.953) -- 0:01:14
613000 -- [-1088.582] (-1090.558) (-1097.814) (-1086.980) * (-1086.779) (-1092.590) (-1093.893) [-1087.050] -- 0:01:15
614000 -- (-1088.081) (-1106.043) (-1094.932) [-1099.243] * (-1089.374) [-1090.358] (-1091.380) (-1089.819) -- 0:01:14
615000 -- [-1085.777] (-1092.670) (-1092.688) (-1086.400) * (-1090.615) (-1092.969) [-1093.866] (-1087.299) -- 0:01:14
Average standard deviation of split frequencies: 0.006299
616000 -- (-1086.996) (-1094.055) (-1088.339) [-1091.747] * (-1087.568) (-1089.774) (-1096.229) [-1090.905] -- 0:01:14
617000 -- (-1095.604) (-1098.340) (-1091.537) [-1085.148] * (-1082.332) (-1088.437) [-1095.482] (-1090.808) -- 0:01:13
618000 -- (-1088.041) (-1090.083) (-1087.971) [-1085.029] * [-1083.663] (-1091.646) (-1089.299) (-1090.723) -- 0:01:13
619000 -- (-1082.771) (-1090.727) [-1086.417] (-1084.915) * (-1085.640) (-1100.403) [-1090.410] (-1084.372) -- 0:01:13
620000 -- (-1089.381) [-1081.755] (-1091.715) (-1089.621) * (-1090.909) [-1084.876] (-1091.738) (-1093.022) -- 0:01:13
Average standard deviation of split frequencies: 0.006018
621000 -- (-1089.384) (-1097.884) (-1085.408) [-1086.702] * (-1098.867) [-1087.411] (-1088.817) (-1086.154) -- 0:01:13
622000 -- (-1091.832) (-1088.984) (-1090.405) [-1088.355] * (-1092.213) [-1083.482] (-1088.028) (-1092.937) -- 0:01:12
623000 -- [-1086.522] (-1091.395) (-1092.317) (-1081.571) * (-1093.801) (-1091.670) [-1086.547] (-1088.813) -- 0:01:12
624000 -- (-1092.157) [-1093.746] (-1087.638) (-1089.145) * (-1092.484) (-1086.571) [-1085.198] (-1087.661) -- 0:01:12
625000 -- (-1089.692) (-1087.708) [-1087.620] (-1091.189) * (-1090.784) (-1092.151) [-1093.690] (-1097.412) -- 0:01:12
Average standard deviation of split frequencies: 0.005445
626000 -- [-1090.166] (-1090.931) (-1086.965) (-1100.389) * (-1091.570) [-1093.238] (-1088.375) (-1094.583) -- 0:01:12
627000 -- [-1089.271] (-1090.488) (-1085.879) (-1095.648) * (-1088.448) (-1095.722) (-1086.840) [-1088.442] -- 0:01:11
628000 -- (-1089.900) (-1100.239) (-1084.540) [-1090.764] * (-1088.360) (-1092.112) (-1101.082) [-1088.220] -- 0:01:11
629000 -- (-1097.599) (-1086.938) [-1092.122] (-1098.453) * (-1088.454) (-1094.840) (-1098.106) [-1085.071] -- 0:01:11
630000 -- (-1087.918) (-1084.486) (-1090.680) [-1085.867] * (-1087.464) (-1088.002) (-1095.357) [-1089.927] -- 0:01:11
Average standard deviation of split frequencies: 0.004830
631000 -- (-1103.145) (-1087.019) (-1095.508) [-1088.724] * [-1086.263] (-1093.634) (-1098.033) (-1093.526) -- 0:01:11
632000 -- (-1098.491) (-1097.467) (-1090.109) [-1089.024] * (-1089.240) [-1094.794] (-1086.084) (-1090.585) -- 0:01:11
633000 -- [-1088.267] (-1094.217) (-1093.069) (-1098.392) * (-1081.998) [-1080.710] (-1086.281) (-1088.203) -- 0:01:10
634000 -- (-1096.898) (-1096.208) (-1086.437) [-1095.361] * [-1089.913] (-1090.785) (-1089.884) (-1087.581) -- 0:01:11
635000 -- (-1090.976) (-1097.946) (-1094.678) [-1106.962] * (-1089.809) [-1089.805] (-1094.094) (-1091.491) -- 0:01:10
Average standard deviation of split frequencies: 0.005131
636000 -- (-1086.618) (-1096.418) [-1084.046] (-1091.770) * (-1091.956) (-1085.518) [-1087.351] (-1090.355) -- 0:01:10
637000 -- (-1087.540) (-1101.636) (-1094.484) [-1092.850] * (-1096.871) (-1100.807) (-1094.107) [-1100.141] -- 0:01:10
638000 -- (-1097.332) (-1096.295) (-1093.266) [-1087.745] * (-1089.084) (-1085.611) [-1083.542] (-1085.273) -- 0:01:09
639000 -- (-1084.996) (-1107.500) (-1090.436) [-1086.463] * (-1091.621) (-1085.750) (-1099.683) [-1083.852] -- 0:01:09
640000 -- (-1090.028) [-1097.478] (-1095.067) (-1090.511) * (-1103.251) (-1087.819) [-1089.385] (-1090.733) -- 0:01:09
Average standard deviation of split frequencies: 0.005603
641000 -- (-1089.032) (-1089.650) (-1091.606) [-1087.285] * (-1085.841) [-1084.542] (-1092.871) (-1083.735) -- 0:01:09
642000 -- [-1084.524] (-1086.127) (-1087.090) (-1089.852) * [-1090.923] (-1085.549) (-1087.694) (-1095.043) -- 0:01:09
643000 -- [-1087.248] (-1093.951) (-1092.867) (-1080.768) * (-1094.979) (-1099.587) (-1093.592) [-1089.946] -- 0:01:08
644000 -- (-1084.658) (-1087.220) (-1087.265) [-1089.678] * (-1088.779) (-1095.606) (-1094.958) [-1084.319] -- 0:01:08
645000 -- (-1090.526) (-1100.812) [-1084.807] (-1083.806) * (-1092.150) (-1090.074) [-1089.905] (-1084.682) -- 0:01:08
Average standard deviation of split frequencies: 0.005557
646000 -- (-1097.697) [-1087.139] (-1081.607) (-1092.012) * (-1089.678) (-1098.089) [-1092.297] (-1089.617) -- 0:01:08
647000 -- (-1091.742) [-1085.612] (-1085.020) (-1085.125) * [-1090.183] (-1096.032) (-1092.449) (-1085.459) -- 0:01:08
648000 -- (-1090.435) (-1089.088) (-1090.992) [-1082.592] * (-1088.574) (-1089.726) (-1090.041) [-1093.496] -- 0:01:07
649000 -- (-1092.921) [-1087.843] (-1090.321) (-1094.036) * (-1086.684) (-1088.556) [-1090.156] (-1090.377) -- 0:01:07
650000 -- (-1083.636) (-1091.255) [-1089.486] (-1086.972) * (-1089.887) [-1090.208] (-1102.363) (-1094.272) -- 0:01:07
Average standard deviation of split frequencies: 0.005239
651000 -- [-1083.558] (-1081.001) (-1085.701) (-1089.973) * (-1102.634) [-1088.965] (-1092.743) (-1094.053) -- 0:01:07
652000 -- (-1087.380) [-1085.618] (-1083.557) (-1090.428) * (-1095.073) [-1086.319] (-1089.126) (-1085.515) -- 0:01:07
653000 -- (-1089.626) (-1094.702) (-1088.318) [-1092.069] * (-1086.329) (-1094.772) (-1090.165) [-1082.044] -- 0:01:06
654000 -- [-1086.515] (-1086.971) (-1088.911) (-1086.820) * (-1096.654) [-1089.707] (-1091.221) (-1090.150) -- 0:01:06
655000 -- [-1085.189] (-1093.603) (-1086.842) (-1089.056) * [-1086.344] (-1086.627) (-1109.009) (-1093.096) -- 0:01:06
Average standard deviation of split frequencies: 0.005528
656000 -- (-1087.230) (-1088.917) [-1086.789] (-1088.517) * [-1088.959] (-1094.549) (-1083.001) (-1093.572) -- 0:01:06
657000 -- (-1086.652) (-1092.327) (-1089.877) [-1082.234] * (-1084.513) (-1087.409) (-1088.895) [-1089.530] -- 0:01:06
658000 -- [-1087.676] (-1093.632) (-1089.947) (-1093.949) * (-1095.995) (-1089.514) [-1081.089] (-1094.866) -- 0:01:06
659000 -- (-1092.804) (-1091.684) [-1087.785] (-1092.369) * (-1088.731) (-1094.211) (-1095.877) [-1089.687] -- 0:01:05
660000 -- [-1091.509] (-1085.440) (-1088.301) (-1087.732) * (-1088.768) [-1083.545] (-1086.091) (-1086.035) -- 0:01:05
Average standard deviation of split frequencies: 0.005653
661000 -- (-1086.462) [-1088.475] (-1089.461) (-1089.280) * (-1086.386) [-1096.150] (-1094.061) (-1098.577) -- 0:01:05
662000 -- [-1090.268] (-1089.574) (-1099.024) (-1092.604) * [-1091.630] (-1086.047) (-1090.663) (-1089.897) -- 0:01:05
663000 -- (-1096.643) (-1087.705) [-1091.052] (-1102.214) * (-1095.058) (-1095.894) (-1091.918) [-1087.163] -- 0:01:05
664000 -- (-1094.638) (-1092.696) (-1086.472) [-1087.654] * [-1094.938] (-1090.419) (-1096.376) (-1082.249) -- 0:01:04
665000 -- (-1091.933) (-1093.049) (-1086.677) [-1081.522] * (-1087.730) (-1092.769) [-1087.084] (-1089.223) -- 0:01:04
Average standard deviation of split frequencies: 0.005281
666000 -- (-1084.215) (-1096.203) (-1084.797) [-1083.936] * (-1089.013) (-1111.430) (-1084.888) [-1087.273] -- 0:01:04
667000 -- (-1093.694) (-1083.951) [-1089.770] (-1104.944) * (-1095.079) (-1096.673) (-1095.724) [-1081.098] -- 0:01:04
668000 -- (-1086.797) [-1090.847] (-1091.761) (-1094.207) * (-1085.131) (-1088.734) (-1089.755) [-1088.611] -- 0:01:04
669000 -- [-1085.484] (-1091.578) (-1092.311) (-1086.500) * (-1096.145) (-1092.313) [-1085.457] (-1089.789) -- 0:01:03
670000 -- [-1086.551] (-1086.838) (-1090.394) (-1091.035) * (-1088.366) (-1098.427) (-1088.884) [-1090.216] -- 0:01:03
Average standard deviation of split frequencies: 0.005353
671000 -- (-1098.315) (-1083.453) (-1092.008) [-1095.135] * [-1090.227] (-1093.604) (-1092.468) (-1099.388) -- 0:01:03
672000 -- (-1089.241) [-1085.353] (-1089.237) (-1100.265) * [-1081.328] (-1096.522) (-1089.801) (-1095.605) -- 0:01:03
673000 -- (-1091.014) [-1085.762] (-1095.222) (-1094.016) * (-1089.869) (-1087.528) [-1090.077] (-1088.544) -- 0:01:03
674000 -- (-1088.189) (-1088.921) [-1089.369] (-1089.604) * [-1089.132] (-1087.005) (-1096.676) (-1080.986) -- 0:01:02
675000 -- (-1095.662) (-1089.995) (-1095.689) [-1080.847] * [-1083.905] (-1088.878) (-1089.142) (-1085.377) -- 0:01:02
Average standard deviation of split frequencies: 0.004989
676000 -- (-1088.174) (-1086.905) (-1095.563) [-1091.075] * [-1093.888] (-1086.184) (-1089.183) (-1093.230) -- 0:01:02
677000 -- [-1093.269] (-1086.085) (-1089.930) (-1088.735) * [-1088.407] (-1090.881) (-1092.288) (-1094.037) -- 0:01:02
678000 -- (-1089.687) (-1093.561) [-1091.473] (-1088.144) * (-1081.802) (-1086.538) [-1090.664] (-1100.439) -- 0:01:02
679000 -- (-1090.405) (-1096.005) (-1093.294) [-1088.427] * [-1088.180] (-1094.140) (-1093.591) (-1094.817) -- 0:01:01
680000 -- [-1087.539] (-1088.475) (-1097.757) (-1089.247) * (-1083.447) (-1085.836) [-1085.510] (-1086.151) -- 0:01:01
Average standard deviation of split frequencies: 0.004528
681000 -- (-1091.778) (-1095.982) [-1092.557] (-1089.955) * [-1089.875] (-1090.801) (-1085.065) (-1095.253) -- 0:01:01
682000 -- [-1095.576] (-1088.120) (-1086.538) (-1091.115) * (-1083.062) (-1087.065) (-1084.686) [-1085.416] -- 0:01:01
683000 -- (-1086.284) (-1096.044) (-1092.742) [-1085.213] * (-1093.248) [-1082.725] (-1088.980) (-1097.077) -- 0:01:01
684000 -- (-1093.879) (-1089.192) [-1090.903] (-1080.966) * [-1094.480] (-1088.207) (-1087.611) (-1079.376) -- 0:01:00
685000 -- (-1095.272) [-1082.496] (-1088.871) (-1090.832) * (-1091.343) (-1084.787) (-1095.808) [-1090.486] -- 0:01:00
Average standard deviation of split frequencies: 0.004863
686000 -- (-1097.916) (-1092.787) (-1094.327) [-1090.444] * [-1087.729] (-1086.772) (-1087.017) (-1087.496) -- 0:01:00
687000 -- (-1087.303) [-1087.985] (-1090.653) (-1096.122) * (-1085.830) [-1090.380] (-1090.725) (-1091.408) -- 0:01:00
688000 -- (-1092.691) [-1091.754] (-1090.245) (-1092.756) * (-1092.653) (-1085.090) (-1085.876) [-1086.052] -- 0:01:00
689000 -- (-1086.833) [-1086.285] (-1085.632) (-1089.998) * (-1086.467) (-1084.875) [-1086.627] (-1089.932) -- 0:01:00
690000 -- (-1088.506) (-1093.420) (-1089.768) [-1084.628] * (-1095.256) [-1088.733] (-1095.898) (-1082.698) -- 0:00:59
Average standard deviation of split frequencies: 0.004883
691000 -- (-1089.386) (-1089.227) (-1095.396) [-1088.667] * (-1089.262) [-1085.999] (-1100.763) (-1089.117) -- 0:00:59
692000 -- (-1086.267) [-1088.163] (-1086.804) (-1088.129) * (-1088.927) [-1085.344] (-1107.351) (-1091.283) -- 0:00:59
693000 -- (-1096.571) [-1087.604] (-1091.423) (-1088.333) * (-1092.652) [-1089.644] (-1091.251) (-1092.158) -- 0:00:59
694000 -- (-1097.476) [-1085.955] (-1088.607) (-1089.296) * [-1087.079] (-1088.217) (-1090.669) (-1082.140) -- 0:00:59
695000 -- [-1088.118] (-1102.322) (-1093.998) (-1095.530) * (-1086.242) (-1086.191) [-1087.946] (-1089.215) -- 0:00:58
Average standard deviation of split frequencies: 0.005314
696000 -- (-1096.229) (-1086.554) (-1086.667) [-1085.910] * (-1086.072) (-1096.940) [-1083.183] (-1090.478) -- 0:00:58
697000 -- (-1096.444) (-1086.462) [-1090.469] (-1085.619) * [-1088.404] (-1087.517) (-1091.366) (-1091.804) -- 0:00:58
698000 -- (-1095.658) (-1087.932) [-1080.794] (-1083.666) * (-1091.201) [-1093.114] (-1089.903) (-1094.364) -- 0:00:58
699000 -- [-1082.691] (-1091.155) (-1085.685) (-1087.893) * (-1089.281) (-1094.428) [-1089.348] (-1090.993) -- 0:00:58
700000 -- (-1085.254) (-1087.583) (-1090.543) [-1088.666] * [-1082.980] (-1095.242) (-1092.709) (-1093.773) -- 0:00:57
Average standard deviation of split frequencies: 0.005486
701000 -- (-1086.025) (-1097.394) [-1087.370] (-1086.419) * (-1089.586) (-1087.415) (-1088.324) [-1088.218] -- 0:00:57
702000 -- (-1091.243) (-1091.535) (-1089.576) [-1094.480] * (-1091.708) (-1085.178) [-1092.154] (-1087.231) -- 0:00:57
703000 -- (-1094.190) (-1094.415) (-1088.364) [-1087.395] * (-1079.409) (-1086.728) (-1094.743) [-1091.041] -- 0:00:57
704000 -- (-1091.771) (-1091.217) [-1093.103] (-1099.055) * (-1085.744) (-1091.120) (-1087.444) [-1094.162] -- 0:00:57
705000 -- (-1086.803) [-1090.435] (-1097.271) (-1086.811) * (-1100.439) [-1085.834] (-1093.234) (-1090.604) -- 0:00:56
Average standard deviation of split frequencies: 0.005085
706000 -- [-1095.961] (-1099.495) (-1091.863) (-1082.405) * (-1086.604) (-1085.304) (-1089.697) [-1087.644] -- 0:00:56
707000 -- [-1094.877] (-1087.482) (-1085.872) (-1096.227) * (-1086.352) [-1088.586] (-1085.930) (-1090.211) -- 0:00:56
708000 -- (-1096.622) (-1089.481) (-1087.818) [-1084.959] * (-1089.092) [-1085.409] (-1087.508) (-1087.686) -- 0:00:56
709000 -- [-1088.279] (-1086.526) (-1084.616) (-1085.178) * (-1095.626) (-1088.363) (-1096.378) [-1090.136] -- 0:00:56
710000 -- (-1088.187) (-1086.130) [-1088.641] (-1084.998) * (-1090.359) (-1095.251) [-1085.171] (-1088.126) -- 0:00:55
Average standard deviation of split frequencies: 0.005664
711000 -- [-1093.628] (-1103.016) (-1088.996) (-1093.627) * [-1083.185] (-1097.167) (-1098.729) (-1092.767) -- 0:00:55
712000 -- (-1090.212) (-1094.239) [-1092.017] (-1092.993) * (-1086.288) (-1086.411) (-1090.521) [-1083.150] -- 0:00:55
713000 -- [-1083.264] (-1089.901) (-1095.752) (-1095.950) * (-1090.797) (-1088.138) [-1084.121] (-1090.712) -- 0:00:55
714000 -- (-1085.402) (-1098.408) [-1092.329] (-1092.968) * [-1090.439] (-1090.709) (-1087.667) (-1091.216) -- 0:00:55
715000 -- (-1088.400) (-1089.262) (-1094.425) [-1094.196] * [-1089.375] (-1093.482) (-1086.724) (-1098.728) -- 0:00:55
Average standard deviation of split frequencies: 0.004811
716000 -- (-1088.294) (-1097.199) (-1091.038) [-1084.626] * [-1085.680] (-1094.026) (-1089.648) (-1083.470) -- 0:00:54
717000 -- [-1095.697] (-1084.098) (-1091.705) (-1092.403) * (-1088.697) (-1095.083) [-1082.062] (-1087.626) -- 0:00:54
718000 -- (-1089.682) (-1088.218) (-1083.661) [-1091.353] * (-1096.940) (-1081.644) (-1083.690) [-1086.808] -- 0:00:54
719000 -- [-1091.405] (-1091.619) (-1093.742) (-1093.862) * (-1087.675) (-1087.059) [-1084.817] (-1102.706) -- 0:00:54
720000 -- (-1093.444) [-1087.762] (-1101.901) (-1099.589) * (-1093.041) (-1099.457) (-1089.208) [-1093.183] -- 0:00:54
Average standard deviation of split frequencies: 0.005183
721000 -- (-1085.739) [-1083.875] (-1085.181) (-1091.689) * (-1096.679) (-1101.772) [-1086.497] (-1085.416) -- 0:00:53
722000 -- (-1094.573) (-1092.084) (-1089.443) [-1085.028] * (-1088.078) [-1082.090] (-1090.886) (-1086.135) -- 0:00:53
723000 -- (-1092.838) (-1092.642) (-1090.443) [-1085.062] * (-1086.951) (-1096.124) (-1087.359) [-1091.081] -- 0:00:53
724000 -- [-1096.048] (-1093.917) (-1089.939) (-1084.967) * (-1094.541) (-1087.558) [-1089.334] (-1085.762) -- 0:00:53
725000 -- (-1092.328) (-1084.101) [-1086.311] (-1087.457) * (-1089.983) (-1095.241) (-1094.842) [-1082.637] -- 0:00:53
Average standard deviation of split frequencies: 0.005244
726000 -- (-1088.057) (-1092.812) (-1086.692) [-1089.024] * [-1094.361] (-1089.384) (-1086.973) (-1092.171) -- 0:00:52
727000 -- (-1090.144) [-1090.326] (-1091.293) (-1093.505) * (-1083.708) (-1086.502) (-1089.796) [-1091.983] -- 0:00:52
728000 -- (-1085.145) (-1087.527) (-1089.059) [-1086.455] * (-1093.033) [-1084.762] (-1091.803) (-1082.878) -- 0:00:52
729000 -- (-1086.028) [-1093.444] (-1087.869) (-1092.185) * (-1090.844) (-1084.800) (-1094.311) [-1082.931] -- 0:00:52
730000 -- (-1088.503) [-1087.290] (-1101.328) (-1090.655) * (-1095.442) (-1090.468) (-1090.464) [-1085.503] -- 0:00:52
Average standard deviation of split frequencies: 0.004913
731000 -- [-1096.796] (-1090.315) (-1094.697) (-1082.162) * (-1101.393) [-1090.853] (-1088.591) (-1088.739) -- 0:00:51
732000 -- [-1083.913] (-1093.621) (-1080.981) (-1100.434) * (-1097.593) (-1086.314) [-1087.769] (-1090.046) -- 0:00:51
733000 -- (-1089.901) (-1085.642) [-1084.063] (-1089.871) * (-1095.657) [-1093.809] (-1087.454) (-1093.453) -- 0:00:51
734000 -- (-1099.059) [-1090.053] (-1086.944) (-1088.908) * (-1085.350) (-1094.532) (-1089.993) [-1094.891] -- 0:00:51
735000 -- [-1086.699] (-1093.956) (-1094.926) (-1096.219) * (-1089.227) (-1094.991) (-1092.652) [-1093.806] -- 0:00:51
Average standard deviation of split frequencies: 0.004828
736000 -- [-1086.878] (-1086.102) (-1082.800) (-1090.059) * [-1093.269] (-1093.804) (-1087.414) (-1096.104) -- 0:00:50
737000 -- (-1085.506) (-1090.970) (-1094.719) [-1085.927] * [-1085.494] (-1087.590) (-1091.793) (-1089.391) -- 0:00:50
738000 -- [-1086.498] (-1085.903) (-1090.971) (-1086.490) * (-1087.554) (-1086.121) (-1092.663) [-1088.985] -- 0:00:50
739000 -- [-1093.781] (-1098.348) (-1088.040) (-1094.991) * (-1090.335) [-1088.093] (-1087.563) (-1088.305) -- 0:00:50
740000 -- (-1092.838) (-1083.812) (-1092.836) [-1093.765] * [-1088.467] (-1093.871) (-1092.620) (-1092.464) -- 0:00:50
Average standard deviation of split frequencies: 0.005532
741000 -- (-1088.244) [-1088.942] (-1091.417) (-1086.359) * [-1092.723] (-1095.805) (-1097.042) (-1088.352) -- 0:00:49
742000 -- [-1087.401] (-1087.492) (-1096.530) (-1094.311) * (-1095.050) (-1091.403) (-1087.278) [-1080.578] -- 0:00:49
743000 -- (-1097.231) (-1086.266) [-1096.699] (-1084.351) * [-1089.886] (-1092.387) (-1091.040) (-1091.122) -- 0:00:49
744000 -- (-1084.560) (-1093.265) (-1093.804) [-1085.238] * [-1086.108] (-1087.167) (-1085.643) (-1093.567) -- 0:00:49
745000 -- (-1095.181) [-1093.677] (-1088.622) (-1091.905) * (-1088.957) (-1096.921) (-1086.076) [-1090.046] -- 0:00:49
Average standard deviation of split frequencies: 0.005833
746000 -- (-1091.957) (-1090.024) (-1088.475) [-1087.542] * [-1087.519] (-1092.572) (-1084.671) (-1090.393) -- 0:00:49
747000 -- (-1101.787) (-1088.590) [-1088.391] (-1088.471) * [-1083.502] (-1098.144) (-1089.564) (-1101.411) -- 0:00:48
748000 -- (-1090.855) (-1093.403) [-1097.805] (-1092.498) * (-1092.958) (-1090.330) (-1092.229) [-1088.256] -- 0:00:48
749000 -- (-1089.051) [-1088.702] (-1082.977) (-1092.652) * [-1082.266] (-1085.654) (-1091.178) (-1087.888) -- 0:00:48
750000 -- (-1103.757) (-1094.941) [-1087.038] (-1097.098) * (-1086.669) [-1088.540] (-1092.243) (-1087.472) -- 0:00:48
Average standard deviation of split frequencies: 0.006135
751000 -- (-1094.873) (-1089.498) [-1087.807] (-1094.614) * [-1084.419] (-1089.267) (-1096.339) (-1087.300) -- 0:00:48
752000 -- [-1088.397] (-1085.087) (-1087.142) (-1083.269) * (-1082.874) (-1099.764) [-1087.655] (-1095.915) -- 0:00:47
753000 -- [-1085.298] (-1101.287) (-1096.614) (-1094.754) * (-1090.389) [-1090.263] (-1095.517) (-1089.339) -- 0:00:47
754000 -- (-1092.866) [-1090.108] (-1089.077) (-1086.665) * (-1092.466) (-1094.835) (-1084.129) [-1090.676] -- 0:00:47
755000 -- (-1096.996) (-1087.807) [-1091.212] (-1095.846) * [-1088.621] (-1084.514) (-1089.255) (-1084.716) -- 0:00:47
Average standard deviation of split frequencies: 0.006523
756000 -- (-1091.873) (-1087.118) [-1087.643] (-1090.837) * (-1098.110) (-1089.982) (-1087.321) [-1096.176] -- 0:00:47
757000 -- (-1095.774) (-1090.770) (-1084.193) [-1088.092] * (-1101.015) [-1084.894] (-1094.327) (-1091.133) -- 0:00:46
758000 -- (-1091.011) (-1090.850) [-1087.241] (-1088.854) * (-1095.748) (-1082.600) (-1093.891) [-1087.785] -- 0:00:46
759000 -- (-1087.782) (-1089.341) [-1089.827] (-1090.687) * [-1084.373] (-1092.246) (-1100.705) (-1086.308) -- 0:00:46
760000 -- (-1088.045) (-1096.770) (-1086.132) [-1089.212] * (-1082.025) (-1090.976) (-1090.256) [-1088.642] -- 0:00:46
Average standard deviation of split frequencies: 0.006674
761000 -- (-1083.528) (-1093.270) (-1093.789) [-1088.128] * (-1084.696) (-1081.620) [-1086.997] (-1083.872) -- 0:00:46
762000 -- [-1081.452] (-1091.102) (-1084.028) (-1089.950) * (-1086.148) [-1089.435] (-1086.455) (-1093.551) -- 0:00:45
763000 -- (-1088.637) (-1090.667) [-1091.755] (-1093.364) * (-1087.714) (-1088.658) (-1091.051) [-1085.068] -- 0:00:45
764000 -- (-1097.611) [-1092.949] (-1088.774) (-1093.681) * [-1085.541] (-1088.989) (-1090.776) (-1090.040) -- 0:00:45
765000 -- (-1094.098) (-1102.687) [-1091.204] (-1094.195) * (-1093.034) (-1093.877) [-1095.167] (-1086.351) -- 0:00:45
Average standard deviation of split frequencies: 0.007101
766000 -- [-1092.169] (-1098.257) (-1090.986) (-1108.585) * (-1094.481) (-1091.074) [-1086.474] (-1090.030) -- 0:00:45
767000 -- (-1107.002) (-1088.337) [-1088.359] (-1096.323) * (-1091.030) (-1094.904) [-1088.112] (-1089.384) -- 0:00:44
768000 -- (-1098.304) (-1087.064) [-1088.598] (-1098.537) * (-1090.818) (-1100.830) (-1092.164) [-1087.163] -- 0:00:44
769000 -- (-1096.163) (-1098.353) (-1086.757) [-1099.066] * (-1089.802) (-1098.933) (-1085.957) [-1094.106] -- 0:00:44
770000 -- (-1093.923) (-1100.155) (-1100.115) [-1092.768] * (-1091.654) (-1086.105) [-1084.429] (-1100.008) -- 0:00:44
Average standard deviation of split frequencies: 0.006823
771000 -- [-1089.374] (-1098.132) (-1094.114) (-1085.391) * (-1092.765) (-1091.817) [-1084.181] (-1089.756) -- 0:00:44
772000 -- (-1085.221) [-1102.071] (-1088.186) (-1094.779) * [-1096.450] (-1092.462) (-1086.912) (-1094.535) -- 0:00:44
773000 -- [-1083.030] (-1093.390) (-1097.185) (-1091.149) * (-1090.046) (-1089.918) [-1084.303] (-1095.013) -- 0:00:43
774000 -- [-1084.338] (-1091.905) (-1095.435) (-1090.062) * (-1100.911) (-1086.855) [-1089.519] (-1093.553) -- 0:00:43
775000 -- (-1094.593) (-1096.653) [-1084.831] (-1097.330) * (-1087.995) [-1085.449] (-1087.849) (-1083.480) -- 0:00:43
Average standard deviation of split frequencies: 0.006495
776000 -- (-1098.377) (-1095.869) [-1087.365] (-1092.375) * (-1086.298) [-1085.288] (-1086.733) (-1089.574) -- 0:00:43
777000 -- (-1090.758) (-1085.557) (-1089.112) [-1084.933] * [-1087.700] (-1085.257) (-1099.658) (-1093.292) -- 0:00:43
778000 -- (-1088.901) (-1084.923) [-1078.876] (-1088.127) * [-1085.611] (-1087.674) (-1091.911) (-1088.783) -- 0:00:42
779000 -- (-1093.284) (-1086.407) [-1090.023] (-1091.638) * (-1093.736) (-1086.005) [-1093.275] (-1095.212) -- 0:00:42
780000 -- (-1091.288) (-1095.111) [-1088.369] (-1084.338) * (-1092.529) (-1093.483) [-1088.520] (-1095.500) -- 0:00:42
Average standard deviation of split frequencies: 0.006735
781000 -- (-1092.481) (-1091.518) (-1088.698) [-1089.084] * (-1093.519) [-1091.228] (-1085.665) (-1100.971) -- 0:00:42
782000 -- (-1101.375) (-1090.084) (-1088.811) [-1085.748] * (-1098.738) (-1092.475) (-1088.357) [-1085.038] -- 0:00:42
783000 -- [-1091.125] (-1092.136) (-1086.233) (-1085.110) * (-1091.522) [-1085.846] (-1086.699) (-1084.339) -- 0:00:41
784000 -- (-1087.651) (-1088.534) [-1088.222] (-1088.174) * [-1097.453] (-1090.518) (-1094.306) (-1087.613) -- 0:00:41
785000 -- [-1085.742] (-1084.512) (-1088.204) (-1094.696) * (-1090.278) (-1099.145) [-1087.469] (-1095.074) -- 0:00:41
Average standard deviation of split frequencies: 0.007059
786000 -- [-1091.826] (-1091.408) (-1092.199) (-1092.548) * [-1095.727] (-1090.655) (-1089.964) (-1103.912) -- 0:00:41
787000 -- (-1086.728) (-1100.198) [-1087.755] (-1090.498) * [-1095.493] (-1093.585) (-1093.193) (-1100.973) -- 0:00:41
788000 -- (-1086.910) [-1084.054] (-1085.827) (-1098.595) * (-1089.269) (-1095.871) (-1086.130) [-1093.396] -- 0:00:40
789000 -- (-1090.848) (-1090.503) [-1093.753] (-1089.509) * (-1092.652) (-1098.551) (-1091.738) [-1086.002] -- 0:00:40
790000 -- (-1090.831) (-1093.806) [-1088.520] (-1090.347) * (-1093.874) (-1093.885) (-1096.486) [-1089.015] -- 0:00:40
Average standard deviation of split frequencies: 0.007155
791000 -- (-1092.288) [-1083.866] (-1088.091) (-1093.847) * (-1094.925) [-1087.310] (-1093.841) (-1095.083) -- 0:00:40
792000 -- (-1092.620) (-1093.463) [-1090.434] (-1088.113) * (-1094.131) (-1091.163) (-1094.739) [-1088.131] -- 0:00:40
793000 -- (-1096.902) [-1091.499] (-1093.846) (-1090.942) * (-1091.130) [-1085.711] (-1093.611) (-1090.434) -- 0:00:39
794000 -- (-1087.511) [-1083.048] (-1084.071) (-1092.971) * (-1086.902) [-1089.321] (-1096.915) (-1103.595) -- 0:00:39
795000 -- (-1081.940) (-1090.114) (-1088.760) [-1084.559] * (-1086.231) [-1087.801] (-1097.699) (-1087.433) -- 0:00:39
Average standard deviation of split frequencies: 0.006924
796000 -- (-1089.556) (-1089.633) (-1092.251) [-1088.828] * (-1097.629) (-1088.652) [-1094.805] (-1092.921) -- 0:00:39
797000 -- (-1095.582) (-1086.841) [-1094.459] (-1091.778) * (-1087.993) (-1093.164) (-1097.968) [-1094.479] -- 0:00:39
798000 -- (-1091.104) [-1088.320] (-1099.742) (-1091.418) * (-1092.097) (-1092.314) (-1094.300) [-1091.115] -- 0:00:38
799000 -- (-1095.589) (-1087.404) (-1093.314) [-1085.771] * [-1089.641] (-1091.647) (-1086.232) (-1092.071) -- 0:00:38
800000 -- (-1094.555) (-1082.187) [-1097.502] (-1088.210) * [-1086.780] (-1094.323) (-1091.373) (-1103.778) -- 0:00:38
Average standard deviation of split frequencies: 0.006884
801000 -- (-1099.575) (-1087.521) [-1095.773] (-1084.935) * (-1092.002) (-1099.842) [-1085.453] (-1089.925) -- 0:00:38
802000 -- (-1094.887) (-1091.646) [-1084.704] (-1082.928) * [-1086.695] (-1084.575) (-1087.037) (-1090.883) -- 0:00:38
803000 -- [-1089.265] (-1088.139) (-1087.322) (-1091.751) * (-1089.403) (-1089.243) (-1092.119) [-1089.181] -- 0:00:38
804000 -- (-1083.273) (-1088.684) [-1091.995] (-1090.962) * (-1084.044) (-1087.720) [-1089.192] (-1098.780) -- 0:00:37
805000 -- (-1083.515) (-1092.424) [-1080.587] (-1088.371) * (-1093.052) (-1093.544) (-1093.241) [-1085.958] -- 0:00:37
Average standard deviation of split frequencies: 0.007018
806000 -- (-1087.350) (-1093.752) (-1087.135) [-1092.073] * [-1098.151] (-1094.188) (-1089.934) (-1084.051) -- 0:00:37
807000 -- (-1093.768) (-1087.866) (-1100.746) [-1089.756] * (-1085.130) (-1088.951) [-1098.948] (-1087.265) -- 0:00:37
808000 -- (-1096.995) [-1086.169] (-1087.183) (-1092.180) * (-1088.996) (-1090.188) (-1094.807) [-1087.832] -- 0:00:37
809000 -- (-1091.144) (-1087.471) [-1095.767] (-1087.254) * (-1094.901) (-1084.859) [-1088.888] (-1091.036) -- 0:00:36
810000 -- (-1094.843) (-1085.971) [-1086.828] (-1091.085) * (-1088.784) [-1087.835] (-1084.537) (-1089.978) -- 0:00:36
Average standard deviation of split frequencies: 0.006978
811000 -- (-1095.512) (-1099.531) (-1088.530) [-1089.207] * (-1093.698) [-1089.708] (-1083.127) (-1084.599) -- 0:00:36
812000 -- (-1089.490) [-1090.741] (-1090.956) (-1084.065) * (-1088.431) (-1094.105) [-1087.420] (-1085.836) -- 0:00:36
813000 -- (-1087.760) [-1087.411] (-1081.544) (-1087.364) * (-1088.930) [-1089.546] (-1086.139) (-1086.099) -- 0:00:36
814000 -- [-1087.103] (-1091.345) (-1088.570) (-1092.806) * (-1084.284) (-1091.373) [-1090.223] (-1088.774) -- 0:00:35
815000 -- (-1082.015) [-1087.543] (-1093.329) (-1087.672) * (-1093.801) (-1087.223) (-1100.412) [-1084.926] -- 0:00:35
Average standard deviation of split frequencies: 0.007243
816000 -- (-1089.056) [-1085.813] (-1087.856) (-1098.695) * (-1097.475) [-1096.553] (-1109.478) (-1085.657) -- 0:00:35
817000 -- (-1083.924) (-1086.810) (-1090.920) [-1088.526] * [-1092.747] (-1091.905) (-1092.846) (-1088.505) -- 0:00:35
818000 -- (-1084.156) (-1089.530) [-1092.593] (-1093.057) * [-1086.628] (-1093.390) (-1093.235) (-1084.033) -- 0:00:35
819000 -- [-1081.462] (-1086.651) (-1084.265) (-1088.607) * (-1084.712) [-1089.860] (-1099.411) (-1089.708) -- 0:00:34
820000 -- (-1104.133) (-1098.434) (-1097.030) [-1087.522] * [-1089.481] (-1090.540) (-1087.242) (-1102.527) -- 0:00:34
Average standard deviation of split frequencies: 0.006981
821000 -- (-1089.012) (-1084.054) (-1100.710) [-1089.777] * (-1090.857) [-1091.035] (-1091.778) (-1089.975) -- 0:00:34
822000 -- (-1092.031) (-1084.152) [-1094.253] (-1092.114) * (-1095.824) (-1087.198) [-1093.486] (-1084.771) -- 0:00:34
823000 -- (-1098.345) [-1087.060] (-1099.624) (-1086.297) * (-1090.652) (-1086.287) (-1088.427) [-1087.386] -- 0:00:34
824000 -- (-1095.100) (-1096.305) (-1102.451) [-1089.496] * [-1088.611] (-1090.301) (-1090.212) (-1086.646) -- 0:00:33
825000 -- (-1087.999) (-1093.678) [-1092.042] (-1085.525) * (-1089.810) (-1089.797) (-1083.442) [-1086.639] -- 0:00:33
Average standard deviation of split frequencies: 0.006717
826000 -- (-1090.359) (-1086.524) (-1087.339) [-1086.383] * (-1088.512) (-1101.121) (-1086.482) [-1084.561] -- 0:00:33
827000 -- (-1086.895) (-1093.909) (-1090.429) [-1083.681] * (-1085.048) (-1089.215) (-1096.717) [-1085.153] -- 0:00:33
828000 -- (-1091.291) (-1091.918) [-1087.735] (-1086.625) * (-1088.356) (-1094.242) [-1097.945] (-1089.525) -- 0:00:33
829000 -- (-1092.690) (-1099.007) [-1085.687] (-1091.902) * (-1087.654) [-1093.807] (-1090.967) (-1093.785) -- 0:00:33
830000 -- (-1092.298) (-1103.629) (-1089.146) [-1082.962] * [-1084.237] (-1100.764) (-1086.147) (-1095.740) -- 0:00:32
Average standard deviation of split frequencies: 0.007683
831000 -- (-1094.097) (-1091.963) [-1093.905] (-1096.041) * (-1082.757) (-1094.090) (-1089.420) [-1089.274] -- 0:00:32
832000 -- [-1083.882] (-1095.511) (-1092.393) (-1086.183) * (-1095.293) (-1092.091) (-1088.140) [-1087.367] -- 0:00:32
833000 -- (-1089.545) (-1089.861) (-1093.356) [-1085.885] * (-1098.074) [-1086.582] (-1091.885) (-1088.440) -- 0:00:32
834000 -- (-1094.111) [-1078.513] (-1089.163) (-1097.237) * (-1091.285) (-1095.966) (-1089.998) [-1085.497] -- 0:00:32
835000 -- (-1091.782) (-1094.091) [-1083.029] (-1093.292) * (-1089.800) [-1094.181] (-1090.432) (-1087.151) -- 0:00:31
Average standard deviation of split frequencies: 0.007851
836000 -- (-1096.150) [-1087.973] (-1087.302) (-1091.809) * (-1089.662) [-1086.565] (-1095.430) (-1082.611) -- 0:00:31
837000 -- (-1097.524) [-1084.988] (-1086.535) (-1083.455) * [-1086.842] (-1091.010) (-1094.755) (-1086.383) -- 0:00:31
838000 -- (-1091.152) [-1094.367] (-1092.197) (-1092.524) * [-1088.955] (-1087.743) (-1090.314) (-1090.125) -- 0:00:31
839000 -- (-1093.223) [-1093.545] (-1090.712) (-1103.999) * [-1096.881] (-1093.342) (-1090.426) (-1088.594) -- 0:00:31
840000 -- (-1093.907) (-1088.523) [-1084.449] (-1090.137) * (-1083.797) (-1090.173) (-1098.653) [-1089.552] -- 0:00:30
Average standard deviation of split frequencies: 0.007635
841000 -- (-1111.589) (-1085.630) (-1084.748) [-1084.197] * (-1082.636) [-1094.557] (-1107.172) (-1094.106) -- 0:00:30
842000 -- (-1089.939) (-1089.410) [-1091.304] (-1088.298) * [-1083.089] (-1096.184) (-1087.271) (-1083.923) -- 0:00:30
843000 -- [-1092.508] (-1086.159) (-1092.421) (-1082.678) * (-1086.685) [-1089.719] (-1091.912) (-1087.441) -- 0:00:30
844000 -- (-1089.122) [-1093.158] (-1091.861) (-1087.482) * (-1085.836) (-1086.566) [-1091.088] (-1092.815) -- 0:00:30
845000 -- [-1079.452] (-1099.471) (-1095.604) (-1086.944) * (-1096.478) [-1091.690] (-1094.983) (-1097.078) -- 0:00:29
Average standard deviation of split frequencies: 0.007715
846000 -- (-1088.186) (-1090.310) [-1089.689] (-1088.134) * [-1084.608] (-1086.087) (-1089.020) (-1089.388) -- 0:00:29
847000 -- (-1088.551) (-1091.241) (-1093.056) [-1087.468] * (-1089.434) [-1085.075] (-1088.659) (-1088.661) -- 0:00:29
848000 -- (-1091.626) (-1089.436) [-1088.179] (-1088.875) * (-1093.513) (-1089.153) (-1085.828) [-1084.899] -- 0:00:29
849000 -- (-1091.458) (-1090.412) [-1089.023] (-1089.220) * (-1085.392) [-1088.825] (-1092.084) (-1088.989) -- 0:00:29
850000 -- [-1089.274] (-1092.542) (-1087.094) (-1091.843) * [-1090.511] (-1092.179) (-1096.941) (-1091.321) -- 0:00:28
Average standard deviation of split frequencies: 0.007502
851000 -- [-1080.743] (-1094.823) (-1092.493) (-1090.214) * (-1092.613) (-1093.649) (-1086.985) [-1083.794] -- 0:00:28
852000 -- (-1087.135) [-1083.654] (-1087.911) (-1099.418) * (-1083.306) (-1087.340) [-1089.530] (-1096.817) -- 0:00:28
853000 -- [-1090.803] (-1084.333) (-1092.351) (-1098.621) * (-1088.117) (-1090.068) (-1086.662) [-1085.658] -- 0:00:28
854000 -- (-1089.673) [-1090.063] (-1091.229) (-1088.476) * (-1088.002) (-1092.954) [-1088.034] (-1091.742) -- 0:00:28
855000 -- (-1095.013) (-1090.901) [-1092.842] (-1091.952) * (-1090.076) [-1092.442] (-1080.197) (-1086.814) -- 0:00:27
Average standard deviation of split frequencies: 0.007371
856000 -- (-1092.249) (-1093.397) (-1085.320) [-1091.114] * [-1090.737] (-1091.652) (-1095.737) (-1093.032) -- 0:00:27
857000 -- (-1109.711) (-1090.055) [-1098.198] (-1089.928) * [-1086.631] (-1087.202) (-1094.878) (-1091.400) -- 0:00:27
858000 -- (-1096.340) [-1090.117] (-1091.961) (-1102.819) * [-1091.672] (-1096.475) (-1099.270) (-1084.763) -- 0:00:27
859000 -- (-1083.208) (-1089.093) [-1100.802] (-1097.422) * (-1089.443) (-1104.280) [-1092.367] (-1090.793) -- 0:00:27
860000 -- (-1088.204) (-1091.088) [-1093.802] (-1099.074) * [-1090.789] (-1095.352) (-1098.296) (-1088.214) -- 0:00:27
Average standard deviation of split frequencies: 0.007373
861000 -- [-1087.655] (-1087.970) (-1090.588) (-1085.808) * (-1093.844) (-1090.891) (-1087.851) [-1093.442] -- 0:00:26
862000 -- (-1091.363) (-1098.721) [-1085.292] (-1087.129) * (-1092.201) (-1095.510) (-1084.424) [-1091.075] -- 0:00:26
863000 -- (-1097.038) (-1095.524) (-1090.520) [-1084.823] * (-1087.527) [-1089.052] (-1087.721) (-1098.262) -- 0:00:26
864000 -- (-1095.823) (-1090.153) (-1090.420) [-1086.359] * [-1093.486] (-1097.479) (-1087.242) (-1091.169) -- 0:00:26
865000 -- (-1096.083) (-1090.516) [-1092.359] (-1085.148) * (-1088.550) (-1096.842) [-1087.125] (-1088.664) -- 0:00:26
Average standard deviation of split frequencies: 0.007746
866000 -- [-1085.934] (-1094.314) (-1087.552) (-1085.745) * (-1084.739) (-1087.153) [-1089.113] (-1091.118) -- 0:00:25
867000 -- (-1088.456) (-1088.447) [-1097.929] (-1092.521) * [-1089.522] (-1089.547) (-1094.813) (-1093.823) -- 0:00:25
868000 -- (-1091.676) (-1092.346) (-1095.119) [-1088.188] * [-1085.410] (-1093.693) (-1089.485) (-1089.846) -- 0:00:25
869000 -- (-1088.498) (-1089.588) [-1090.493] (-1085.462) * (-1094.221) (-1099.248) (-1084.793) [-1084.812] -- 0:00:25
870000 -- (-1092.375) (-1083.603) (-1086.475) [-1086.685] * (-1085.071) [-1085.770] (-1090.853) (-1089.596) -- 0:00:25
Average standard deviation of split frequencies: 0.007538
871000 -- (-1086.849) [-1089.391] (-1104.316) (-1087.275) * (-1091.149) (-1085.316) (-1094.571) [-1089.608] -- 0:00:24
872000 -- (-1090.091) (-1083.012) (-1089.829) [-1090.185] * (-1089.981) (-1086.295) (-1084.668) [-1094.751] -- 0:00:24
873000 -- (-1089.700) [-1092.419] (-1087.842) (-1087.471) * (-1092.329) [-1090.854] (-1097.373) (-1102.589) -- 0:00:24
874000 -- (-1098.650) (-1090.262) [-1082.869] (-1097.847) * (-1086.760) (-1089.181) [-1085.373] (-1101.011) -- 0:00:24
875000 -- (-1096.152) (-1091.455) [-1089.475] (-1094.342) * (-1093.328) (-1088.919) [-1098.852] (-1093.559) -- 0:00:24
Average standard deviation of split frequencies: 0.007285
876000 -- (-1091.030) (-1088.717) [-1083.592] (-1099.591) * (-1087.750) (-1085.680) [-1087.058] (-1096.014) -- 0:00:23
877000 -- [-1086.755] (-1087.900) (-1093.535) (-1101.910) * (-1095.529) [-1086.143] (-1089.257) (-1102.650) -- 0:00:23
878000 -- (-1096.211) [-1094.913] (-1089.987) (-1097.259) * (-1083.552) (-1089.160) [-1089.300] (-1096.590) -- 0:00:23
879000 -- [-1090.827] (-1095.692) (-1088.369) (-1089.635) * (-1089.085) (-1095.975) [-1094.851] (-1092.262) -- 0:00:23
880000 -- [-1091.104] (-1098.342) (-1088.546) (-1088.749) * (-1094.694) (-1091.529) [-1095.606] (-1084.792) -- 0:00:23
Average standard deviation of split frequencies: 0.007535
881000 -- (-1088.727) (-1092.106) (-1086.081) [-1089.846] * (-1091.822) (-1094.197) [-1082.424] (-1097.286) -- 0:00:22
882000 -- [-1088.918] (-1095.405) (-1097.162) (-1086.280) * [-1083.209] (-1096.055) (-1093.542) (-1093.381) -- 0:00:22
883000 -- (-1089.612) (-1097.056) [-1082.848] (-1083.783) * [-1089.044] (-1095.487) (-1086.989) (-1089.117) -- 0:00:22
884000 -- (-1089.218) (-1091.115) [-1093.835] (-1095.557) * (-1096.641) [-1092.674] (-1090.242) (-1097.864) -- 0:00:22
885000 -- (-1094.071) (-1085.590) [-1089.983] (-1085.898) * (-1091.723) [-1080.794] (-1094.038) (-1097.359) -- 0:00:22
Average standard deviation of split frequencies: 0.007694
886000 -- (-1090.242) (-1087.269) (-1091.965) [-1087.330] * (-1088.031) [-1086.951] (-1097.778) (-1092.612) -- 0:00:22
887000 -- (-1098.919) (-1085.165) [-1084.528] (-1088.151) * (-1092.754) [-1089.573] (-1086.295) (-1086.235) -- 0:00:21
888000 -- (-1089.437) [-1096.538] (-1088.000) (-1084.482) * [-1083.705] (-1085.565) (-1089.326) (-1090.669) -- 0:00:21
889000 -- (-1085.691) (-1101.173) [-1087.688] (-1083.919) * [-1088.431] (-1099.717) (-1094.344) (-1087.334) -- 0:00:21
890000 -- (-1092.159) (-1108.620) (-1094.142) [-1081.998] * (-1097.052) (-1094.069) [-1095.191] (-1086.452) -- 0:00:21
Average standard deviation of split frequencies: 0.008183
891000 -- [-1087.576] (-1086.645) (-1094.444) (-1091.039) * (-1092.291) (-1086.045) (-1100.979) [-1098.577] -- 0:00:21
892000 -- (-1082.623) (-1082.805) (-1094.270) [-1087.444] * [-1084.581] (-1093.944) (-1092.207) (-1088.387) -- 0:00:20
893000 -- (-1084.044) [-1090.549] (-1091.616) (-1094.225) * (-1088.253) [-1087.258] (-1091.486) (-1091.740) -- 0:00:20
894000 -- [-1089.719] (-1094.129) (-1086.145) (-1097.302) * (-1095.456) [-1079.538] (-1098.526) (-1090.046) -- 0:00:20
895000 -- (-1094.433) (-1099.182) [-1093.271] (-1085.500) * (-1085.068) [-1085.876] (-1095.117) (-1088.694) -- 0:00:20
Average standard deviation of split frequencies: 0.008054
896000 -- (-1089.293) [-1089.603] (-1092.507) (-1093.234) * [-1085.281] (-1085.994) (-1093.310) (-1094.711) -- 0:00:20
897000 -- (-1083.025) (-1084.115) [-1084.412] (-1089.385) * [-1096.828] (-1090.692) (-1093.719) (-1095.905) -- 0:00:19
898000 -- (-1083.389) (-1090.661) (-1092.409) [-1091.118] * (-1094.171) [-1090.797] (-1083.705) (-1088.926) -- 0:00:19
899000 -- (-1095.802) (-1087.595) (-1086.689) [-1088.483] * [-1091.778] (-1098.823) (-1089.569) (-1091.791) -- 0:00:19
900000 -- (-1086.999) (-1091.735) (-1094.991) [-1088.240] * [-1084.512] (-1094.266) (-1092.222) (-1094.666) -- 0:00:19
Average standard deviation of split frequencies: 0.008173
901000 -- [-1087.932] (-1095.406) (-1093.759) (-1090.645) * (-1081.749) (-1097.478) (-1090.195) [-1082.444] -- 0:00:19
902000 -- (-1096.356) [-1091.794] (-1093.378) (-1084.686) * [-1088.672] (-1088.749) (-1088.657) (-1088.747) -- 0:00:18
903000 -- (-1093.907) (-1094.674) (-1085.038) [-1092.792] * (-1096.038) [-1092.119] (-1096.257) (-1093.876) -- 0:00:18
904000 -- (-1092.144) (-1090.727) [-1087.639] (-1089.066) * (-1088.735) [-1087.781] (-1086.911) (-1088.749) -- 0:00:18
905000 -- [-1091.912] (-1088.932) (-1095.800) (-1093.778) * [-1086.314] (-1091.044) (-1092.276) (-1094.837) -- 0:00:18
Average standard deviation of split frequencies: 0.008045
906000 -- (-1092.166) (-1086.753) (-1103.372) [-1086.282] * (-1083.438) (-1087.330) [-1096.997] (-1096.869) -- 0:00:18
907000 -- (-1093.815) [-1086.966] (-1094.059) (-1088.020) * (-1095.673) (-1091.317) (-1088.648) [-1086.166] -- 0:00:17
908000 -- (-1097.400) [-1086.006] (-1092.242) (-1084.345) * [-1090.426] (-1085.064) (-1088.980) (-1086.832) -- 0:00:17
909000 -- [-1101.136] (-1087.918) (-1082.878) (-1097.338) * (-1085.052) (-1085.452) (-1090.207) [-1088.248] -- 0:00:17
910000 -- [-1103.777] (-1091.565) (-1090.683) (-1094.638) * (-1093.529) [-1087.354] (-1085.472) (-1092.028) -- 0:00:17
Average standard deviation of split frequencies: 0.008282
911000 -- (-1090.180) [-1090.814] (-1084.885) (-1087.389) * [-1091.880] (-1095.452) (-1094.972) (-1092.383) -- 0:00:17
912000 -- (-1095.283) (-1089.202) [-1086.961] (-1086.922) * (-1091.453) [-1089.094] (-1091.312) (-1089.783) -- 0:00:16
913000 -- [-1087.131] (-1093.067) (-1090.025) (-1086.957) * (-1088.060) (-1090.339) [-1093.325] (-1095.251) -- 0:00:16
914000 -- (-1096.200) [-1088.201] (-1090.470) (-1089.122) * [-1094.147] (-1090.889) (-1086.777) (-1091.314) -- 0:00:16
915000 -- [-1094.652] (-1089.170) (-1103.119) (-1087.925) * [-1102.077] (-1095.182) (-1088.785) (-1088.483) -- 0:00:16
Average standard deviation of split frequencies: 0.007957
916000 -- [-1085.949] (-1095.942) (-1100.831) (-1094.155) * (-1095.349) [-1089.228] (-1083.998) (-1089.856) -- 0:00:16
917000 -- (-1093.283) [-1091.025] (-1084.419) (-1089.047) * (-1092.341) [-1091.870] (-1097.722) (-1087.138) -- 0:00:16
918000 -- [-1082.032] (-1084.668) (-1088.296) (-1091.961) * (-1091.676) (-1088.775) (-1092.095) [-1084.560] -- 0:00:15
919000 -- (-1089.669) (-1089.599) [-1087.840] (-1088.875) * (-1099.558) (-1089.041) [-1085.095] (-1094.806) -- 0:00:15
920000 -- [-1085.275] (-1093.691) (-1091.075) (-1093.231) * (-1092.155) [-1091.923] (-1085.505) (-1086.847) -- 0:00:15
Average standard deviation of split frequencies: 0.008232
921000 -- (-1093.786) [-1081.202] (-1100.489) (-1088.199) * (-1088.314) (-1090.135) (-1091.129) [-1082.982] -- 0:00:15
922000 -- (-1087.647) (-1095.017) [-1081.870] (-1100.253) * [-1090.765] (-1086.385) (-1090.646) (-1087.195) -- 0:00:15
923000 -- [-1089.255] (-1093.541) (-1098.456) (-1100.719) * [-1097.286] (-1096.704) (-1085.548) (-1091.143) -- 0:00:14
924000 -- (-1088.237) (-1087.725) (-1096.832) [-1089.280] * (-1092.130) (-1085.934) (-1085.467) [-1093.847] -- 0:00:14
925000 -- [-1092.711] (-1092.790) (-1096.861) (-1082.884) * (-1088.467) (-1087.386) (-1084.359) [-1085.244] -- 0:00:14
Average standard deviation of split frequencies: 0.007910
926000 -- [-1086.633] (-1094.476) (-1089.604) (-1091.094) * (-1084.914) [-1091.649] (-1088.225) (-1091.645) -- 0:00:14
927000 -- (-1091.101) (-1085.212) (-1090.676) [-1087.577] * [-1089.511] (-1089.046) (-1088.580) (-1088.497) -- 0:00:14
928000 -- (-1090.608) (-1084.197) (-1084.865) [-1094.233] * (-1090.115) (-1099.609) [-1084.888] (-1094.137) -- 0:00:13
929000 -- (-1082.912) (-1084.452) [-1091.380] (-1096.301) * (-1100.898) (-1098.350) [-1086.260] (-1086.957) -- 0:00:13
930000 -- [-1084.657] (-1091.583) (-1090.091) (-1094.716) * (-1087.630) (-1088.415) (-1092.646) [-1087.107] -- 0:00:13
Average standard deviation of split frequencies: 0.008377
931000 -- [-1084.213] (-1092.959) (-1093.262) (-1089.853) * (-1100.842) [-1090.818] (-1085.510) (-1095.878) -- 0:00:13
932000 -- (-1091.398) [-1088.574] (-1089.968) (-1097.368) * (-1099.018) (-1096.941) (-1090.001) [-1095.353] -- 0:00:13
933000 -- (-1085.955) (-1092.961) [-1096.713] (-1098.228) * (-1089.763) (-1087.743) [-1087.973] (-1092.030) -- 0:00:12
934000 -- (-1091.013) [-1090.186] (-1091.235) (-1087.511) * (-1095.206) (-1087.228) (-1091.119) [-1095.862] -- 0:00:12
935000 -- [-1084.770] (-1088.078) (-1091.493) (-1096.786) * (-1094.444) (-1085.580) (-1090.449) [-1095.070] -- 0:00:12
Average standard deviation of split frequencies: 0.007787
936000 -- (-1086.041) (-1090.346) [-1092.413] (-1092.711) * (-1094.231) (-1088.645) (-1087.028) [-1086.464] -- 0:00:12
937000 -- (-1081.471) (-1084.131) [-1087.242] (-1086.651) * (-1087.983) [-1099.212] (-1090.269) (-1095.832) -- 0:00:12
938000 -- [-1085.885] (-1088.419) (-1095.053) (-1097.048) * (-1092.954) [-1087.188] (-1088.346) (-1098.827) -- 0:00:11
939000 -- [-1087.656] (-1087.904) (-1089.609) (-1088.292) * (-1095.222) (-1094.868) [-1087.326] (-1090.656) -- 0:00:11
940000 -- (-1084.503) [-1085.934] (-1093.165) (-1090.876) * [-1083.163] (-1089.037) (-1091.192) (-1091.900) -- 0:00:11
Average standard deviation of split frequencies: 0.007748
941000 -- [-1093.130] (-1083.526) (-1087.118) (-1099.496) * (-1092.360) (-1094.859) [-1090.625] (-1086.880) -- 0:00:11
942000 -- (-1088.836) (-1088.932) (-1098.521) [-1084.619] * [-1081.305] (-1090.226) (-1092.083) (-1091.087) -- 0:00:11
943000 -- (-1090.452) [-1082.971] (-1094.785) (-1092.224) * (-1088.058) (-1085.307) [-1092.431] (-1096.436) -- 0:00:11
944000 -- (-1094.257) (-1095.823) [-1088.248] (-1088.561) * [-1085.135] (-1090.838) (-1086.480) (-1095.764) -- 0:00:10
945000 -- [-1089.392] (-1093.995) (-1084.530) (-1097.471) * (-1088.172) (-1098.245) [-1086.488] (-1088.973) -- 0:00:10
Average standard deviation of split frequencies: 0.008280
946000 -- [-1084.540] (-1088.331) (-1091.303) (-1084.728) * [-1086.984] (-1100.743) (-1090.453) (-1089.834) -- 0:00:10
947000 -- [-1084.557] (-1095.887) (-1091.225) (-1083.244) * (-1090.878) (-1091.225) [-1092.080] (-1095.617) -- 0:00:10
948000 -- (-1089.828) (-1088.540) (-1089.004) [-1087.571] * (-1085.414) (-1097.053) (-1095.865) [-1088.416] -- 0:00:10
949000 -- (-1084.294) (-1091.028) [-1083.669] (-1103.673) * [-1080.903] (-1096.253) (-1101.315) (-1089.437) -- 0:00:09
950000 -- (-1089.865) (-1090.508) (-1094.034) [-1083.546] * [-1082.880] (-1092.160) (-1081.603) (-1090.455) -- 0:00:09
Average standard deviation of split frequencies: 0.007629
951000 -- (-1085.823) (-1092.785) (-1089.395) [-1091.694] * (-1094.886) (-1082.487) [-1083.076] (-1084.451) -- 0:00:09
952000 -- (-1093.948) (-1086.491) [-1089.611] (-1092.472) * (-1094.030) (-1089.824) (-1087.139) [-1085.263] -- 0:00:09
953000 -- (-1089.796) (-1093.472) [-1087.108] (-1093.683) * (-1094.215) (-1084.616) (-1085.001) [-1088.367] -- 0:00:09
954000 -- (-1092.818) [-1098.079] (-1100.394) (-1090.625) * (-1089.269) (-1088.040) (-1088.772) [-1087.361] -- 0:00:08
955000 -- [-1094.754] (-1091.822) (-1081.709) (-1088.489) * (-1100.207) (-1093.869) [-1090.776] (-1088.599) -- 0:00:08
Average standard deviation of split frequencies: 0.007965
956000 -- [-1092.952] (-1087.168) (-1084.306) (-1087.882) * (-1084.898) (-1094.684) [-1089.011] (-1090.044) -- 0:00:08
957000 -- (-1085.191) (-1091.664) [-1085.840] (-1086.796) * (-1088.767) (-1090.272) [-1096.118] (-1085.279) -- 0:00:08
958000 -- (-1083.958) (-1088.283) (-1089.045) [-1095.373] * (-1087.966) [-1086.319] (-1092.277) (-1095.843) -- 0:00:08
959000 -- (-1085.345) (-1091.270) (-1091.163) [-1085.549] * (-1089.395) (-1091.515) [-1091.109] (-1096.326) -- 0:00:07
960000 -- [-1087.044] (-1095.557) (-1093.363) (-1087.134) * (-1088.161) (-1086.312) [-1095.591] (-1090.860) -- 0:00:07
Average standard deviation of split frequencies: 0.007965
961000 -- [-1084.763] (-1088.508) (-1095.423) (-1092.380) * (-1098.129) (-1090.570) [-1091.659] (-1091.542) -- 0:00:07
962000 -- (-1091.051) [-1087.417] (-1090.298) (-1090.553) * (-1090.974) [-1085.286] (-1101.513) (-1093.535) -- 0:00:07
963000 -- (-1090.897) [-1089.890] (-1095.616) (-1094.649) * (-1089.817) [-1094.356] (-1088.704) (-1089.167) -- 0:00:07
964000 -- (-1098.490) (-1093.368) [-1086.001] (-1099.832) * (-1093.032) (-1103.469) (-1088.700) [-1091.168] -- 0:00:06
965000 -- (-1095.536) [-1090.480] (-1085.224) (-1091.934) * (-1099.143) (-1081.442) [-1083.487] (-1093.914) -- 0:00:06
Average standard deviation of split frequencies: 0.007695
966000 -- (-1098.099) (-1099.624) [-1092.531] (-1095.198) * (-1093.117) (-1092.778) (-1089.717) [-1087.536] -- 0:00:06
967000 -- [-1094.707] (-1089.120) (-1096.217) (-1092.748) * (-1087.038) (-1094.447) (-1099.533) [-1090.097] -- 0:00:06
968000 -- (-1087.497) (-1087.712) [-1088.102] (-1089.128) * (-1103.791) (-1093.861) [-1088.399] (-1088.358) -- 0:00:06
969000 -- (-1086.879) (-1084.068) [-1086.379] (-1089.610) * (-1089.156) (-1090.569) (-1087.864) [-1098.038] -- 0:00:05
970000 -- (-1084.887) (-1099.360) (-1090.979) [-1093.107] * [-1085.211] (-1087.597) (-1089.323) (-1087.692) -- 0:00:05
Average standard deviation of split frequencies: 0.007023
971000 -- (-1101.181) (-1090.543) (-1086.092) [-1093.476] * (-1086.050) [-1088.513] (-1092.698) (-1094.447) -- 0:00:05
972000 -- (-1089.853) (-1083.757) [-1087.900] (-1102.110) * (-1091.568) [-1082.785] (-1087.997) (-1086.592) -- 0:00:05
973000 -- (-1086.608) [-1086.298] (-1096.587) (-1100.016) * (-1090.840) (-1086.085) [-1088.145] (-1086.981) -- 0:00:05
974000 -- (-1088.079) [-1096.195] (-1088.370) (-1094.243) * [-1084.411] (-1086.599) (-1084.361) (-1090.755) -- 0:00:05
975000 -- (-1086.590) [-1088.030] (-1087.745) (-1088.789) * [-1095.511] (-1082.450) (-1084.320) (-1085.298) -- 0:00:04
Average standard deviation of split frequencies: 0.007394
976000 -- (-1085.169) [-1088.109] (-1085.864) (-1095.752) * (-1098.916) (-1094.745) (-1099.212) [-1089.938] -- 0:00:04
977000 -- [-1085.915] (-1093.232) (-1093.495) (-1097.892) * [-1090.520] (-1089.829) (-1086.608) (-1097.797) -- 0:00:04
978000 -- (-1091.713) (-1092.520) (-1089.184) [-1084.751] * (-1087.488) (-1089.631) (-1087.461) [-1085.130] -- 0:00:04
979000 -- [-1092.764] (-1084.402) (-1083.709) (-1094.118) * (-1101.490) (-1088.714) [-1089.638] (-1092.765) -- 0:00:04
980000 -- (-1090.654) (-1090.273) [-1084.607] (-1093.358) * (-1086.766) (-1090.627) (-1091.920) [-1092.453] -- 0:00:03
Average standard deviation of split frequencies: 0.007321
981000 -- (-1090.063) (-1086.820) (-1086.013) [-1086.469] * (-1089.524) (-1089.108) [-1086.669] (-1097.077) -- 0:00:03
982000 -- (-1085.596) (-1088.629) [-1088.562] (-1087.961) * [-1084.382] (-1091.674) (-1094.342) (-1093.123) -- 0:00:03
983000 -- (-1090.960) (-1088.883) [-1085.895] (-1084.672) * [-1092.301] (-1081.668) (-1093.164) (-1088.818) -- 0:00:03
984000 -- (-1094.847) (-1084.873) [-1083.430] (-1087.694) * (-1090.946) (-1097.225) [-1099.340] (-1090.752) -- 0:00:03
985000 -- (-1091.835) (-1087.272) (-1086.352) [-1090.708] * (-1096.506) [-1087.004] (-1093.115) (-1088.139) -- 0:00:02
Average standard deviation of split frequencies: 0.007429
986000 -- [-1088.582] (-1096.916) (-1085.910) (-1092.861) * [-1086.197] (-1095.046) (-1097.557) (-1085.157) -- 0:00:02
987000 -- (-1091.353) (-1093.625) (-1088.117) [-1086.759] * [-1083.683] (-1094.209) (-1094.369) (-1083.749) -- 0:00:02
988000 -- (-1101.653) [-1087.774] (-1090.294) (-1091.223) * (-1094.024) [-1085.052] (-1085.151) (-1094.347) -- 0:00:02
989000 -- (-1088.092) [-1090.181] (-1092.974) (-1084.602) * (-1082.229) [-1087.532] (-1085.561) (-1085.577) -- 0:00:02
990000 -- (-1090.257) [-1081.361] (-1083.015) (-1099.529) * (-1095.199) (-1091.352) [-1093.468] (-1093.699) -- 0:00:01
Average standard deviation of split frequencies: 0.007980
991000 -- (-1095.034) (-1085.112) (-1085.442) [-1087.590] * [-1089.784] (-1099.351) (-1092.175) (-1088.633) -- 0:00:01
992000 -- (-1088.483) (-1093.443) [-1086.772] (-1089.241) * (-1101.334) (-1091.702) (-1096.434) [-1083.195] -- 0:00:01
993000 -- [-1090.363] (-1089.785) (-1084.654) (-1086.754) * [-1091.121] (-1088.405) (-1099.155) (-1087.974) -- 0:00:01
994000 -- (-1087.658) [-1087.795] (-1094.769) (-1087.407) * (-1091.239) (-1090.282) (-1099.841) [-1091.903] -- 0:00:01
995000 -- [-1089.837] (-1087.845) (-1098.856) (-1088.946) * (-1092.978) (-1094.222) (-1096.908) [-1094.641] -- 0:00:00
Average standard deviation of split frequencies: 0.007573
996000 -- [-1092.786] (-1099.952) (-1091.792) (-1094.280) * [-1084.252] (-1084.256) (-1090.338) (-1094.355) -- 0:00:00
997000 -- (-1099.123) (-1086.563) [-1088.752] (-1095.633) * [-1086.132] (-1086.656) (-1086.473) (-1086.256) -- 0:00:00
998000 -- (-1087.625) (-1094.217) [-1091.885] (-1087.960) * (-1090.958) [-1086.154] (-1096.091) (-1088.536) -- 0:00:00
999000 -- (-1096.347) [-1085.398] (-1088.738) (-1086.653) * (-1089.164) (-1090.548) [-1089.500] (-1094.683) -- 0:00:00
1000000 -- [-1092.438] (-1095.412) (-1098.765) (-1097.318) * (-1097.944) (-1088.780) [-1097.168] (-1090.101) -- 0:00:00
Average standard deviation of split frequencies: 0.006885
Analysis completed in 3 mins 13 seconds
Analysis used 191.86 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1076.32
Likelihood of best state for "cold" chain of run 2 was -1076.48
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
63.5 % ( 55 %) Dirichlet(Revmat{all})
83.4 % ( 80 %) Slider(Revmat{all})
29.2 % ( 29 %) Dirichlet(Pi{all})
30.4 % ( 25 %) Slider(Pi{all})
75.8 % ( 43 %) Multiplier(Alpha{1,2})
66.3 % ( 31 %) Multiplier(Alpha{3})
53.5 % ( 29 %) Slider(Pinvar{all})
37.3 % ( 39 %) ExtSPR(Tau{all},V{all})
25.5 % ( 22 %) ExtTBR(Tau{all},V{all})
40.4 % ( 37 %) NNI(Tau{all},V{all})
40.3 % ( 39 %) ParsSPR(Tau{all},V{all})
27.2 % ( 32 %) Multiplier(V{all})
54.7 % ( 60 %) Nodeslider(V{all})
27.4 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
64.7 % ( 58 %) Dirichlet(Revmat{all})
83.2 % ( 75 %) Slider(Revmat{all})
28.3 % ( 34 %) Dirichlet(Pi{all})
30.4 % ( 20 %) Slider(Pi{all})
75.0 % ( 42 %) Multiplier(Alpha{1,2})
66.2 % ( 36 %) Multiplier(Alpha{3})
53.5 % ( 25 %) Slider(Pinvar{all})
37.5 % ( 33 %) ExtSPR(Tau{all},V{all})
25.4 % ( 24 %) ExtTBR(Tau{all},V{all})
40.3 % ( 40 %) NNI(Tau{all},V{all})
40.5 % ( 40 %) ParsSPR(Tau{all},V{all})
27.2 % ( 26 %) Multiplier(V{all})
54.7 % ( 58 %) Nodeslider(V{all})
27.3 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.36
2 | 166460 0.76 0.55
3 | 167431 166463 0.77
4 | 167217 165871 166558
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.36
2 | 167103 0.76 0.55
3 | 166950 166476 0.77
4 | 167053 166358 166060
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p
Writing summary statistics to file /data/mrbayes_input.nex.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1086.72
| * 1 1 |
| 2 1 |
| 1 1 1 2 1 |
| 2 2 2 *2 1 2 1 2 2 1 1|
| 2 1*2 1*2 2 2 12 1221 1 1 2 2 1 |
| * 1 11 1 2122 1 2 |
| 1 1 2 1 2 1 2 * 22 1 |
|11 1 21 2 22 |
| 1 22 * 12 1 2 1 22 1 2 |
| 2 2 1 212 1 1 1 |
|2 1 * 2 1 2 |
| 2 2 2 1 1 2|
| 2 1 1 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1091.06
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1084.02 -1099.86
2 -1084.14 -1097.31
--------------------------------------
TOTAL -1084.08 -1099.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.097699 0.000840 0.049433 0.157990 0.093805 1025.00 1173.97 1.000
r(A<->C){all} 0.060361 0.002043 0.000074 0.145674 0.050117 413.43 427.14 1.000
r(A<->G){all} 0.271490 0.009268 0.096766 0.459840 0.259582 340.49 388.40 1.002
r(A<->T){all} 0.040118 0.000947 0.000001 0.099463 0.034299 495.85 498.24 1.000
r(C<->G){all} 0.036529 0.001233 0.000057 0.108388 0.026258 377.98 519.13 1.000
r(C<->T){all} 0.503374 0.010402 0.300397 0.685466 0.504395 355.33 370.39 1.001
r(G<->T){all} 0.088128 0.002031 0.011302 0.176373 0.081110 397.85 443.17 1.002
pi(A){all} 0.241247 0.000281 0.207676 0.273052 0.240715 1068.01 1169.27 1.000
pi(C){all} 0.184267 0.000218 0.153588 0.211861 0.184400 886.60 955.75 1.000
pi(G){all} 0.205150 0.000244 0.176621 0.236534 0.204497 1294.19 1307.57 1.001
pi(T){all} 0.369336 0.000344 0.333702 0.404838 0.369420 1193.33 1296.50 1.000
alpha{1,2} 0.131597 0.055451 0.000013 0.402841 0.078369 921.18 1000.18 1.000
alpha{3} 1.953090 1.438978 0.183584 4.354609 1.657156 1293.25 1373.24 1.000
pinvar{all} 0.795769 0.005338 0.656416 0.909125 0.808686 747.71 886.18 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .*.**..*
10 -- .....**.
11 -- .*.*****
12 -- .*.*...*
13 -- .*.....*
14 -- .*.*....
15 -- ....*..*
16 -- ...**..*
17 -- ...**...
18 -- .*..*..*
19 -- ...*...*
20 -- .*.**...
21 -- .*..*...
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/mrbayes_input.nex.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3001 0.999667 0.000471 0.999334 1.000000 2
10 2943 0.980346 0.000471 0.980013 0.980680 2
11 2896 0.964690 0.004711 0.961359 0.968021 2
12 697 0.232179 0.014604 0.221852 0.242505 2
13 623 0.207528 0.006124 0.203198 0.211859 2
14 609 0.202865 0.008009 0.197202 0.208528 2
15 603 0.200866 0.007066 0.195869 0.205863 2
16 597 0.198867 0.004240 0.195869 0.201865 2
17 594 0.197868 0.016959 0.185876 0.209860 2
18 591 0.196869 0.001413 0.195869 0.197868 2
19 587 0.195536 0.008009 0.189873 0.201199 2
20 557 0.185543 0.007066 0.180546 0.190540 2
21 546 0.181879 0.010364 0.174550 0.189207 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/mrbayes_input.nex.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.016390 0.000080 0.002984 0.034650 0.014701 1.000 2
length{all}[2] 0.001588 0.000003 0.000003 0.004817 0.001089 1.001 2
length{all}[3] 0.018112 0.000089 0.002270 0.035598 0.016475 1.000 2
length{all}[4] 0.001578 0.000003 0.000001 0.004714 0.001078 1.000 2
length{all}[5] 0.003154 0.000006 0.000015 0.007716 0.002565 1.000 2
length{all}[6] 0.001666 0.000003 0.000001 0.005228 0.001105 1.000 2
length{all}[7] 0.001664 0.000003 0.000000 0.005045 0.001144 1.000 2
length{all}[8] 0.001644 0.000003 0.000000 0.004986 0.001129 1.000 2
length{all}[9] 0.020373 0.000114 0.004681 0.042721 0.018278 1.000 2
length{all}[10] 0.012213 0.000062 0.000099 0.027120 0.010524 1.000 2
length{all}[11] 0.016436 0.000097 0.001661 0.035489 0.014271 1.000 2
length{all}[12] 0.001906 0.000004 0.000001 0.006104 0.001327 1.000 2
length{all}[13] 0.001662 0.000003 0.000002 0.005248 0.001078 1.000 2
length{all}[14] 0.001586 0.000003 0.000002 0.004669 0.001070 1.000 2
length{all}[15] 0.001728 0.000003 0.000000 0.005710 0.001154 0.998 2
length{all}[16] 0.001520 0.000003 0.000000 0.004575 0.001043 0.999 2
length{all}[17] 0.001625 0.000003 0.000002 0.005079 0.001080 0.999 2
length{all}[18] 0.001591 0.000002 0.000004 0.004333 0.001139 0.999 2
length{all}[19] 0.001736 0.000004 0.000003 0.005596 0.001058 0.999 2
length{all}[20] 0.001683 0.000003 0.000003 0.005264 0.001132 1.007 2
length{all}[21] 0.001593 0.000003 0.000001 0.004679 0.001064 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006885
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values (excluding NA and >10.0) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C3 (3)
|
| /------------------------ C2 (2)
+ |
| |------------------------ C4 (4)
| /----------100----------+
| | |------------------------ C5 (5)
| | |
\-----------96----------+ \------------------------ C8 (8)
|
| /------------------------ C6 (6)
\-----------98----------+
\------------------------ C7 (7)
Phylogram (based on average branch lengths):
/------------------------------ C1 (1)
|
|---------------------------------- C3 (3)
|
| /-- C2 (2)
+ |
| |-- C4 (4)
| /-------------------------------------+
| | |----- C5 (5)
| | |
\----------------------------+ \-- C8 (8)
|
| /-- C6 (6)
\---------------------+
\-- C7 (7)
|---------| 0.005 expected changes per site
Calculating tree probabilities...
Credible sets of trees (62 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 15 trees
95 % credible set contains 17 trees
99 % credible set contains 41 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
Running FUBAR...
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\
***************** TYPES OF STANDARD ANALYSES *****************
(1) Selection Analyses
(2) Evolutionary Hypothesis Testing
(3) Relative evolutionary rate inference
(4) Coevolutionary analysis
(5) Basic Analyses
(6) Codon Selection Analyses
(7) Compartmentalization
(8) Data File Tools
(9) Miscellaneous
(10) Model Comparison
(11) Kernel Analysis Tools
(12) Molecular Clock
(13) Phylogeny Reconstruction
(14) Positive Selection
(15) Recombination
(16) Selection/Recombination
(17) Relative Rate
(18) Relative Ratio
(19) Substitution Rates
Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' *****************
(1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution).
(2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood).
(3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting).
(4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection).
(5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification).
(6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood).
(7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation).
Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types):
Analysis Description
--------------------
Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a
coding sequence alignment to determine whether some sites have been
subject to pervasive purifying or diversifying selection. v2.1
introduces two more methods for estimating the posterior distribution of
grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation
Bayes approximation (fastest). Please note that a FUBAR analysis
generates a cache and a results JSON file in the same directory as
directory as the original alignment. HyPhy needs to have write
privileges to this directory. For example if the original file is in
/home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there
will also exist FUBAR-generated files
/home/sergei/FUBAR/data/pol.nex.FUBAR.json,
/home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide
checkpointing so that a partially completed analysis can be restarted.
- __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree
(one per partition)
- __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring
selection (2013), Mol Biol Evol. 30(5):1196-205
- __Written by__: Sergei L Kosakovsky Pond
- __Contact Information__: spond@temple.edu
- __Analysis Version__: 2.1
####Choose Genetic Code
1. [**Universal**] Universal code. (Genebank transl_table=1).
2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2).
3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3).
4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4).
5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5).
6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6).
7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9).
8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10).
9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12).
10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13).
11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14).
12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15).
13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16).
14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21).
15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22).
16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23).
17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24).
18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25).
19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26).
>Please choose an option (or press q to cancel selection):
>Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`)
>A tree was found in the data file: `(C1,C3,((C2,C4,C5,C8),(C6,C7)))`
>Would you like to use it (y/n)?
>Loaded a multiple sequence alignment with **8** sequences, **218** codons, and **1** partitions from `/data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna`
> FUBAR will write cache and result files to _/data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively
> Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer):
####Posterior estimation method
1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation)
2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed)
3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default)
>Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5):
### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -1090.40, AIC-c = 2218.95 (19 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 : 0.055
### Computing the phylogenetic likelihood function on the grid
* Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid
* Best scaling achieved for
* synonymous rate = 2.815
* non-synonymous rate = 0.286
* Computing conditional site likelihoods on a 20 x 20 rate grid
### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
* Dirichlet alpha : 0.5
### Tabulating site-level results
| Codon | Partition | alpha | beta |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
| 100 | 1 | 1.909 | 25.413 | Pos. posterior = 0.9504 |
----
## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these, 0.05 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=218
183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVQHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDAHFQHALPLANFLMTSVFVIYF
SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF
********* *******:**********.*********************
183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLM
LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMLGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV
TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL
**************:**********************************:
183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG
**************************************************
183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV
**************************************************
183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 NMCFSKLRLCEEVEVQSD
TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NMCFSELRLCEEVEVQSD
*****:************
>183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACCTCTTTTGGTGACTCAGTTCAGGCTGGTGTGCAGCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTTGTAATTTACTTTGCTATGTACAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTTTTTGCAATGTTTGTATACGCACCATTGTTATGTTATTTTGAGCTGTATGTTGATGCCGCTATTATTTTCGGTGCTCTTTACACTAGGCTTATGTATGTTACGTATTATGCCTGTAGGTACAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAAGGCTATTATTGGTACTATCAGGACAACTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCAATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAAGTTGAAGTTCAATCTGAT >LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACTTCTTTTGGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTCGTAATTTACTTTGCCATGTATAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTGTTTGCAATGTTTGTGTACGCACCATTGCTATGTTACTTTGAGCTGTATGTTGATGCCGCTATTATTTTTGGTGCGCTTTACACCAGGCTTTTGTATGTTACATATTATGCCTGTAGGTATAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAGGGCTACTATTGGTACTATCAGGACAACTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCTATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT >175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTCTTTCAAACTTCTTTTGGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAACTACCATTACCTGATGCACATTTTCAACATGCATTGCCATTAGCTAATTTTCTCATGACTAGTGTGTTTGTAATTTACTTTGCTATGTACAAAGCCAGCTCAGTTAGAAATAACTGTATTATGCTTGGCTTTAGGCTTTTTGCAATGTTTGTATACGCACCATTGCTATGTTACTTTGAGCTGTATGTTGATGCTGCTATTATTTTTGGTGCTCTTTACACCAGGCTTGTGTATGTTACATATTATGCCTGTAGGTACAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAAGGCTATTATTGGTACTATCAGGACAACTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCAATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT >SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACTTCTTTTGGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTCGTAATTTACTTTGCCATGTATAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTGTTTGCAATGTTTGTGTACGCACCATTGCTATGTTACTTTGAGCTGTATGTTGATGCCGCTATTATTTTTGGTGCGCTTTACACCAGGCTTTTGTATGTTACATATTATGCCTGTAGGTATAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAGGGCTACTATTGGTACTATCAGGACAACTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCTATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT >TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACTTCTTTTGGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTCGTAATTTACTTTGCCATGTATAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTGTTTGCAATGTTTGTGTACGCACCATTGCTATGTTACTTTGAGCTGTATGTTGATGCCGCTATTATTTTTGGTGCGCTTTACACCAGGCTTTTGTATGTTACATATTATGCCTGTAGGTATAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAGGGCTACTATTGGTACTATCAGGACAACTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCTATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTAAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT >TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACTTCTTTTTGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTCGTAATTTACTTTGCCATGTATAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTATTTGCAATGTTTGTGTACGCACCATTGTTATGTTATTTTGAGCTGTATGTTGATGCCGCTATTATTTTCGGTGCTCTTTACACCAGGCTTGTGTATGTTACGTATTATGCCTGTAGGTACAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAAGGCTACTATTGGTACTACCAGGACAATTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCAATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT >TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACTTCTTTTTGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTCGTAATTTACTTTGCCATGTATAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTATTTGCAATGTTTGTGTACGCACCATTGTTATGTTATTTTGAGCTGTATGTTGATGCCGCTATTATTTTCGGTGCTCTTTACACCAGGCTTGTGTATGTTACGTATTATGCCTGTAGGTACAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAAGGCTACTATTGGTACTACCAGGACAATTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCAATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT >TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ATGACTGGCCTATTTCAAACTTCTTTTGGTGACTCAGTTCAGGCTGGTGTGCATCATTTAGTTGAAAAATTACCATTACCTGATGTACATTTTCAACATGCATTGCCATTAGCCAATTTTCTCATGACTAGTGTGTTCGTAATTTACTTTGCCATGTATAAAGCCAGCTCAGTTAGAAATAACTGTATTATGTTTGGCTTTAGGCTGTTTGCAATGTTTGTGTACGCACCATTGCTATGTTACTTTGAGCTGTATGTTGATGCCGCTATTATTTTTGGTGCGCTTTACACCAGGCTTTTGTATGTTACATATTATGCCTGTAGGTATAGATCACCTGCATTTGTTGTGCTTAACACTGACAAACTTGCTTTTGTTCAGGGCTACTATTGGTACTATCAGGACAACTCATACCTGACTTTGTTAGGTGGTGAAAACTTTGTCACCTTTGGTCCTAATTTTGTGCCTATTGCTGCCACTAATGACCTTTACATTGCTCTCAGAGGTAAGAAAGATGATGATGTACCACTGGTGAGGCGCGTAGAACTCATCAATGGACAATTCTTTTACATCTTTGCACAAGAGCCTGTTGTAGGTGTGGTGAACATGTGCTTTTCTGAACTTAGACTCTGTGAAGAGGTTGAAGTTCAATCTGAT
>183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVQHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLM YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD >LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD >175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDAHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMLGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD >SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD >TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSKLRLCEEVEVQSD >TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD >TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFCDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLV YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD >TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 MTGLFQTSFGDSVQAGVHHLVEKLPLPDVHFQHALPLANFLMTSVFVIYF AMYKASSVRNNCIMFGFRLFAMFVYAPLLCYFELYVDAAIIFGALYTRLL YVTYYACRYRSPAFVVLNTDKLAFVQGYYWYYQDNSYLTLLGGENFVTFG PNFVPIAATNDLYIALRGKKDDDVPLVRRVELINGQFFYIFAQEPVVGVV NMCFSELRLCEEVEVQSD
Reading sequence file /data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/fasta/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1
Found 8 sequences of length 654
Alignment looks like a valid DNA alignment.
Estimated diversity is (pairwise deletion - ignoring missing/ambig): 1.8%
Found 18 informative sites.
Writing alignment of informative sites to: Phi.inf.sites
Writing list of informative sites to: Phi.inf.list
Calculating all pairwise incompatibilities...
Done: 0.0%100.0%
Using a window size of 80 with k as 2
Calculating analytical mean and variance
Doing permutation test for PHI
Doing permutation test for NSS
Doing Permutation test for MAXCHI
Writing alignment of polymorphic unambig sites to: Phi.poly.sites
Window size is 19 polymorphic sites
**p-Value(s)**
----------
NSS: 5.30e-02 (1000 permutations)
Max Chi^2: 1.44e-01 (1000 permutations)
PHI (Permutation): 1.08e-01 (1000 permutations)
PHI (Normal): 6.63e-02
#NEXUS
[ID: 5197109330]
begin taxa;
dimensions ntax=8;
taxlabels
183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10
LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10
SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10
TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
end;
begin trees;
translate
1 183A_NS3_AFU92105_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
2 LSH5A_NS3_AFU92096_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
3 175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10,
4 SL12A_NS3_AFU92079_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10,
5 TLC1310A_NS3_AFU92087_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10,
6 TLC1343A_NS3_AFU92123_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
7 TLC1347A_NS3_AFU92132_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10,
8 TT3A_NS3_AFU92071_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:1.470101e-02,3:1.647520e-02,((2:1.089313e-03,4:1.077724e-03,5:2.564881e-03,8:1.129402e-03)1.000:1.827814e-02,(6:1.105006e-03,7:1.144086e-03)0.980:1.052364e-02)0.965:1.427084e-02);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:1.470101e-02,3:1.647520e-02,((2:1.089313e-03,4:1.077724e-03,5:2.564881e-03,8:1.129402e-03):1.827814e-02,(6:1.105006e-03,7:1.144086e-03):1.052364e-02):1.427084e-02);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/mrbayes_input.nex.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1083.87 -1101.42
2 -1083.62 -1098.60
--------------------------------------
TOTAL -1083.74 -1100.79
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/mrbayes_input.nex.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.098867 0.000926 0.045031 0.157211 0.094133 1335.05 1418.03 1.000
r(A<->C){all} 0.058271 0.001967 0.000004 0.142653 0.048044 483.12 541.15 1.000
r(A<->G){all} 0.267152 0.009609 0.096600 0.463915 0.254519 280.59 363.58 1.003
r(A<->T){all} 0.037752 0.000809 0.000014 0.093311 0.031202 702.96 766.43 1.000
r(C<->G){all} 0.033026 0.001124 0.000005 0.100338 0.022616 358.83 458.24 1.000
r(C<->T){all} 0.515192 0.010926 0.315603 0.713932 0.514288 348.18 350.54 1.005
r(G<->T){all} 0.088607 0.002054 0.013070 0.176698 0.081664 508.40 574.91 1.002
pi(A){all} 0.241928 0.000268 0.208806 0.273077 0.241804 831.11 1017.22 1.000
pi(C){all} 0.184106 0.000220 0.154269 0.211773 0.183782 1054.89 1170.95 1.000
pi(G){all} 0.204859 0.000239 0.175444 0.235277 0.204906 920.43 1169.14 1.000
pi(T){all} 0.369107 0.000341 0.334938 0.406509 0.368456 1090.31 1159.59 1.000
alpha{1,2} 0.125280 0.033237 0.000087 0.399204 0.076807 1086.59 1207.83 1.000
alpha{3} 1.935802 1.370690 0.227649 4.331500 1.673914 1113.73 1271.87 1.000
pinvar{all} 0.797703 0.005015 0.663103 0.909071 0.809955 1162.83 1200.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C3,((C2,C4,C5,C8),(C6,C7)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **8** sequences, **218** codons, and **1** partitions from `/data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_NS3_AFU92114_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1090.40, AIC-c = 2218.95 (19 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.055 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 2.815 * non-synonymous rate = 0.286 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 100 | 1 | 1.909 | 25.413 | Pos. posterior = 0.9504 | ---- ## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.05 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
