--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:10:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/panD/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -587.74          -591.88
2       -587.76          -591.46
--------------------------------------
TOTAL     -587.75          -591.69
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890302    0.088247    0.330790    1.446417    0.853635   1421.22   1461.11    1.000
r(A<->C){all}   0.162002    0.018816    0.000124    0.435537    0.124249    216.05    217.44    1.000
r(A<->G){all}   0.160506    0.018846    0.000112    0.433472    0.124935    155.94    224.91    1.004
r(A<->T){all}   0.174020    0.019580    0.000025    0.446177    0.139401    203.70    308.54    1.004
r(C<->G){all}   0.155814    0.018042    0.000086    0.419243    0.118661    225.46    245.91    1.000
r(C<->T){all}   0.162538    0.019662    0.000027    0.459295    0.126638    131.76    190.31    1.000
r(G<->T){all}   0.185120    0.021937    0.000018    0.472351    0.154779    161.52    179.70    1.000
pi(A){all}      0.196819    0.000374    0.156531    0.232789    0.196326   1235.98   1241.14    1.000
pi(C){all}      0.274712    0.000441    0.234690    0.316848    0.274759   1310.42   1383.81    1.000
pi(G){all}      0.290598    0.000494    0.249718    0.335884    0.289878   1294.98   1336.70    1.000
pi(T){all}      0.237871    0.000435    0.198349    0.279207    0.237391   1193.33   1242.77    1.000
alpha{1,2}      0.436866    0.233661    0.000193    1.418664    0.270404    989.54   1174.71    1.000
alpha{3}        0.449342    0.224962    0.000294    1.427722    0.293254   1172.76   1275.34    1.000
pinvar{all}     0.996334    0.000020    0.988214    0.999999    0.997733   1282.30   1355.09    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-555.297471
Model 2: PositiveSelection	-555.297451
Model 0: one-ratio	-555.297608
Model 7: beta	-555.297451
Model 8: beta&w>1	-555.297451


Model 0 vs 1	2.7399999999033753E-4

Model 2 vs 1	3.999999989900971E-5

Model 8 vs 7	0.0
>C1
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C2
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C3
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C4
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C5
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C6
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=142 

C1              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C2              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C3              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C4              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C5              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C6              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
                **************************************************

C1              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C2              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C3              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C4              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C5              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C6              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
                **************************************************

C1              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C2              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C3              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C4              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C5              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C6              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
                ******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  142 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  142 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4260]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4260]--->[4260]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.674 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C2              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C3              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C4              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C5              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C6              MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
                **************************************************

C1              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C2              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C3              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C4              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C5              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C6              NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
                **************************************************

C1              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C2              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C3              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C4              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C5              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C6              YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
                ******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C2              ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C3              ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C4              ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C5              ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C6              ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
                **************************************************

C1              GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C2              GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C3              GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C4              GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C5              GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C6              GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
                **************************************************

C1              GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C2              GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C3              GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C4              GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C5              GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C6              GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
                **************************************************

C1              AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C2              AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C3              AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C4              AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C5              AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C6              AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
                **************************************************

C1              TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C2              TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C3              TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C4              TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C5              TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C6              TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
                **************************************************

C1              TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C2              TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C3              TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C4              TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C5              TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C6              TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
                **************************************************

C1              TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C2              TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C3              TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C4              TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C5              TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C6              TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
                **************************************************

C1              GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C2              GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C3              GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C4              GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C5              GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C6              GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
                **************************************************

C1              TATTTGATCCCCGGATCGGTGCGCGG
C2              TATTTGATCCCCGGATCGGTGCGCGG
C3              TATTTGATCCCCGGATCGGTGCGCGG
C4              TATTTGATCCCCGGATCGGTGCGCGG
C5              TATTTGATCCCCGGATCGGTGCGCGG
C6              TATTTGATCCCCGGATCGGTGCGCGG
                **************************



>C1
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C2
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C3
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C4
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C5
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C6
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C1
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C2
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C3
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C4
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C5
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C6
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 426 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579784927
      Setting output file names to "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1936447336
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9071215193
      Seed = 390605383
      Swapseed = 1579784927
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -953.408422 -- -24.965149
         Chain 2 -- -953.408367 -- -24.965149
         Chain 3 -- -953.408277 -- -24.965149
         Chain 4 -- -953.408422 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -953.408422 -- -24.965149
         Chain 2 -- -953.408422 -- -24.965149
         Chain 3 -- -953.408422 -- -24.965149
         Chain 4 -- -953.408367 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-953.408] (-953.408) (-953.408) (-953.408) * [-953.408] (-953.408) (-953.408) (-953.408) 
        500 -- (-598.078) [-601.627] (-606.518) (-597.751) * [-591.650] (-596.589) (-595.897) (-596.877) -- 0:00:00
       1000 -- (-604.716) [-594.836] (-606.728) (-595.844) * (-595.320) [-594.826] (-595.834) (-597.858) -- 0:00:00
       1500 -- (-593.917) (-602.374) [-597.864] (-601.151) * (-598.595) [-591.351] (-604.999) (-594.477) -- 0:00:00
       2000 -- (-597.831) (-605.621) (-593.690) [-597.824] * (-597.304) (-606.397) [-594.067] (-598.348) -- 0:00:00
       2500 -- [-593.550] (-597.902) (-600.958) (-595.915) * (-603.381) [-598.565] (-596.434) (-598.401) -- 0:00:00
       3000 -- (-599.636) (-598.575) (-597.392) [-593.143] * (-598.480) [-599.475] (-594.906) (-602.868) -- 0:05:32
       3500 -- (-595.997) (-600.402) [-595.909] (-594.576) * (-596.919) (-597.110) (-596.891) [-599.056] -- 0:04:44
       4000 -- (-596.816) (-597.203) (-602.326) [-591.330] * (-598.704) (-605.411) (-598.304) [-597.206] -- 0:04:09
       4500 -- (-599.841) (-599.588) (-600.743) [-593.121] * [-596.265] (-600.761) (-599.149) (-603.304) -- 0:03:41
       5000 -- [-592.076] (-598.879) (-596.130) (-598.870) * (-596.547) (-593.247) (-606.356) [-595.245] -- 0:03:19

      Average standard deviation of split frequencies: 0.086424

       5500 -- (-604.469) (-600.561) [-597.367] (-597.291) * [-597.820] (-600.967) (-602.282) (-601.667) -- 0:03:00
       6000 -- (-596.601) (-602.284) (-597.073) [-597.386] * [-596.273] (-599.912) (-599.528) (-594.221) -- 0:02:45
       6500 -- (-592.657) (-597.659) [-594.777] (-594.687) * [-594.059] (-603.473) (-605.080) (-595.198) -- 0:02:32
       7000 -- (-597.353) (-602.589) [-592.866] (-599.238) * (-600.816) [-593.229] (-600.594) (-595.162) -- 0:02:21
       7500 -- (-601.227) (-594.752) (-602.844) [-601.180] * (-606.067) (-597.716) (-600.269) [-592.149] -- 0:02:12
       8000 -- [-600.745] (-604.265) (-601.742) (-602.193) * (-592.716) (-600.876) (-593.993) [-593.135] -- 0:02:04
       8500 -- (-594.681) (-610.428) [-596.542] (-597.823) * (-604.340) (-604.718) [-590.625] (-599.726) -- 0:01:56
       9000 -- (-589.781) [-595.748] (-600.266) (-597.262) * [-594.362] (-598.734) (-594.144) (-600.311) -- 0:01:50
       9500 -- (-592.511) (-596.932) (-599.307) [-592.274] * [-596.381] (-607.434) (-594.909) (-594.876) -- 0:01:44
      10000 -- [-594.260] (-605.907) (-609.725) (-598.697) * (-595.959) (-594.910) (-591.309) [-596.069] -- 0:01:39

      Average standard deviation of split frequencies: 0.076335

      10500 -- (-589.738) (-604.390) [-594.973] (-601.053) * [-597.540] (-589.234) (-589.022) (-594.995) -- 0:01:34
      11000 -- (-588.120) (-600.554) (-601.283) [-597.797] * (-595.586) (-588.113) [-587.417] (-599.250) -- 0:01:29
      11500 -- [-591.429] (-595.303) (-601.610) (-599.462) * (-597.973) [-586.639] (-587.751) (-599.003) -- 0:01:25
      12000 -- (-587.717) (-600.714) (-606.009) [-594.901] * (-602.917) (-588.909) (-590.637) [-597.258] -- 0:01:22
      12500 -- (-587.548) (-599.545) [-595.215] (-602.433) * (-598.214) (-586.339) (-588.779) [-593.993] -- 0:01:19
      13000 -- (-588.757) (-596.513) [-595.122] (-598.047) * (-595.141) [-587.936] (-587.669) (-610.538) -- 0:01:15
      13500 -- [-588.137] (-597.578) (-596.098) (-600.864) * (-594.398) (-594.621) [-588.274] (-602.851) -- 0:01:13
      14000 -- (-587.637) (-596.042) (-598.004) [-598.799] * (-595.404) (-591.310) [-589.628] (-597.785) -- 0:01:10
      14500 -- (-588.090) (-597.349) [-601.662] (-594.479) * (-599.631) [-588.370] (-587.744) (-597.035) -- 0:01:07
      15000 -- (-587.372) [-600.292] (-612.890) (-596.648) * (-597.709) [-588.814] (-590.705) (-603.163) -- 0:01:05

      Average standard deviation of split frequencies: 0.071331

      15500 -- (-587.099) (-603.429) (-595.329) [-599.802] * [-601.340] (-587.833) (-588.090) (-594.021) -- 0:01:03
      16000 -- (-587.271) (-599.085) [-597.015] (-600.416) * [-593.222] (-590.212) (-589.047) (-598.438) -- 0:01:01
      16500 -- (-588.355) [-593.876] (-607.833) (-596.231) * [-595.913] (-591.123) (-588.808) (-596.563) -- 0:00:59
      17000 -- (-590.782) (-600.374) [-603.638] (-602.867) * (-598.914) (-589.108) [-587.106] (-603.303) -- 0:00:57
      17500 -- (-591.749) [-594.565] (-593.990) (-599.945) * (-600.275) (-590.726) (-590.250) [-599.321] -- 0:00:56
      18000 -- (-587.586) (-601.564) (-598.346) [-598.801] * (-596.152) (-589.067) (-586.403) [-593.496] -- 0:00:54
      18500 -- (-592.159) (-597.790) (-606.066) [-595.796] * (-597.160) (-592.275) (-587.455) [-601.145] -- 0:00:53
      19000 -- (-587.335) (-600.697) [-591.316] (-599.353) * (-598.329) (-595.654) [-587.403] (-601.086) -- 0:01:43
      19500 -- (-587.750) [-596.244] (-608.794) (-606.999) * (-593.509) [-589.719] (-588.323) (-595.481) -- 0:01:40
      20000 -- (-588.583) [-595.371] (-596.870) (-603.554) * (-596.761) [-587.662] (-589.782) (-598.823) -- 0:01:38

      Average standard deviation of split frequencies: 0.067289

      20500 -- (-588.607) [-596.447] (-595.718) (-606.302) * (-596.895) [-589.053] (-588.509) (-599.887) -- 0:01:35
      21000 -- (-588.855) [-596.460] (-598.028) (-605.173) * (-596.358) [-589.952] (-589.142) (-606.958) -- 0:01:33
      21500 -- [-589.352] (-603.131) (-592.230) (-597.338) * (-600.592) (-586.509) (-589.443) [-597.493] -- 0:01:31
      22000 -- (-589.812) (-599.215) [-596.869] (-590.878) * (-598.772) (-592.886) [-590.038] (-611.653) -- 0:01:28
      22500 -- (-588.265) [-594.634] (-606.660) (-587.691) * [-601.854] (-588.645) (-586.543) (-606.930) -- 0:01:26
      23000 -- (-587.986) (-597.596) (-599.319) [-587.562] * (-601.257) [-587.380] (-587.487) (-595.332) -- 0:01:24
      23500 -- (-586.481) [-598.066] (-609.882) (-587.919) * (-600.512) (-586.964) [-586.751] (-603.942) -- 0:01:23
      24000 -- (-587.022) (-596.889) (-615.622) [-589.106] * (-610.629) (-586.612) (-586.759) [-596.982] -- 0:01:21
      24500 -- (-587.016) (-600.565) [-588.373] (-587.703) * (-606.049) (-588.448) [-586.351] (-601.572) -- 0:01:19
      25000 -- (-589.134) (-603.033) (-587.486) [-587.531] * (-595.388) (-589.917) (-586.207) [-594.647] -- 0:01:18

      Average standard deviation of split frequencies: 0.051096

      25500 -- (-590.732) [-597.856] (-587.431) (-586.474) * (-592.308) (-591.252) (-588.681) [-601.612] -- 0:01:16
      26000 -- [-594.747] (-597.360) (-589.125) (-586.561) * [-586.270] (-590.260) (-592.660) (-598.385) -- 0:01:14
      26500 -- (-591.205) (-604.313) (-594.401) [-587.142] * (-586.992) (-588.339) (-595.947) [-590.792] -- 0:01:13
      27000 -- [-589.592] (-598.364) (-587.893) (-594.157) * (-590.661) [-589.081] (-597.672) (-597.237) -- 0:01:12
      27500 -- (-587.165) (-596.608) (-588.640) [-587.056] * (-586.914) (-590.283) (-589.297) [-593.293] -- 0:01:10
      28000 -- (-591.996) [-598.745] (-591.099) (-589.813) * (-588.889) (-590.355) [-588.146] (-601.006) -- 0:01:09
      28500 -- (-589.759) [-592.444] (-589.576) (-588.036) * (-589.429) (-589.415) [-587.872] (-597.336) -- 0:01:08
      29000 -- (-589.261) [-597.923] (-591.362) (-588.113) * (-589.274) [-587.206] (-590.830) (-595.317) -- 0:01:06
      29500 -- [-591.158] (-596.234) (-589.152) (-595.099) * (-589.135) [-588.038] (-589.272) (-597.068) -- 0:01:05
      30000 -- [-587.868] (-596.852) (-593.765) (-589.417) * (-589.416) [-586.644] (-587.330) (-608.602) -- 0:01:04

      Average standard deviation of split frequencies: 0.054570

      30500 -- (-589.953) (-600.276) [-590.123] (-587.385) * [-587.243] (-586.718) (-587.893) (-610.145) -- 0:01:03
      31000 -- [-587.773] (-593.631) (-589.776) (-587.069) * (-589.857) (-592.510) [-587.460] (-596.251) -- 0:01:02
      31500 -- (-587.946) (-606.978) [-589.835] (-590.567) * [-594.275] (-591.181) (-593.277) (-603.279) -- 0:01:01
      32000 -- (-587.808) [-594.166] (-587.779) (-590.391) * (-588.373) (-597.190) [-590.964] (-597.712) -- 0:01:00
      32500 -- (-594.098) (-593.980) (-587.511) [-587.119] * [-586.500] (-588.263) (-587.084) (-598.946) -- 0:00:59
      33000 -- [-589.051] (-592.602) (-588.964) (-588.519) * (-587.104) [-589.339] (-586.888) (-597.158) -- 0:00:58
      33500 -- (-595.790) (-593.391) (-589.133) [-592.971] * [-589.292] (-595.529) (-587.974) (-602.517) -- 0:00:57
      34000 -- (-588.317) (-601.954) (-589.516) [-587.750] * (-586.239) (-592.338) (-589.874) [-602.951] -- 0:00:56
      34500 -- (-587.009) (-609.154) (-591.806) [-586.419] * [-587.396] (-589.496) (-590.550) (-597.078) -- 0:00:55
      35000 -- (-590.968) (-590.994) [-589.673] (-587.485) * (-588.579) (-589.198) (-588.611) [-596.942] -- 0:00:55

      Average standard deviation of split frequencies: 0.044108

      35500 -- (-586.704) (-588.036) [-587.557] (-591.433) * [-589.107] (-596.219) (-588.112) (-598.312) -- 0:01:21
      36000 -- (-588.227) [-591.621] (-587.100) (-588.235) * (-588.688) (-586.895) [-586.680] (-598.324) -- 0:01:20
      36500 -- (-587.224) (-591.352) [-587.329] (-588.465) * (-591.254) (-590.944) (-586.962) [-598.403] -- 0:01:19
      37000 -- (-587.575) (-588.316) (-586.848) [-588.300] * (-589.101) (-593.097) [-588.222] (-592.505) -- 0:01:18
      37500 -- [-589.137] (-588.320) (-588.759) (-587.467) * (-588.468) [-587.167] (-589.983) (-596.476) -- 0:01:17
      38000 -- [-592.090] (-591.342) (-587.099) (-586.837) * (-587.915) (-588.404) (-590.484) [-598.711] -- 0:01:15
      38500 -- (-590.753) (-592.191) (-587.353) [-586.837] * (-590.958) [-588.860] (-588.609) (-593.314) -- 0:01:14
      39000 -- (-587.104) (-588.625) (-592.333) [-588.426] * [-587.114] (-591.641) (-586.723) (-596.512) -- 0:01:13
      39500 -- (-588.572) [-588.971] (-589.591) (-587.117) * [-588.780] (-588.315) (-587.770) (-599.282) -- 0:01:12
      40000 -- (-589.135) [-589.824] (-588.778) (-592.447) * (-592.920) (-586.654) [-588.665] (-586.979) -- 0:01:12

      Average standard deviation of split frequencies: 0.038436

      40500 -- (-589.225) (-592.401) [-587.949] (-587.486) * (-587.657) (-590.615) [-587.665] (-590.374) -- 0:01:11
      41000 -- (-588.933) (-588.052) [-588.579] (-589.884) * (-587.732) (-591.313) (-587.521) [-588.408] -- 0:01:10
      41500 -- (-589.108) (-590.254) [-589.990] (-587.507) * (-592.424) [-588.071] (-587.345) (-589.336) -- 0:01:09
      42000 -- (-587.505) (-589.442) (-590.776) [-589.721] * (-588.757) (-587.580) [-589.712] (-589.186) -- 0:01:08
      42500 -- (-589.230) [-587.994] (-588.426) (-588.954) * (-588.832) (-589.079) [-588.987] (-590.543) -- 0:01:07
      43000 -- [-587.912] (-588.464) (-588.460) (-589.975) * (-587.692) (-591.790) (-588.864) [-588.123] -- 0:01:06
      43500 -- (-588.400) (-590.438) (-590.798) [-591.411] * (-588.259) (-587.312) [-589.931] (-590.057) -- 0:01:05
      44000 -- (-590.951) (-589.963) [-587.244] (-587.871) * (-590.463) (-588.985) (-587.161) [-589.036] -- 0:01:05
      44500 -- [-590.574] (-589.551) (-590.147) (-587.825) * (-588.728) (-588.672) [-588.144] (-591.155) -- 0:01:04
      45000 -- (-590.119) [-587.572] (-587.532) (-595.082) * (-589.104) [-587.513] (-588.615) (-590.183) -- 0:01:03

      Average standard deviation of split frequencies: 0.035355

      45500 -- (-591.754) (-587.532) [-587.216] (-590.847) * (-586.456) (-587.888) (-588.103) [-587.457] -- 0:01:02
      46000 -- (-592.604) (-587.591) [-589.352] (-589.418) * (-586.603) (-587.706) (-588.030) [-588.047] -- 0:01:02
      46500 -- (-590.043) (-588.353) (-590.186) [-590.086] * (-587.163) (-587.216) [-588.877] (-586.418) -- 0:01:01
      47000 -- (-588.619) (-596.053) (-589.148) [-589.113] * (-586.737) [-587.357] (-590.554) (-588.077) -- 0:01:00
      47500 -- (-586.631) (-590.487) [-590.651] (-587.196) * (-590.303) (-588.732) [-587.325] (-588.683) -- 0:01:00
      48000 -- (-586.582) [-587.123] (-587.586) (-592.111) * [-590.128] (-591.908) (-588.967) (-589.596) -- 0:00:59
      48500 -- (-588.804) (-587.771) (-589.523) [-587.211] * [-588.612] (-592.618) (-589.398) (-588.073) -- 0:00:58
      49000 -- (-589.331) (-587.382) [-590.835] (-588.959) * (-588.278) [-587.918] (-589.898) (-590.544) -- 0:00:58
      49500 -- (-588.782) [-590.235] (-589.650) (-587.210) * (-590.994) (-588.302) [-590.778] (-588.579) -- 0:00:57
      50000 -- [-589.646] (-589.957) (-590.500) (-587.784) * (-589.974) (-587.943) [-586.364] (-589.589) -- 0:00:57

      Average standard deviation of split frequencies: 0.027447

      50500 -- (-590.653) [-587.750] (-588.238) (-589.801) * [-588.966] (-587.802) (-591.090) (-589.985) -- 0:00:56
      51000 -- (-589.290) (-588.365) [-589.467] (-587.590) * [-591.236] (-588.086) (-590.517) (-588.514) -- 0:00:55
      51500 -- (-587.626) [-589.588] (-588.738) (-587.863) * (-590.374) (-587.340) (-590.573) [-586.266] -- 0:00:55
      52000 -- [-586.526] (-589.226) (-587.593) (-590.302) * [-587.463] (-588.574) (-593.073) (-591.187) -- 0:00:54
      52500 -- [-586.373] (-591.468) (-589.849) (-589.186) * (-586.805) (-588.026) (-591.501) [-590.942] -- 0:01:12
      53000 -- (-590.523) [-590.238] (-586.996) (-588.843) * (-587.646) [-586.733] (-590.220) (-592.762) -- 0:01:11
      53500 -- (-587.799) (-588.548) [-589.431] (-589.587) * (-586.360) (-588.940) (-586.914) [-590.753] -- 0:01:10
      54000 -- [-587.660] (-589.100) (-589.562) (-591.381) * [-589.231] (-587.349) (-588.799) (-587.893) -- 0:01:10
      54500 -- (-590.003) (-588.664) (-588.022) [-587.173] * (-590.489) (-591.773) [-591.641] (-587.479) -- 0:01:09
      55000 -- [-588.520] (-588.419) (-590.907) (-589.495) * (-590.922) (-589.745) [-589.414] (-587.438) -- 0:01:08

      Average standard deviation of split frequencies: 0.027469

      55500 -- (-588.844) (-588.639) (-589.478) [-588.460] * (-587.243) (-587.125) [-589.988] (-588.305) -- 0:01:08
      56000 -- (-588.525) (-586.872) (-588.662) [-590.893] * (-587.863) (-587.578) (-586.422) [-587.868] -- 0:01:07
      56500 -- (-591.179) [-586.605] (-588.417) (-587.647) * (-588.782) (-588.041) [-589.601] (-587.277) -- 0:01:06
      57000 -- (-589.508) (-586.254) (-586.265) [-586.858] * (-588.678) (-587.880) (-589.125) [-588.749] -- 0:01:06
      57500 -- [-589.895] (-586.613) (-587.582) (-589.123) * [-590.701] (-587.427) (-588.099) (-592.304) -- 0:01:05
      58000 -- (-586.898) (-587.961) (-591.812) [-587.599] * (-590.328) (-588.057) (-589.889) [-590.854] -- 0:01:04
      58500 -- (-587.429) [-586.552] (-589.343) (-588.750) * [-590.337] (-589.183) (-588.862) (-589.097) -- 0:01:04
      59000 -- (-586.496) (-586.457) [-589.444] (-586.290) * [-587.067] (-591.887) (-588.879) (-589.794) -- 0:01:03
      59500 -- (-587.992) (-587.743) (-587.920) [-587.087] * [-588.980] (-593.606) (-589.082) (-591.576) -- 0:01:03
      60000 -- [-589.322] (-588.540) (-592.771) (-592.701) * (-587.044) (-586.220) [-591.138] (-587.728) -- 0:01:02

      Average standard deviation of split frequencies: 0.024175

      60500 -- (-589.113) (-588.811) (-587.640) [-588.599] * (-587.060) (-587.548) (-591.321) [-588.539] -- 0:01:02
      61000 -- [-589.170] (-587.808) (-586.520) (-587.677) * [-589.941] (-587.158) (-589.655) (-591.960) -- 0:01:01
      61500 -- (-592.245) (-589.015) [-588.271] (-590.960) * (-590.032) (-586.916) [-593.109] (-588.720) -- 0:01:01
      62000 -- (-586.863) (-592.826) [-590.187] (-590.858) * (-587.588) [-590.998] (-590.148) (-589.990) -- 0:01:00
      62500 -- (-586.834) (-588.268) [-586.729] (-588.748) * [-588.142] (-587.509) (-586.977) (-590.880) -- 0:01:00
      63000 -- (-590.410) (-587.725) [-588.565] (-589.283) * (-587.973) [-587.658] (-588.493) (-588.772) -- 0:00:59
      63500 -- (-588.532) (-587.829) [-590.155] (-588.486) * (-586.867) (-587.823) [-586.894] (-587.653) -- 0:00:58
      64000 -- (-587.282) (-591.638) [-588.018] (-590.175) * (-587.970) (-589.082) [-587.112] (-586.791) -- 0:00:58
      64500 -- [-594.757] (-588.544) (-588.717) (-590.526) * (-590.779) (-590.311) (-594.231) [-590.798] -- 0:00:58
      65000 -- (-592.991) (-587.243) [-590.752] (-588.977) * [-588.487] (-588.223) (-591.816) (-587.301) -- 0:00:57

      Average standard deviation of split frequencies: 0.024148

      65500 -- (-590.394) [-588.156] (-591.569) (-587.441) * (-590.354) [-588.673] (-597.188) (-588.823) -- 0:00:57
      66000 -- (-588.517) (-588.021) [-589.123] (-588.559) * (-594.104) [-587.243] (-589.978) (-589.373) -- 0:00:56
      66500 -- (-587.649) [-587.434] (-589.580) (-589.028) * (-595.167) (-591.162) (-586.585) [-587.867] -- 0:00:56
      67000 -- (-587.377) (-587.813) (-590.884) [-590.419] * [-590.251] (-587.821) (-586.756) (-589.251) -- 0:00:55
      67500 -- (-588.371) (-587.536) [-590.430] (-587.143) * (-588.403) [-588.729] (-589.585) (-591.104) -- 0:00:55
      68000 -- (-590.710) (-587.961) [-588.251] (-589.178) * (-591.457) (-586.335) [-587.208] (-587.755) -- 0:00:54
      68500 -- [-588.483] (-588.515) (-587.953) (-588.922) * [-589.264] (-587.989) (-588.825) (-587.186) -- 0:01:07
      69000 -- (-588.085) (-586.876) (-588.991) [-592.254] * (-590.139) (-588.387) (-589.927) [-588.177] -- 0:01:07
      69500 -- [-589.841] (-589.023) (-589.392) (-589.491) * (-588.280) (-592.035) [-588.482] (-594.156) -- 0:01:06
      70000 -- [-589.654] (-588.144) (-594.841) (-588.693) * (-587.171) (-589.614) (-591.227) [-590.162] -- 0:01:06

      Average standard deviation of split frequencies: 0.022554

      70500 -- [-587.420] (-591.378) (-588.145) (-589.416) * (-589.486) [-586.367] (-591.118) (-591.145) -- 0:01:05
      71000 -- [-586.786] (-590.375) (-587.518) (-590.042) * (-589.323) [-586.882] (-588.638) (-589.383) -- 0:01:05
      71500 -- (-587.502) (-588.340) (-587.945) [-590.872] * (-591.594) [-588.620] (-588.439) (-589.084) -- 0:01:04
      72000 -- (-587.945) (-587.756) (-591.437) [-586.529] * [-591.632] (-588.127) (-586.966) (-589.218) -- 0:01:04
      72500 -- (-591.957) (-589.697) (-589.382) [-590.614] * (-587.614) (-589.467) (-588.708) [-588.631] -- 0:01:03
      73000 -- (-589.239) (-587.930) (-588.439) [-588.314] * [-587.226] (-587.684) (-590.554) (-590.581) -- 0:01:03
      73500 -- (-592.107) [-586.268] (-588.025) (-588.828) * [-587.865] (-586.869) (-586.583) (-587.178) -- 0:01:03
      74000 -- [-590.240] (-588.313) (-590.323) (-590.294) * (-587.480) (-588.539) [-586.399] (-588.067) -- 0:01:02
      74500 -- (-587.784) [-589.761] (-590.924) (-595.156) * [-588.715] (-592.251) (-590.914) (-588.023) -- 0:01:02
      75000 -- [-587.941] (-587.991) (-591.724) (-594.720) * (-587.219) [-588.080] (-589.494) (-586.712) -- 0:01:01

      Average standard deviation of split frequencies: 0.022020

      75500 -- (-588.409) (-587.962) [-589.413] (-592.609) * (-588.336) (-590.968) (-588.192) [-586.512] -- 0:01:01
      76000 -- [-587.743] (-587.855) (-589.892) (-587.607) * (-587.578) (-587.813) [-588.108] (-587.185) -- 0:01:00
      76500 -- [-587.956] (-592.428) (-589.487) (-586.106) * [-586.079] (-589.134) (-587.716) (-586.789) -- 0:01:00
      77000 -- (-589.686) (-591.549) (-588.322) [-586.106] * [-586.426] (-588.458) (-591.390) (-588.786) -- 0:00:59
      77500 -- (-588.819) [-588.660] (-587.228) (-586.605) * [-587.290] (-588.223) (-590.367) (-589.669) -- 0:00:59
      78000 -- [-586.571] (-587.360) (-588.201) (-586.968) * [-588.040] (-586.555) (-591.475) (-586.598) -- 0:00:59
      78500 -- [-588.945] (-587.559) (-589.119) (-587.444) * (-588.202) (-587.757) [-587.313] (-588.053) -- 0:00:58
      79000 -- (-588.921) (-588.883) [-588.997] (-587.689) * (-588.338) (-588.912) [-587.806] (-590.159) -- 0:00:58
      79500 -- [-588.229] (-588.686) (-590.585) (-593.406) * [-586.606] (-589.545) (-589.175) (-589.422) -- 0:00:57
      80000 -- (-586.678) [-586.730] (-590.231) (-589.074) * (-586.972) [-591.780] (-589.219) (-593.616) -- 0:00:57

      Average standard deviation of split frequencies: 0.020915

      80500 -- [-588.551] (-590.589) (-587.152) (-588.999) * (-588.238) (-587.741) [-589.578] (-587.167) -- 0:00:57
      81000 -- [-588.895] (-587.864) (-590.413) (-587.916) * (-589.924) (-590.450) (-591.869) [-587.685] -- 0:00:56
      81500 -- (-589.462) [-592.224] (-594.110) (-587.141) * [-588.373] (-589.731) (-589.945) (-588.323) -- 0:00:56
      82000 -- (-590.178) [-588.903] (-594.226) (-591.864) * (-587.454) (-587.247) [-588.463] (-589.285) -- 0:00:55
      82500 -- (-587.787) (-590.052) [-594.003] (-586.594) * [-588.252] (-588.766) (-587.153) (-588.089) -- 0:00:55
      83000 -- (-588.891) (-588.961) [-594.422] (-589.594) * (-588.805) [-588.081] (-591.937) (-589.143) -- 0:00:55
      83500 -- [-587.519] (-589.554) (-587.202) (-586.828) * (-592.243) (-591.930) (-592.957) [-589.564] -- 0:00:54
      84000 -- (-593.010) (-587.663) [-592.340] (-589.341) * [-588.779] (-587.406) (-590.522) (-588.841) -- 0:00:54
      84500 -- (-587.278) (-586.354) [-588.544] (-590.075) * (-587.949) (-587.365) (-589.739) [-586.902] -- 0:00:54
      85000 -- [-587.373] (-591.327) (-587.622) (-588.440) * (-586.626) (-586.570) (-590.145) [-588.605] -- 0:01:04

      Average standard deviation of split frequencies: 0.020621

      85500 -- (-588.226) (-589.154) (-592.603) [-588.160] * (-589.372) (-590.273) (-588.824) [-587.275] -- 0:01:04
      86000 -- (-588.416) (-588.320) [-587.132] (-587.322) * [-590.653] (-588.182) (-587.618) (-589.666) -- 0:01:03
      86500 -- [-587.589] (-587.166) (-588.993) (-588.900) * (-589.700) (-587.701) [-586.520] (-586.094) -- 0:01:03
      87000 -- (-587.006) (-587.711) (-587.245) [-587.553] * (-592.036) (-587.721) (-586.889) [-587.343] -- 0:01:02
      87500 -- (-588.375) (-588.522) (-587.079) [-592.142] * [-590.054] (-588.042) (-590.964) (-587.565) -- 0:01:02
      88000 -- (-590.028) (-587.095) [-588.656] (-587.768) * (-587.862) (-588.174) (-589.347) [-588.992] -- 0:01:02
      88500 -- (-591.237) (-586.550) [-587.300] (-587.950) * (-588.040) (-587.614) [-589.056] (-587.802) -- 0:01:01
      89000 -- (-589.730) [-588.305] (-589.276) (-588.355) * (-588.052) (-588.935) (-588.172) [-587.319] -- 0:01:01
      89500 -- (-591.114) (-586.253) [-587.263] (-588.048) * (-587.555) [-586.987] (-588.795) (-586.167) -- 0:01:01
      90000 -- (-590.655) [-587.048] (-588.417) (-593.076) * (-590.591) (-586.440) [-586.944] (-586.935) -- 0:01:00

      Average standard deviation of split frequencies: 0.020277

      90500 -- (-589.347) [-587.067] (-590.097) (-588.618) * (-588.659) (-587.527) [-587.328] (-586.642) -- 0:01:00
      91000 -- (-588.690) (-586.555) [-589.415] (-587.626) * (-587.285) (-594.648) [-592.777] (-586.923) -- 0:00:59
      91500 -- [-587.115] (-590.075) (-594.355) (-587.175) * (-586.490) (-588.724) (-591.065) [-588.537] -- 0:00:59
      92000 -- (-586.490) (-588.141) (-593.521) [-588.972] * (-587.331) (-588.000) [-587.069] (-593.908) -- 0:00:59
      92500 -- (-590.311) (-588.175) (-590.053) [-587.944] * (-589.790) (-588.356) [-586.522] (-588.303) -- 0:00:58
      93000 -- [-588.398] (-589.128) (-588.358) (-586.803) * (-590.340) [-587.433] (-587.500) (-588.644) -- 0:00:58
      93500 -- (-586.928) [-589.374] (-587.780) (-589.171) * (-587.358) (-586.965) [-586.494] (-588.875) -- 0:00:58
      94000 -- (-589.540) (-588.107) [-590.508] (-588.020) * (-588.503) (-588.382) (-589.407) [-586.877] -- 0:00:57
      94500 -- [-589.029] (-589.665) (-588.236) (-589.845) * (-589.225) (-602.597) (-588.888) [-591.095] -- 0:00:57
      95000 -- (-596.555) [-587.642] (-586.838) (-587.915) * [-587.829] (-596.207) (-586.921) (-586.730) -- 0:00:57

      Average standard deviation of split frequencies: 0.019151

      95500 -- [-593.047] (-588.534) (-587.425) (-588.681) * (-588.948) [-587.856] (-588.572) (-587.688) -- 0:00:56
      96000 -- (-587.002) [-593.481] (-588.184) (-587.739) * (-589.503) [-586.450] (-588.135) (-588.030) -- 0:00:56
      96500 -- [-586.711] (-587.120) (-587.320) (-586.725) * (-593.236) [-589.318] (-587.661) (-587.649) -- 0:00:56
      97000 -- (-589.018) [-588.201] (-587.317) (-586.355) * (-599.104) [-588.379] (-587.340) (-587.231) -- 0:00:55
      97500 -- [-590.458] (-592.815) (-589.457) (-587.025) * (-591.874) (-591.254) (-587.023) [-586.353] -- 0:00:55
      98000 -- (-589.421) (-587.053) (-587.955) [-586.602] * [-587.644] (-592.016) (-591.744) (-586.345) -- 0:00:55
      98500 -- (-588.094) (-588.343) (-589.951) [-588.533] * (-586.720) (-592.224) [-590.754] (-590.787) -- 0:00:54
      99000 -- (-587.926) (-591.164) [-589.771] (-586.980) * (-587.363) (-595.500) (-588.539) [-589.105] -- 0:00:54
      99500 -- (-587.843) (-592.986) [-587.966] (-586.734) * (-586.663) (-592.979) [-590.846] (-588.301) -- 0:00:54
      100000 -- (-587.831) [-589.077] (-591.066) (-587.595) * (-586.985) (-591.644) [-589.408] (-587.161) -- 0:00:54

      Average standard deviation of split frequencies: 0.017795

      100500 -- (-586.271) [-589.180] (-589.686) (-586.897) * (-589.490) (-588.612) [-588.272] (-587.445) -- 0:00:53
      101000 -- (-588.467) (-588.317) (-587.847) [-587.344] * (-588.353) [-591.778] (-589.126) (-589.158) -- 0:00:53
      101500 -- (-588.197) (-589.482) [-587.477] (-587.649) * (-589.169) (-588.429) (-587.941) [-587.113] -- 0:00:53
      102000 -- [-589.405] (-590.225) (-591.247) (-587.942) * (-588.708) [-587.634] (-587.845) (-592.725) -- 0:01:01
      102500 -- [-588.434] (-589.909) (-590.719) (-586.753) * [-591.678] (-590.000) (-589.156) (-588.552) -- 0:01:01
      103000 -- (-587.986) [-590.323] (-593.641) (-589.746) * [-588.047] (-588.017) (-590.849) (-590.740) -- 0:01:00
      103500 -- [-590.661] (-592.059) (-589.787) (-587.403) * (-587.627) (-587.492) (-587.791) [-587.839] -- 0:01:00
      104000 -- (-590.745) (-593.488) (-586.884) [-592.045] * (-586.951) (-587.910) (-586.868) [-592.182] -- 0:01:00
      104500 -- (-592.655) (-588.371) [-587.370] (-587.617) * (-587.990) [-588.138] (-588.210) (-588.940) -- 0:00:59
      105000 -- (-589.154) (-590.306) [-587.459] (-588.265) * (-586.841) (-588.052) (-588.679) [-590.046] -- 0:00:59

      Average standard deviation of split frequencies: 0.015788

      105500 -- (-587.565) (-592.623) (-589.266) [-588.765] * (-587.564) (-588.059) (-586.672) [-589.256] -- 0:00:59
      106000 -- (-589.530) [-589.085] (-587.385) (-591.317) * (-589.181) [-586.316] (-590.507) (-589.671) -- 0:00:59
      106500 -- [-589.428] (-589.142) (-588.196) (-591.589) * (-589.443) (-588.315) [-587.964] (-592.326) -- 0:00:58
      107000 -- (-588.906) [-587.713] (-586.799) (-590.383) * (-588.578) (-587.147) (-589.947) [-587.095] -- 0:00:58
      107500 -- (-589.527) [-588.422] (-588.649) (-588.704) * (-588.907) (-588.083) [-589.140] (-587.112) -- 0:00:58
      108000 -- (-589.014) (-587.797) (-587.153) [-587.954] * (-588.460) (-586.407) [-587.381] (-587.183) -- 0:00:57
      108500 -- (-588.521) (-586.891) (-588.876) [-592.393] * (-591.155) [-587.931] (-586.963) (-590.044) -- 0:00:57
      109000 -- (-590.838) (-587.438) [-588.948] (-590.280) * (-588.979) (-588.288) [-591.258] (-587.058) -- 0:00:57
      109500 -- [-590.829] (-588.769) (-588.287) (-586.710) * [-589.968] (-586.716) (-589.762) (-590.890) -- 0:00:56
      110000 -- [-587.945] (-590.296) (-587.002) (-587.617) * (-588.062) [-587.640] (-590.398) (-589.414) -- 0:00:56

      Average standard deviation of split frequencies: 0.015974

      110500 -- (-589.058) (-590.811) [-589.208] (-592.595) * (-590.016) (-588.266) (-590.107) [-588.105] -- 0:00:56
      111000 -- (-586.493) (-588.339) (-589.877) [-592.216] * (-589.444) (-586.321) [-587.073] (-591.765) -- 0:00:56
      111500 -- (-589.392) [-586.734] (-587.986) (-588.268) * (-588.101) (-587.475) [-587.443] (-591.947) -- 0:00:55
      112000 -- (-588.082) (-588.980) [-590.835] (-586.628) * [-588.545] (-588.058) (-588.568) (-592.825) -- 0:00:55
      112500 -- [-587.860] (-589.271) (-590.962) (-587.367) * (-591.496) (-590.067) [-587.096] (-590.763) -- 0:00:55
      113000 -- (-587.311) (-587.802) (-588.042) [-586.587] * (-586.921) (-587.258) (-587.097) [-589.574] -- 0:00:54
      113500 -- [-587.504] (-590.297) (-587.329) (-587.897) * [-587.946] (-588.114) (-587.608) (-587.544) -- 0:00:54
      114000 -- (-591.172) (-588.069) (-588.895) [-586.486] * [-589.718] (-588.882) (-586.640) (-589.777) -- 0:00:54
      114500 -- (-588.935) (-589.749) [-589.812] (-587.054) * (-591.135) (-587.776) (-589.681) [-586.314] -- 0:00:54
      115000 -- (-591.252) [-586.567] (-589.738) (-590.028) * (-587.564) [-588.233] (-589.508) (-588.189) -- 0:00:53

      Average standard deviation of split frequencies: 0.017474

      115500 -- (-588.074) (-590.201) [-588.259] (-587.450) * (-588.844) (-587.937) (-589.732) [-587.330] -- 0:00:53
      116000 -- (-589.586) (-591.062) (-587.574) [-586.566] * (-587.745) (-588.835) (-588.291) [-586.508] -- 0:00:53
      116500 -- (-587.211) [-588.916] (-589.882) (-588.518) * (-589.311) (-587.570) [-586.871] (-587.622) -- 0:00:53
      117000 -- (-586.814) (-586.367) [-589.780] (-590.634) * (-595.449) (-589.062) [-587.621] (-587.833) -- 0:00:52
      117500 -- (-590.808) (-587.799) (-589.665) [-587.766] * (-590.785) (-594.029) (-588.292) [-589.394] -- 0:00:52
      118000 -- (-587.624) (-589.076) [-589.370] (-590.095) * [-588.515] (-590.779) (-588.754) (-591.110) -- 0:00:52
      118500 -- [-587.569] (-589.471) (-588.471) (-586.411) * [-587.508] (-591.226) (-587.227) (-587.551) -- 0:00:52
      119000 -- (-586.765) (-590.359) (-589.370) [-591.346] * [-586.604] (-587.339) (-591.446) (-587.818) -- 0:00:59
      119500 -- (-589.445) [-586.995] (-587.331) (-586.498) * [-588.410] (-588.081) (-586.914) (-586.712) -- 0:00:58
      120000 -- (-590.980) [-587.696] (-588.407) (-586.571) * [-589.403] (-588.478) (-586.487) (-589.095) -- 0:00:58

      Average standard deviation of split frequencies: 0.016449

      120500 -- (-588.130) (-596.154) (-586.966) [-593.452] * (-591.653) (-587.568) (-587.609) [-589.042] -- 0:00:58
      121000 -- (-586.807) [-591.446] (-588.553) (-592.282) * [-588.967] (-587.872) (-587.353) (-591.864) -- 0:00:58
      121500 -- (-587.885) (-590.654) [-588.687] (-590.204) * (-589.318) (-588.618) (-587.329) [-590.615] -- 0:00:57
      122000 -- (-588.607) (-588.733) [-586.836] (-592.947) * (-586.702) (-588.287) [-587.866] (-590.722) -- 0:00:57
      122500 -- [-587.873] (-589.657) (-592.036) (-587.772) * (-586.474) [-588.038] (-587.134) (-590.843) -- 0:00:57
      123000 -- (-593.896) (-589.047) (-589.317) [-590.070] * [-586.433] (-588.266) (-590.469) (-589.393) -- 0:00:57
      123500 -- (-587.426) (-592.243) (-589.283) [-589.813] * (-586.673) (-589.046) (-588.314) [-586.876] -- 0:00:56
      124000 -- [-591.228] (-589.557) (-586.442) (-592.061) * [-587.343] (-586.770) (-589.732) (-586.531) -- 0:00:56
      124500 -- (-589.964) (-588.454) (-586.069) [-590.006] * (-588.132) (-590.478) [-588.503] (-590.695) -- 0:00:56
      125000 -- (-589.045) [-589.771] (-588.705) (-588.678) * (-589.139) (-588.533) [-589.591] (-590.428) -- 0:00:56

      Average standard deviation of split frequencies: 0.013784

      125500 -- (-587.848) (-589.036) [-588.511] (-590.059) * (-587.853) (-588.176) [-590.277] (-588.280) -- 0:00:55
      126000 -- (-590.244) (-587.242) (-590.643) [-587.769] * [-589.096] (-589.693) (-589.039) (-588.004) -- 0:00:55
      126500 -- (-588.775) (-588.453) (-590.791) [-587.143] * (-588.130) [-590.314] (-588.006) (-587.541) -- 0:00:55
      127000 -- (-588.882) (-588.658) (-590.299) [-588.075] * (-588.245) (-587.925) (-588.987) [-587.806] -- 0:00:54
      127500 -- (-586.672) (-586.499) (-589.534) [-589.577] * (-588.542) (-591.463) (-589.129) [-588.738] -- 0:00:54
      128000 -- (-586.762) (-586.855) [-589.269] (-592.685) * [-586.861] (-590.335) (-590.947) (-588.859) -- 0:00:54
      128500 -- (-589.785) (-588.209) (-587.135) [-588.926] * (-588.051) (-587.352) (-590.740) [-588.992] -- 0:00:54
      129000 -- (-586.667) (-592.759) [-588.376] (-589.268) * (-590.248) (-589.017) (-590.710) [-589.153] -- 0:00:54
      129500 -- [-587.758] (-588.086) (-587.626) (-589.367) * (-587.154) (-589.837) [-591.832] (-589.879) -- 0:00:53
      130000 -- (-588.763) (-592.543) [-588.841] (-588.123) * (-586.982) (-590.457) [-590.263] (-590.074) -- 0:00:53

      Average standard deviation of split frequencies: 0.016140

      130500 -- [-593.013] (-589.479) (-587.410) (-589.041) * (-587.282) [-587.575] (-586.879) (-592.682) -- 0:00:53
      131000 -- (-588.583) (-591.606) (-586.565) [-588.292] * (-586.870) [-588.494] (-586.962) (-589.616) -- 0:00:53
      131500 -- (-586.560) (-588.715) [-590.041] (-589.478) * [-586.882] (-587.999) (-587.587) (-592.683) -- 0:00:52
      132000 -- [-586.816] (-589.148) (-589.165) (-588.228) * (-589.947) (-590.786) [-587.119] (-589.871) -- 0:00:52
      132500 -- (-588.181) (-589.149) (-587.775) [-586.796] * (-588.080) (-590.491) [-586.912] (-589.237) -- 0:00:52
      133000 -- (-589.068) (-594.716) (-590.199) [-589.716] * (-587.786) (-590.625) [-587.036] (-587.107) -- 0:00:52
      133500 -- (-586.743) [-588.222] (-592.540) (-587.865) * (-588.564) [-589.883] (-589.319) (-590.146) -- 0:00:51
      134000 -- [-592.921] (-588.273) (-589.593) (-588.771) * (-587.723) (-590.467) (-592.437) [-587.055] -- 0:00:51
      134500 -- [-589.344] (-591.052) (-587.589) (-590.445) * (-586.699) (-587.172) [-587.238] (-587.703) -- 0:00:51
      135000 -- (-588.875) (-587.611) [-590.462] (-589.171) * (-587.796) [-589.765] (-587.928) (-586.884) -- 0:00:51

      Average standard deviation of split frequencies: 0.018061

      135500 -- (-587.341) [-588.020] (-592.831) (-597.800) * (-586.807) (-587.954) [-588.141] (-586.259) -- 0:00:51
      136000 -- (-587.073) (-588.930) (-589.768) [-590.189] * (-588.268) [-588.052] (-587.986) (-587.329) -- 0:00:57
      136500 -- (-590.483) (-588.114) (-587.691) [-588.171] * (-586.533) (-590.262) (-590.797) [-587.194] -- 0:00:56
      137000 -- (-588.403) [-587.747] (-588.764) (-587.558) * (-587.057) [-586.501] (-590.217) (-587.730) -- 0:00:56
      137500 -- (-588.202) (-587.266) [-587.946] (-588.192) * [-587.591] (-589.388) (-589.573) (-590.239) -- 0:00:56
      138000 -- [-587.355] (-588.892) (-588.977) (-586.997) * (-587.015) (-588.716) [-589.893] (-587.800) -- 0:00:56
      138500 -- (-587.438) [-587.430] (-588.660) (-586.861) * [-588.909] (-591.693) (-591.146) (-589.451) -- 0:00:55
      139000 -- (-587.775) [-586.173] (-586.284) (-588.515) * [-587.165] (-597.496) (-588.994) (-589.430) -- 0:00:55
      139500 -- (-587.906) (-590.518) [-588.775] (-587.338) * [-587.385] (-590.493) (-587.721) (-590.923) -- 0:00:55
      140000 -- (-588.664) (-593.700) (-586.959) [-587.829] * (-592.740) (-589.536) (-586.942) [-588.946] -- 0:00:55

      Average standard deviation of split frequencies: 0.017259

      140500 -- (-586.453) (-589.912) (-588.934) [-587.483] * (-588.794) (-591.219) [-587.204] (-589.180) -- 0:00:55
      141000 -- (-592.841) (-589.374) [-587.829] (-591.258) * (-587.662) (-588.187) [-588.892] (-588.459) -- 0:00:54
      141500 -- (-592.785) [-588.430] (-593.189) (-586.955) * [-587.127] (-587.920) (-590.676) (-587.210) -- 0:00:54
      142000 -- (-589.622) (-589.090) (-589.303) [-586.691] * (-586.555) (-586.820) (-586.604) [-586.236] -- 0:00:54
      142500 -- (-587.313) (-589.603) (-588.426) [-587.817] * (-586.757) [-591.265] (-587.532) (-587.229) -- 0:00:54
      143000 -- [-588.074] (-590.605) (-587.401) (-587.810) * (-589.999) [-588.385] (-590.300) (-588.859) -- 0:00:53
      143500 -- (-589.010) (-590.548) (-590.256) [-587.188] * (-587.260) (-587.806) (-590.592) [-588.076] -- 0:00:53
      144000 -- [-589.652] (-587.859) (-592.965) (-589.649) * (-588.082) [-587.244] (-587.522) (-586.777) -- 0:00:53
      144500 -- (-590.666) (-589.674) [-591.068] (-593.213) * (-591.799) (-586.258) [-591.189] (-588.457) -- 0:00:53
      145000 -- (-590.065) [-589.958] (-587.079) (-586.666) * (-589.361) (-586.258) (-594.238) [-592.467] -- 0:00:53

      Average standard deviation of split frequencies: 0.016628

      145500 -- [-588.011] (-588.098) (-590.115) (-587.322) * (-590.847) (-588.340) [-591.680] (-591.732) -- 0:00:52
      146000 -- (-588.383) (-586.606) (-591.248) [-587.769] * (-590.742) [-587.259] (-590.663) (-589.427) -- 0:00:52
      146500 -- [-588.591] (-587.030) (-589.097) (-590.304) * (-588.002) (-586.631) [-586.873] (-586.234) -- 0:00:52
      147000 -- (-588.097) (-589.688) [-591.350] (-590.537) * (-587.035) (-588.326) (-589.330) [-587.714] -- 0:00:52
      147500 -- (-587.990) (-590.003) (-590.097) [-592.647] * (-587.960) (-586.603) [-590.792] (-586.317) -- 0:00:52
      148000 -- [-587.880] (-590.029) (-588.359) (-592.821) * (-589.547) (-590.407) [-588.490] (-587.214) -- 0:00:51
      148500 -- (-586.977) (-588.502) [-588.765] (-596.877) * (-589.699) (-589.311) [-587.929] (-590.984) -- 0:00:51
      149000 -- (-591.956) (-586.835) [-588.865] (-589.309) * (-589.154) (-588.413) (-594.718) [-589.949] -- 0:00:51
      149500 -- (-587.884) (-588.950) (-587.605) [-589.216] * (-587.912) [-593.571] (-588.187) (-587.531) -- 0:00:51
      150000 -- [-586.719] (-588.278) (-588.476) (-590.827) * (-589.305) [-588.310] (-589.108) (-588.604) -- 0:00:51

      Average standard deviation of split frequencies: 0.014705

      150500 -- (-590.782) (-590.564) [-588.685] (-587.994) * [-589.020] (-591.072) (-592.390) (-589.000) -- 0:00:50
      151000 -- (-592.834) (-587.776) (-589.331) [-586.798] * (-589.093) (-591.249) [-589.160] (-589.890) -- 0:00:50
      151500 -- [-591.896] (-591.128) (-587.565) (-587.136) * [-587.505] (-589.545) (-590.131) (-586.558) -- 0:00:50
      152000 -- (-587.887) (-590.063) (-591.916) [-586.722] * (-587.812) [-589.496] (-591.497) (-586.781) -- 0:00:50
      152500 -- (-589.321) (-587.398) [-588.401] (-587.680) * (-591.040) (-587.513) (-587.837) [-590.156] -- 0:00:55
      153000 -- (-594.343) [-587.340] (-592.085) (-589.681) * (-591.260) (-588.476) (-589.981) [-587.874] -- 0:00:55
      153500 -- (-588.093) (-587.129) [-590.216] (-587.666) * (-590.519) (-592.876) [-587.225] (-590.419) -- 0:00:55
      154000 -- (-586.968) (-589.383) [-589.561] (-586.929) * (-587.932) (-588.589) (-587.155) [-587.227] -- 0:00:54
      154500 -- (-589.721) (-588.361) [-586.549] (-587.378) * [-587.593] (-588.054) (-589.549) (-587.663) -- 0:00:54
      155000 -- [-588.149] (-588.938) (-586.515) (-587.823) * (-588.920) [-588.673] (-588.085) (-588.013) -- 0:00:54

      Average standard deviation of split frequencies: 0.014950

      155500 -- (-592.534) (-587.562) [-586.255] (-586.703) * (-589.824) (-589.450) (-589.593) [-588.176] -- 0:00:54
      156000 -- (-586.707) (-587.521) [-587.016] (-586.395) * [-588.297] (-588.055) (-587.680) (-592.347) -- 0:00:54
      156500 -- (-586.857) (-587.369) (-586.748) [-590.213] * (-588.584) [-588.833] (-587.250) (-587.317) -- 0:00:53
      157000 -- [-591.208] (-589.439) (-588.292) (-588.017) * (-587.932) (-588.065) [-590.454] (-587.918) -- 0:00:53
      157500 -- (-588.688) (-587.136) [-587.070] (-586.810) * (-587.964) (-588.330) (-587.091) [-586.209] -- 0:00:53
      158000 -- (-586.957) (-586.910) (-590.097) [-586.950] * (-587.803) (-588.146) (-587.788) [-590.925] -- 0:00:53
      158500 -- (-587.188) (-590.213) (-590.986) [-589.063] * (-588.521) [-587.508] (-588.282) (-589.883) -- 0:00:53
      159000 -- [-588.887] (-587.749) (-589.333) (-588.976) * [-590.151] (-586.651) (-587.405) (-589.932) -- 0:00:52
      159500 -- (-588.148) (-587.191) (-590.074) [-587.393] * (-587.676) (-587.057) [-590.433] (-586.969) -- 0:00:52
      160000 -- (-586.421) (-587.630) [-587.415] (-588.507) * [-587.082] (-587.517) (-587.335) (-587.172) -- 0:00:52

      Average standard deviation of split frequencies: 0.015134

      160500 -- (-590.832) (-589.961) [-588.008] (-588.394) * (-588.047) (-589.845) (-587.811) [-586.326] -- 0:00:52
      161000 -- (-593.467) (-589.124) (-587.661) [-588.090] * (-588.298) (-587.420) (-587.525) [-587.657] -- 0:00:52
      161500 -- (-591.362) (-591.580) [-589.765] (-587.442) * (-587.722) (-588.636) (-588.569) [-586.677] -- 0:00:51
      162000 -- [-589.132] (-587.335) (-589.550) (-588.252) * (-588.656) (-588.320) [-586.948] (-587.877) -- 0:00:51
      162500 -- (-592.780) (-590.225) [-587.747] (-593.052) * (-586.365) (-588.873) [-586.967] (-588.227) -- 0:00:51
      163000 -- (-588.002) (-588.958) [-587.885] (-596.702) * (-586.652) (-588.956) [-588.570] (-588.048) -- 0:00:51
      163500 -- [-590.316] (-587.969) (-589.660) (-588.481) * [-588.158] (-586.514) (-588.003) (-588.140) -- 0:00:51
      164000 -- (-589.857) (-590.502) [-590.832] (-588.367) * (-590.258) [-588.920] (-590.168) (-586.758) -- 0:00:50
      164500 -- (-590.105) [-588.005] (-589.274) (-589.066) * (-590.010) (-586.580) [-587.547] (-588.868) -- 0:00:50
      165000 -- (-593.476) (-588.614) [-589.749] (-587.690) * (-587.235) [-587.832] (-591.302) (-592.333) -- 0:00:50

      Average standard deviation of split frequencies: 0.014946

      165500 -- (-591.478) [-587.740] (-588.244) (-588.480) * [-586.938] (-589.694) (-591.102) (-592.056) -- 0:00:50
      166000 -- (-589.925) (-589.595) [-588.342] (-588.079) * (-592.804) [-587.533] (-588.030) (-590.355) -- 0:00:50
      166500 -- [-589.627] (-586.313) (-587.803) (-587.015) * (-587.104) (-588.919) [-587.434] (-588.024) -- 0:00:50
      167000 -- (-590.455) (-590.854) (-588.015) [-587.291] * [-586.915] (-587.412) (-590.759) (-589.888) -- 0:00:49
      167500 -- (-587.406) [-587.534] (-587.921) (-589.719) * (-588.307) [-588.301] (-588.277) (-588.460) -- 0:00:49
      168000 -- [-588.161] (-589.804) (-587.598) (-590.059) * (-591.133) (-587.500) [-588.213] (-587.853) -- 0:00:49
      168500 -- [-588.212] (-594.152) (-587.441) (-588.037) * [-592.010] (-587.188) (-587.876) (-587.055) -- 0:00:49
      169000 -- (-586.738) (-590.791) (-587.558) [-591.450] * (-590.388) (-587.626) [-586.607] (-591.103) -- 0:00:49
      169500 -- (-588.618) [-589.945] (-586.572) (-590.665) * [-589.254] (-587.126) (-587.043) (-591.591) -- 0:00:48
      170000 -- [-589.372] (-588.448) (-587.954) (-593.280) * (-586.908) (-588.262) (-586.650) [-588.612] -- 0:00:53

      Average standard deviation of split frequencies: 0.015119

      170500 -- (-588.444) (-586.899) [-586.540] (-590.361) * (-591.743) (-592.642) (-587.595) [-586.318] -- 0:00:53
      171000 -- (-589.574) (-588.343) [-589.411] (-588.835) * (-589.759) [-587.935] (-588.818) (-590.154) -- 0:00:53
      171500 -- (-589.552) (-589.657) [-588.787] (-596.905) * (-591.304) (-589.863) [-589.656] (-590.306) -- 0:00:53
      172000 -- (-587.577) (-595.946) (-589.047) [-586.820] * [-586.789] (-599.567) (-591.581) (-587.238) -- 0:00:52
      172500 -- (-587.348) (-592.920) [-587.044] (-587.313) * (-589.250) (-587.412) (-588.069) [-590.807] -- 0:00:52
      173000 -- (-589.117) [-587.115] (-588.595) (-589.604) * [-586.773] (-588.206) (-591.247) (-590.926) -- 0:00:52
      173500 -- [-588.659] (-587.224) (-590.053) (-589.947) * [-588.207] (-590.732) (-590.186) (-591.086) -- 0:00:52
      174000 -- (-589.944) (-587.476) (-588.146) [-593.326] * (-587.032) [-589.756] (-586.514) (-589.760) -- 0:00:52
      174500 -- (-589.622) (-587.338) [-586.646] (-587.186) * [-586.834] (-590.581) (-589.641) (-589.066) -- 0:00:52
      175000 -- (-587.736) (-587.936) [-586.243] (-587.492) * [-586.536] (-588.978) (-588.826) (-588.642) -- 0:00:51

      Average standard deviation of split frequencies: 0.014802

      175500 -- (-587.574) (-586.916) (-587.307) [-587.341] * [-587.722] (-588.798) (-590.224) (-592.287) -- 0:00:51
      176000 -- [-591.128] (-589.753) (-586.523) (-587.509) * [-591.820] (-591.506) (-588.340) (-589.341) -- 0:00:51
      176500 -- (-590.648) (-587.254) (-586.587) [-588.826] * (-588.750) (-588.976) (-588.968) [-589.055] -- 0:00:51
      177000 -- (-587.736) [-588.576] (-588.171) (-587.972) * (-588.328) (-588.253) (-587.849) [-590.612] -- 0:00:51
      177500 -- [-590.114] (-591.176) (-587.319) (-586.493) * (-589.672) [-588.002] (-587.349) (-589.777) -- 0:00:50
      178000 -- [-587.556] (-587.070) (-588.755) (-587.486) * (-587.941) [-587.562] (-587.737) (-590.672) -- 0:00:50
      178500 -- (-587.129) [-587.565] (-586.877) (-587.748) * (-590.302) (-586.898) [-588.166] (-587.588) -- 0:00:50
      179000 -- (-589.109) [-587.547] (-592.430) (-589.138) * [-587.706] (-588.492) (-589.043) (-586.898) -- 0:00:50
      179500 -- (-587.882) (-590.259) (-590.613) [-588.752] * (-588.649) (-587.703) (-595.321) [-586.635] -- 0:00:50
      180000 -- (-587.458) (-587.548) [-587.613] (-592.978) * [-592.153] (-588.311) (-588.925) (-587.744) -- 0:00:50

      Average standard deviation of split frequencies: 0.014121

      180500 -- [-589.056] (-589.319) (-588.334) (-590.105) * (-586.977) [-587.572] (-590.211) (-590.596) -- 0:00:49
      181000 -- (-590.533) [-588.809] (-588.647) (-589.458) * (-586.459) (-586.977) (-589.868) [-590.462] -- 0:00:49
      181500 -- (-589.653) (-591.816) (-587.725) [-588.862] * (-588.855) (-586.291) (-589.462) [-587.994] -- 0:00:49
      182000 -- [-588.700] (-590.202) (-587.467) (-590.488) * (-592.375) [-587.944] (-589.590) (-588.536) -- 0:00:49
      182500 -- (-589.191) (-589.196) (-589.193) [-588.449] * (-592.719) (-586.895) (-589.336) [-588.085] -- 0:00:49
      183000 -- (-588.111) (-587.650) (-596.204) [-588.854] * (-588.779) (-592.195) [-586.417] (-589.452) -- 0:00:49
      183500 -- (-587.375) [-591.387] (-591.015) (-590.063) * [-588.239] (-590.712) (-593.337) (-588.439) -- 0:00:48
      184000 -- (-591.532) (-592.623) [-591.762] (-590.556) * [-587.894] (-590.527) (-588.696) (-591.528) -- 0:00:48
      184500 -- (-590.526) (-593.845) [-591.094] (-588.388) * (-591.530) (-587.881) (-591.733) [-587.695] -- 0:00:48
      185000 -- (-587.554) (-586.256) (-589.388) [-588.785] * (-587.844) (-587.201) [-587.414] (-588.518) -- 0:00:48

      Average standard deviation of split frequencies: 0.013567

      185500 -- (-587.234) [-586.705] (-589.650) (-587.563) * (-589.617) (-586.788) (-587.456) [-586.377] -- 0:00:48
      186000 -- [-588.049] (-586.952) (-590.646) (-589.739) * (-590.225) [-588.422] (-586.436) (-586.748) -- 0:00:48
      186500 -- (-586.593) [-587.606] (-591.311) (-589.933) * (-589.471) (-587.485) [-586.826] (-587.759) -- 0:00:52
      187000 -- (-590.687) (-590.638) [-589.685] (-588.742) * (-593.621) [-589.027] (-587.836) (-587.816) -- 0:00:52
      187500 -- (-586.983) (-587.557) (-589.010) [-587.945] * (-586.837) (-587.980) [-587.949] (-587.424) -- 0:00:52
      188000 -- [-586.519] (-593.674) (-587.127) (-590.162) * (-590.571) (-588.201) (-587.533) [-588.847] -- 0:00:51
      188500 -- [-586.543] (-587.453) (-588.447) (-589.738) * (-592.578) (-591.842) (-588.591) [-586.718] -- 0:00:51
      189000 -- (-586.768) (-589.271) (-588.088) [-587.035] * (-590.852) [-592.576] (-586.493) (-587.272) -- 0:00:51
      189500 -- [-586.771] (-587.884) (-587.933) (-588.718) * [-589.850] (-588.665) (-587.810) (-588.030) -- 0:00:51
      190000 -- (-587.100) (-588.963) (-588.616) [-586.766] * (-589.740) [-589.133] (-586.792) (-587.125) -- 0:00:51

      Average standard deviation of split frequencies: 0.014107

      190500 -- (-588.156) (-590.209) [-590.819] (-588.768) * (-588.005) (-589.851) (-588.179) [-588.376] -- 0:00:50
      191000 -- [-589.594] (-589.706) (-586.466) (-589.989) * (-589.169) (-590.594) (-587.585) [-592.284] -- 0:00:50
      191500 -- (-587.782) [-587.887] (-588.965) (-587.507) * (-587.620) (-590.285) (-588.372) [-587.676] -- 0:00:50
      192000 -- (-587.247) (-588.960) [-586.469] (-590.668) * [-587.365] (-591.687) (-588.361) (-587.539) -- 0:00:50
      192500 -- (-587.364) (-589.288) [-586.467] (-592.596) * (-588.625) (-593.253) [-588.603] (-587.658) -- 0:00:50
      193000 -- (-589.057) (-587.056) [-586.399] (-588.034) * [-587.831] (-587.482) (-591.012) (-586.458) -- 0:00:50
      193500 -- (-588.874) (-590.769) [-590.182] (-588.736) * (-587.619) [-587.146] (-588.790) (-587.466) -- 0:00:50
      194000 -- [-587.569] (-592.096) (-588.274) (-587.784) * (-586.735) [-586.871] (-587.126) (-587.653) -- 0:00:49
      194500 -- (-587.861) (-591.353) (-587.213) [-586.913] * (-587.606) (-588.930) (-587.046) [-588.370] -- 0:00:49
      195000 -- (-588.386) (-589.533) [-592.576] (-586.672) * (-587.912) (-589.448) (-588.595) [-589.530] -- 0:00:49

      Average standard deviation of split frequencies: 0.013829

      195500 -- (-592.854) [-588.844] (-590.199) (-587.688) * (-589.197) (-593.574) (-587.645) [-589.086] -- 0:00:49
      196000 -- (-589.343) (-587.788) [-588.100] (-587.119) * (-587.976) [-587.664] (-587.484) (-589.353) -- 0:00:49
      196500 -- (-589.290) (-589.372) [-586.640] (-588.288) * (-588.275) (-588.700) (-588.127) [-589.975] -- 0:00:49
      197000 -- (-588.036) (-589.287) [-587.033] (-595.241) * (-592.985) (-587.974) [-587.546] (-587.919) -- 0:00:48
      197500 -- (-589.567) [-587.152] (-587.232) (-590.892) * (-592.124) (-588.795) (-588.143) [-588.381] -- 0:00:48
      198000 -- (-589.628) (-587.694) [-588.344] (-587.401) * (-588.381) [-589.022] (-589.226) (-589.332) -- 0:00:48
      198500 -- (-587.405) (-589.087) [-588.445] (-586.550) * (-586.590) (-586.209) (-589.738) [-587.660] -- 0:00:48
      199000 -- [-587.940] (-588.092) (-588.189) (-587.559) * (-587.197) (-588.664) (-588.531) [-587.230] -- 0:00:48
      199500 -- [-587.964] (-588.048) (-586.970) (-590.142) * [-587.787] (-588.266) (-589.454) (-586.725) -- 0:00:48
      200000 -- [-590.156] (-588.338) (-588.163) (-592.932) * [-586.708] (-588.973) (-590.114) (-588.092) -- 0:00:48

      Average standard deviation of split frequencies: 0.013948

      200500 -- [-590.413] (-593.031) (-587.953) (-588.391) * (-587.378) (-588.494) [-588.444] (-590.368) -- 0:00:47
      201000 -- [-588.495] (-596.921) (-589.142) (-587.852) * (-587.394) (-588.941) (-588.948) [-587.126] -- 0:00:47
      201500 -- (-588.329) [-587.327] (-590.122) (-593.120) * (-589.491) (-591.395) [-589.173] (-587.267) -- 0:00:47
      202000 -- [-586.328] (-591.370) (-589.504) (-593.061) * [-588.221] (-587.307) (-591.129) (-587.010) -- 0:00:47
      202500 -- (-588.662) (-593.228) (-588.939) [-587.179] * (-587.278) (-587.662) [-588.152] (-586.823) -- 0:00:47
      203000 -- (-587.769) [-589.445] (-589.806) (-592.138) * (-587.122) (-589.325) [-588.571] (-588.786) -- 0:00:47
      203500 -- [-586.545] (-590.717) (-592.270) (-588.026) * (-588.927) [-586.754] (-587.701) (-589.991) -- 0:00:50
      204000 -- (-589.629) [-586.140] (-590.448) (-588.051) * [-588.353] (-587.434) (-589.053) (-589.769) -- 0:00:50
      204500 -- (-589.113) (-586.754) [-588.978] (-590.721) * (-588.808) [-587.105] (-587.418) (-589.357) -- 0:00:50
      205000 -- (-586.394) [-588.556] (-589.407) (-588.160) * (-588.109) (-587.468) [-588.935] (-588.918) -- 0:00:50

      Average standard deviation of split frequencies: 0.015211

      205500 -- (-590.635) [-589.069] (-587.433) (-589.647) * (-588.355) (-591.814) [-588.501] (-586.917) -- 0:00:50
      206000 -- [-589.215] (-588.134) (-589.295) (-591.695) * (-587.858) (-588.288) (-592.440) [-587.410] -- 0:00:50
      206500 -- (-587.797) [-587.969] (-587.961) (-589.647) * (-586.973) [-586.755] (-588.716) (-587.410) -- 0:00:49
      207000 -- (-586.419) (-589.520) [-589.180] (-590.626) * (-588.495) (-587.886) [-588.087] (-589.120) -- 0:00:49
      207500 -- (-588.370) [-588.675] (-587.785) (-590.567) * (-589.022) (-587.295) (-591.319) [-589.741] -- 0:00:49
      208000 -- (-588.723) [-588.262] (-591.555) (-589.407) * (-588.417) (-587.482) (-590.854) [-588.034] -- 0:00:49
      208500 -- (-588.384) (-588.882) (-587.167) [-588.234] * (-588.774) [-587.674] (-592.784) (-589.148) -- 0:00:49
      209000 -- (-588.062) (-589.015) [-591.825] (-590.280) * (-587.799) [-587.420] (-589.617) (-588.411) -- 0:00:49
      209500 -- (-593.111) [-588.453] (-593.534) (-590.973) * (-592.043) (-587.617) (-595.254) [-587.215] -- 0:00:49
      210000 -- (-589.206) [-589.244] (-593.258) (-589.225) * [-586.455] (-587.766) (-587.016) (-586.467) -- 0:00:48

      Average standard deviation of split frequencies: 0.014479

      210500 -- (-591.038) (-592.336) (-591.647) [-587.789] * (-588.809) (-590.114) [-592.728] (-587.706) -- 0:00:48
      211000 -- (-592.564) (-587.530) [-587.506] (-589.150) * (-586.381) [-588.660] (-591.960) (-586.963) -- 0:00:48
      211500 -- [-589.259] (-589.257) (-587.210) (-586.552) * (-587.075) (-588.590) [-591.537] (-587.696) -- 0:00:48
      212000 -- (-588.698) (-589.201) (-588.420) [-588.290] * (-588.343) (-588.675) (-590.022) [-587.028] -- 0:00:48
      212500 -- [-587.959] (-586.733) (-588.694) (-586.881) * (-587.925) (-590.586) [-586.667] (-589.569) -- 0:00:48
      213000 -- (-586.921) [-590.825] (-587.817) (-588.047) * [-590.050] (-588.337) (-588.783) (-589.783) -- 0:00:48
      213500 -- (-589.363) (-589.488) [-588.377] (-589.036) * (-589.102) [-589.007] (-588.828) (-587.902) -- 0:00:47
      214000 -- [-590.563] (-587.263) (-587.167) (-588.977) * (-587.134) (-588.913) (-589.560) [-587.462] -- 0:00:47
      214500 -- (-588.561) (-586.497) [-587.632] (-587.465) * (-591.778) [-588.624] (-590.445) (-587.343) -- 0:00:47
      215000 -- (-588.351) [-586.314] (-589.414) (-587.684) * (-586.483) (-588.927) [-587.980] (-586.201) -- 0:00:47

      Average standard deviation of split frequencies: 0.013822

      215500 -- (-586.526) (-586.966) [-589.060] (-586.412) * (-588.092) (-589.994) (-594.465) [-587.452] -- 0:00:47
      216000 -- [-589.754] (-586.295) (-586.725) (-587.180) * (-590.635) [-590.243] (-589.201) (-588.483) -- 0:00:47
      216500 -- (-591.122) (-589.813) [-589.218] (-588.430) * (-592.507) (-586.377) [-587.096] (-587.333) -- 0:00:47
      217000 -- [-588.392] (-589.893) (-587.695) (-587.331) * (-588.162) [-586.731] (-589.142) (-589.973) -- 0:00:46
      217500 -- (-588.124) (-587.383) (-592.818) [-589.005] * (-588.854) [-589.302] (-588.707) (-587.342) -- 0:00:46
      218000 -- [-587.629] (-589.306) (-597.361) (-586.305) * (-595.190) (-588.706) [-590.605] (-588.177) -- 0:00:46
      218500 -- (-588.512) (-587.062) (-587.777) [-587.724] * [-598.258] (-591.357) (-590.543) (-589.883) -- 0:00:46
      219000 -- (-589.466) (-588.106) [-587.071] (-590.865) * [-587.533] (-589.055) (-587.931) (-587.951) -- 0:00:46
      219500 -- (-589.583) (-590.497) [-588.737] (-592.649) * (-587.738) [-589.744] (-587.851) (-592.741) -- 0:00:46
      220000 -- [-586.288] (-589.330) (-588.130) (-588.326) * (-588.279) (-586.738) (-586.402) [-591.073] -- 0:00:46

      Average standard deviation of split frequencies: 0.013446

      220500 -- (-588.142) (-592.054) (-587.312) [-589.232] * (-589.769) [-586.213] (-588.715) (-590.126) -- 0:00:49
      221000 -- (-587.681) (-593.343) (-587.104) [-588.222] * [-588.462] (-586.190) (-589.785) (-588.237) -- 0:00:49
      221500 -- (-591.193) [-587.543] (-587.323) (-588.080) * (-593.220) (-586.178) (-587.634) [-590.285] -- 0:00:49
      222000 -- (-590.201) (-590.601) [-587.114] (-587.191) * (-588.429) [-590.050] (-587.965) (-586.911) -- 0:00:49
      222500 -- (-586.746) (-588.063) (-588.388) [-589.055] * (-590.245) (-588.378) [-587.315] (-590.848) -- 0:00:48
      223000 -- (-586.947) (-588.229) (-589.029) [-588.420] * (-588.674) (-591.705) [-588.986] (-590.536) -- 0:00:48
      223500 -- (-588.241) (-591.196) (-588.615) [-587.519] * (-589.681) (-589.481) [-587.673] (-587.505) -- 0:00:48
      224000 -- (-588.082) [-589.145] (-589.762) (-588.252) * (-589.455) (-587.572) [-587.604] (-590.184) -- 0:00:48
      224500 -- (-588.159) [-587.657] (-590.226) (-587.324) * (-589.721) (-587.344) (-589.603) [-587.734] -- 0:00:48
      225000 -- [-586.906] (-590.092) (-589.877) (-588.287) * (-589.462) [-587.780] (-587.615) (-587.437) -- 0:00:48

      Average standard deviation of split frequencies: 0.014138

      225500 -- (-587.925) (-589.709) (-589.613) [-587.882] * (-587.050) (-588.313) (-587.612) [-588.242] -- 0:00:48
      226000 -- (-588.687) [-589.783] (-588.666) (-589.057) * (-591.737) (-586.239) [-587.798] (-589.730) -- 0:00:47
      226500 -- (-588.519) (-587.737) (-587.126) [-587.352] * (-587.512) (-590.460) [-588.298] (-588.176) -- 0:00:47
      227000 -- [-587.203] (-587.851) (-589.849) (-587.960) * [-586.853] (-589.465) (-588.082) (-587.105) -- 0:00:47
      227500 -- (-591.006) [-587.403] (-589.748) (-590.900) * (-589.934) [-588.157] (-586.673) (-591.051) -- 0:00:47
      228000 -- (-591.223) (-586.607) [-587.354] (-586.830) * (-587.729) [-586.827] (-586.675) (-586.518) -- 0:00:47
      228500 -- (-592.437) (-588.238) [-587.076] (-587.789) * (-587.783) (-591.372) (-587.184) [-586.790] -- 0:00:47
      229000 -- (-589.175) [-586.671] (-587.524) (-588.077) * (-588.577) (-590.925) (-587.757) [-586.877] -- 0:00:47
      229500 -- (-586.885) (-588.898) [-588.582] (-594.646) * (-590.232) (-592.234) [-588.131] (-587.242) -- 0:00:47
      230000 -- (-588.595) [-587.018] (-588.741) (-587.738) * (-592.269) (-590.197) (-589.759) [-586.947] -- 0:00:46

      Average standard deviation of split frequencies: 0.013965

      230500 -- (-587.871) (-590.377) (-588.255) [-587.994] * (-589.162) [-589.078] (-588.083) (-592.080) -- 0:00:46
      231000 -- [-590.994] (-591.680) (-586.936) (-588.840) * (-589.276) (-587.486) (-589.124) [-590.205] -- 0:00:46
      231500 -- (-592.240) (-594.206) (-587.709) [-588.117] * [-587.914] (-588.769) (-586.281) (-589.067) -- 0:00:46
      232000 -- (-589.552) [-587.963] (-589.856) (-588.187) * [-587.037] (-589.911) (-587.765) (-590.367) -- 0:00:46
      232500 -- (-588.286) [-589.740] (-587.035) (-590.495) * (-591.260) (-588.913) (-587.350) [-588.063] -- 0:00:46
      233000 -- (-589.403) (-587.209) [-588.611] (-588.423) * (-587.983) (-590.595) [-587.192] (-592.977) -- 0:00:46
      233500 -- (-589.461) (-588.325) (-589.936) [-586.163] * (-590.339) (-588.989) (-589.500) [-587.920] -- 0:00:45
      234000 -- (-587.123) (-587.534) [-586.983] (-589.006) * (-588.448) [-587.491] (-587.916) (-589.180) -- 0:00:45
      234500 -- (-587.623) (-587.213) (-587.818) [-586.847] * (-589.314) [-588.344] (-589.079) (-586.422) -- 0:00:45
      235000 -- (-588.131) (-587.947) [-587.996] (-595.629) * [-588.458] (-587.220) (-592.790) (-590.302) -- 0:00:45

      Average standard deviation of split frequencies: 0.013317

      235500 -- (-592.187) (-586.968) [-587.672] (-592.892) * (-587.918) (-588.841) (-592.329) [-586.862] -- 0:00:45
      236000 -- (-588.983) [-587.307] (-588.569) (-591.076) * [-586.905] (-588.682) (-586.899) (-587.367) -- 0:00:45
      236500 -- (-587.925) [-592.718] (-587.841) (-590.970) * [-592.926] (-588.258) (-587.854) (-588.100) -- 0:00:45
      237000 -- (-587.989) (-589.874) (-588.947) [-588.202] * [-586.902] (-590.447) (-589.279) (-587.177) -- 0:00:48
      237500 -- (-588.658) (-587.081) [-587.268] (-587.188) * [-588.278] (-587.322) (-587.532) (-591.682) -- 0:00:48
      238000 -- (-590.911) (-588.640) (-587.838) [-588.237] * [-588.931] (-589.128) (-586.955) (-589.126) -- 0:00:48
      238500 -- [-586.974] (-589.460) (-586.536) (-586.744) * (-588.319) (-589.784) [-587.810] (-590.574) -- 0:00:47
      239000 -- (-586.456) [-591.502] (-590.574) (-588.550) * [-590.999] (-588.261) (-589.148) (-597.736) -- 0:00:47
      239500 -- (-586.436) [-586.793] (-592.682) (-588.393) * [-588.222] (-590.748) (-591.064) (-589.042) -- 0:00:47
      240000 -- (-589.037) (-588.060) [-587.633] (-587.884) * (-588.518) [-586.208] (-586.498) (-586.666) -- 0:00:47

      Average standard deviation of split frequencies: 0.013602

      240500 -- (-587.926) (-589.874) [-588.335] (-589.428) * [-589.233] (-587.813) (-587.221) (-588.648) -- 0:00:47
      241000 -- [-589.544] (-591.030) (-589.531) (-588.409) * [-588.882] (-587.282) (-588.089) (-589.616) -- 0:00:47
      241500 -- [-586.831] (-591.466) (-589.149) (-591.512) * (-590.772) (-587.369) [-587.320] (-587.788) -- 0:00:47
      242000 -- [-586.966] (-588.857) (-589.861) (-593.275) * [-586.100] (-588.784) (-588.661) (-588.173) -- 0:00:46
      242500 -- (-589.814) (-587.984) (-586.951) [-587.118] * (-588.792) (-592.380) [-589.414] (-587.360) -- 0:00:46
      243000 -- (-586.467) [-587.890] (-587.510) (-586.297) * (-592.001) (-588.776) (-588.057) [-586.889] -- 0:00:46
      243500 -- [-587.478] (-589.974) (-589.897) (-588.177) * [-588.412] (-590.025) (-587.334) (-587.482) -- 0:00:46
      244000 -- (-586.925) (-590.178) [-588.090] (-587.750) * [-587.087] (-588.274) (-587.684) (-587.801) -- 0:00:46
      244500 -- (-588.743) (-588.735) (-588.566) [-588.395] * (-590.957) (-587.291) [-588.039] (-588.691) -- 0:00:46
      245000 -- (-587.518) (-591.068) (-588.029) [-586.841] * [-590.841] (-588.036) (-591.219) (-588.137) -- 0:00:46

      Average standard deviation of split frequencies: 0.014316

      245500 -- (-586.291) (-586.564) [-587.541] (-591.924) * (-587.612) (-594.734) [-588.519] (-586.523) -- 0:00:46
      246000 -- (-586.861) (-586.153) [-589.591] (-588.623) * [-587.333] (-587.625) (-588.280) (-591.985) -- 0:00:45
      246500 -- (-593.269) (-587.876) (-590.145) [-588.048] * [-588.338] (-590.701) (-591.591) (-587.051) -- 0:00:45
      247000 -- (-587.752) (-589.550) (-589.389) [-586.359] * (-588.172) [-592.875] (-588.535) (-588.172) -- 0:00:45
      247500 -- (-587.140) (-590.157) [-588.132] (-587.453) * (-587.592) [-587.641] (-593.585) (-587.090) -- 0:00:45
      248000 -- [-589.370] (-586.809) (-589.193) (-586.179) * [-587.853] (-590.990) (-590.523) (-588.937) -- 0:00:45
      248500 -- [-588.265] (-590.019) (-588.686) (-586.312) * (-588.451) [-587.730] (-586.468) (-586.383) -- 0:00:45
      249000 -- (-588.716) [-586.476] (-589.762) (-587.832) * (-586.929) (-591.557) [-587.250] (-590.102) -- 0:00:45
      249500 -- [-588.456] (-586.338) (-587.142) (-588.365) * (-589.434) (-591.026) (-587.171) [-586.706] -- 0:00:45
      250000 -- (-589.305) (-587.090) (-589.166) [-587.292] * (-587.833) (-591.900) (-588.811) [-587.378] -- 0:00:45

      Average standard deviation of split frequencies: 0.014049

      250500 -- [-590.326] (-586.755) (-586.549) (-586.844) * (-587.533) [-586.616] (-589.741) (-591.214) -- 0:00:44
      251000 -- [-589.098] (-587.151) (-591.281) (-588.041) * (-587.323) [-590.844] (-586.470) (-588.695) -- 0:00:44
      251500 -- [-589.185] (-586.893) (-587.176) (-588.344) * (-589.587) [-587.379] (-587.319) (-587.750) -- 0:00:44
      252000 -- (-586.817) (-587.422) (-587.371) [-589.621] * (-591.610) (-588.049) [-587.901] (-587.410) -- 0:00:44
      252500 -- [-586.918] (-587.391) (-587.062) (-588.550) * (-590.357) (-587.075) (-587.666) [-588.601] -- 0:00:44
      253000 -- (-588.473) (-589.671) [-587.185] (-591.396) * (-590.929) [-586.190] (-590.314) (-591.236) -- 0:00:44
      253500 -- (-594.548) (-588.035) (-588.526) [-591.058] * (-592.132) [-590.280] (-589.415) (-588.356) -- 0:00:44
      254000 -- (-591.807) [-589.075] (-588.347) (-593.137) * (-591.311) (-589.474) (-588.440) [-588.672] -- 0:00:46
      254500 -- (-591.484) (-587.966) (-589.135) [-587.743] * (-587.898) (-590.707) (-588.079) [-586.887] -- 0:00:46
      255000 -- (-588.372) [-589.671] (-588.943) (-587.679) * (-588.166) [-588.565] (-587.065) (-594.539) -- 0:00:46

      Average standard deviation of split frequencies: 0.013005

      255500 -- (-588.095) (-588.297) [-589.126] (-587.620) * [-589.939] (-588.812) (-590.592) (-589.249) -- 0:00:46
      256000 -- [-590.812] (-589.804) (-590.151) (-586.922) * [-592.891] (-589.565) (-587.846) (-589.368) -- 0:00:46
      256500 -- (-587.391) (-589.360) [-587.964] (-589.279) * (-589.677) (-588.456) (-592.729) [-588.220] -- 0:00:46
      257000 -- [-586.673] (-588.756) (-587.724) (-589.241) * (-588.927) (-589.761) (-589.963) [-589.748] -- 0:00:46
      257500 -- (-586.448) (-587.446) [-586.132] (-590.224) * [-589.739] (-590.791) (-588.292) (-588.793) -- 0:00:46
      258000 -- (-587.729) [-587.757] (-590.750) (-592.110) * (-587.994) [-591.310] (-590.673) (-588.525) -- 0:00:46
      258500 -- (-587.479) (-592.211) (-591.447) [-591.427] * (-588.499) (-591.395) (-592.721) [-591.069] -- 0:00:45
      259000 -- [-587.822] (-586.272) (-587.318) (-590.551) * (-587.657) (-587.773) [-587.639] (-591.395) -- 0:00:45
      259500 -- (-588.552) (-587.665) (-586.633) [-590.560] * (-591.908) [-588.640] (-590.479) (-587.550) -- 0:00:45
      260000 -- (-587.891) (-589.391) [-587.026] (-591.284) * [-589.071] (-587.396) (-588.795) (-591.485) -- 0:00:45

      Average standard deviation of split frequencies: 0.012659

      260500 -- [-587.493] (-590.042) (-587.215) (-595.443) * (-588.300) (-589.327) (-586.963) [-589.214] -- 0:00:45
      261000 -- (-591.433) [-589.117] (-590.289) (-591.602) * (-590.130) (-589.493) (-587.347) [-587.926] -- 0:00:45
      261500 -- (-587.550) [-587.971] (-589.351) (-590.258) * (-589.782) (-587.975) [-587.488] (-590.748) -- 0:00:45
      262000 -- (-587.094) (-590.176) (-589.115) [-590.455] * (-590.453) (-589.910) [-590.631] (-587.684) -- 0:00:45
      262500 -- (-590.429) (-591.680) [-589.992] (-588.468) * (-594.336) (-591.959) (-589.537) [-587.313] -- 0:00:44
      263000 -- (-587.143) (-589.036) (-590.186) [-588.236] * (-589.072) [-597.813] (-589.055) (-587.931) -- 0:00:44
      263500 -- [-587.776] (-587.861) (-593.604) (-589.564) * [-590.468] (-595.022) (-587.781) (-588.251) -- 0:00:44
      264000 -- (-590.835) (-588.469) [-591.445] (-586.654) * (-587.950) (-590.427) (-589.258) [-586.770] -- 0:00:44
      264500 -- (-589.010) (-587.007) [-590.187] (-586.981) * (-587.380) (-588.449) (-588.113) [-586.709] -- 0:00:44
      265000 -- (-588.120) (-588.995) (-594.753) [-588.394] * (-587.963) (-587.267) (-590.413) [-589.708] -- 0:00:44

      Average standard deviation of split frequencies: 0.011298

      265500 -- [-588.477] (-586.090) (-589.946) (-588.072) * (-587.446) [-588.382] (-590.572) (-593.969) -- 0:00:44
      266000 -- (-588.111) (-590.315) (-589.526) [-592.183] * (-587.637) (-587.715) (-591.912) [-591.281] -- 0:00:44
      266500 -- (-588.162) (-586.691) [-590.577] (-590.422) * [-587.842] (-587.307) (-589.127) (-588.065) -- 0:00:44
      267000 -- (-589.546) (-588.144) (-591.196) [-587.880] * (-589.918) [-586.633] (-587.548) (-588.961) -- 0:00:43
      267500 -- (-593.065) (-587.298) (-588.658) [-587.082] * [-592.288] (-590.000) (-586.885) (-587.091) -- 0:00:43
      268000 -- (-589.030) (-588.785) (-587.725) [-587.366] * (-593.260) [-590.398] (-587.199) (-589.914) -- 0:00:43
      268500 -- (-587.718) (-586.665) (-588.556) [-589.274] * (-586.835) [-588.991] (-586.549) (-592.749) -- 0:00:43
      269000 -- (-587.541) (-587.514) [-587.184] (-587.983) * (-588.079) (-590.635) (-586.579) [-590.087] -- 0:00:43
      269500 -- (-589.028) [-587.771] (-587.841) (-588.693) * (-589.521) [-587.015] (-586.505) (-589.056) -- 0:00:43
      270000 -- (-586.910) (-586.747) (-588.166) [-590.607] * [-587.178] (-587.222) (-587.455) (-589.976) -- 0:00:43

      Average standard deviation of split frequencies: 0.011865

      270500 -- (-587.515) [-586.883] (-588.626) (-589.105) * (-589.567) (-590.723) [-588.913] (-591.552) -- 0:00:43
      271000 -- (-588.408) (-587.392) (-587.605) [-592.738] * [-588.657] (-588.788) (-586.834) (-587.215) -- 0:00:45
      271500 -- (-590.897) (-587.343) [-587.898] (-588.806) * (-587.845) (-590.996) (-586.642) [-586.875] -- 0:00:45
      272000 -- (-588.099) [-587.222] (-587.684) (-586.820) * (-586.944) (-588.246) (-587.372) [-588.700] -- 0:00:45
      272500 -- (-586.820) (-588.149) (-586.674) [-587.561] * (-590.298) (-589.501) [-593.237] (-588.462) -- 0:00:45
      273000 -- (-586.555) (-586.917) (-586.464) [-587.096] * [-588.034] (-588.897) (-591.824) (-593.991) -- 0:00:45
      273500 -- (-587.677) [-586.973] (-589.954) (-587.029) * [-587.412] (-586.902) (-593.994) (-592.610) -- 0:00:45
      274000 -- (-590.131) [-586.951] (-597.681) (-588.366) * (-587.790) (-586.862) [-588.101] (-590.221) -- 0:00:45
      274500 -- [-587.926] (-588.965) (-588.368) (-590.197) * (-588.289) (-587.977) (-589.259) [-589.587] -- 0:00:44
      275000 -- (-592.543) (-587.467) (-587.179) [-594.649] * (-590.041) [-587.874] (-588.511) (-590.048) -- 0:00:44

      Average standard deviation of split frequencies: 0.011273

      275500 -- [-588.219] (-587.650) (-589.895) (-595.516) * (-588.859) (-589.161) [-588.922] (-589.439) -- 0:00:44
      276000 -- (-588.116) (-586.974) (-590.372) [-587.968] * (-587.392) [-587.518] (-590.813) (-587.223) -- 0:00:44
      276500 -- (-589.859) (-589.089) (-588.494) [-587.159] * (-587.356) (-588.560) [-588.519] (-587.548) -- 0:00:44
      277000 -- (-588.979) (-591.081) [-588.625] (-587.522) * (-588.478) (-588.656) [-590.156] (-586.965) -- 0:00:44
      277500 -- (-588.101) [-588.259] (-588.629) (-591.173) * (-593.458) (-592.103) (-588.566) [-586.662] -- 0:00:44
      278000 -- (-589.157) (-587.680) (-587.353) [-588.174] * (-590.028) (-590.029) [-586.995] (-592.590) -- 0:00:44
      278500 -- [-586.850] (-590.145) (-587.622) (-588.204) * [-589.103] (-587.843) (-586.536) (-591.839) -- 0:00:44
      279000 -- (-587.255) [-588.657] (-593.391) (-589.892) * (-593.998) (-587.097) [-588.531] (-586.690) -- 0:00:43
      279500 -- (-587.987) (-589.114) [-589.570] (-589.930) * (-590.311) (-588.679) [-588.737] (-588.597) -- 0:00:43
      280000 -- [-588.328] (-587.656) (-590.617) (-588.842) * (-593.203) [-587.414] (-586.994) (-588.900) -- 0:00:43

      Average standard deviation of split frequencies: 0.011981

      280500 -- [-587.150] (-589.409) (-588.704) (-592.685) * (-587.635) (-590.253) [-587.373] (-588.310) -- 0:00:43
      281000 -- [-587.122] (-586.356) (-589.408) (-586.558) * (-592.662) (-588.204) [-586.632] (-588.354) -- 0:00:43
      281500 -- (-590.379) (-587.746) (-588.035) [-587.618] * [-588.077] (-588.157) (-586.786) (-590.357) -- 0:00:43
      282000 -- (-587.690) (-590.344) [-588.346] (-589.422) * (-588.108) (-588.637) (-586.834) [-587.712] -- 0:00:43
      282500 -- (-586.766) [-588.987] (-587.784) (-586.500) * (-589.993) [-587.557] (-586.832) (-586.475) -- 0:00:43
      283000 -- (-587.931) (-590.099) (-588.167) [-588.394] * (-590.436) (-589.401) (-586.884) [-587.469] -- 0:00:43
      283500 -- [-586.909] (-587.362) (-586.726) (-588.403) * (-589.531) (-589.903) [-589.609] (-588.555) -- 0:00:42
      284000 -- [-586.748] (-586.964) (-589.051) (-588.240) * [-588.572] (-591.769) (-587.287) (-593.436) -- 0:00:42
      284500 -- (-590.109) (-586.838) [-590.659] (-587.387) * (-589.802) [-587.787] (-589.291) (-588.255) -- 0:00:42
      285000 -- (-588.051) [-586.713] (-589.872) (-590.890) * (-588.647) [-586.507] (-587.509) (-589.499) -- 0:00:42

      Average standard deviation of split frequencies: 0.012527

      285500 -- (-589.455) (-586.495) (-588.293) [-591.070] * (-586.940) (-587.182) [-586.833] (-590.866) -- 0:00:42
      286000 -- (-586.377) [-586.620] (-589.006) (-592.347) * (-586.892) (-586.339) [-586.482] (-589.681) -- 0:00:42
      286500 -- [-588.506] (-589.220) (-591.197) (-589.020) * [-586.633] (-588.858) (-588.160) (-590.613) -- 0:00:42
      287000 -- [-587.821] (-586.756) (-596.629) (-589.717) * [-587.861] (-589.412) (-594.001) (-588.347) -- 0:00:42
      287500 -- (-586.667) (-587.855) (-589.245) [-587.741] * (-589.157) [-589.001] (-587.628) (-587.365) -- 0:00:42
      288000 -- (-589.832) (-588.295) [-586.698] (-587.641) * (-599.525) (-588.273) [-588.249] (-587.408) -- 0:00:44
      288500 -- (-587.965) (-589.921) (-590.766) [-587.909] * (-599.707) [-588.168] (-588.184) (-587.793) -- 0:00:44
      289000 -- [-588.222] (-589.292) (-590.779) (-586.531) * [-590.271] (-590.402) (-588.246) (-587.094) -- 0:00:44
      289500 -- [-589.352] (-587.739) (-588.780) (-591.199) * (-587.940) (-592.749) (-590.611) [-587.059] -- 0:00:44
      290000 -- (-589.401) (-587.723) [-591.826] (-587.950) * (-590.224) [-591.608] (-591.906) (-586.400) -- 0:00:44

      Average standard deviation of split frequencies: 0.012366

      290500 -- (-587.528) [-586.323] (-593.949) (-589.778) * (-587.597) [-586.608] (-587.762) (-588.892) -- 0:00:43
      291000 -- (-587.854) (-588.277) [-589.640] (-588.269) * (-589.148) (-588.828) (-587.750) [-586.957] -- 0:00:43
      291500 -- [-586.198] (-587.170) (-587.994) (-589.694) * [-588.743] (-588.714) (-586.112) (-586.733) -- 0:00:43
      292000 -- (-588.223) [-586.466] (-592.305) (-589.453) * (-589.396) (-588.862) [-589.867] (-586.258) -- 0:00:43
      292500 -- (-591.451) (-589.756) (-586.903) [-586.256] * (-588.490) (-587.040) (-593.074) [-587.514] -- 0:00:43
      293000 -- [-586.816] (-589.339) (-590.284) (-587.323) * (-587.840) [-587.794] (-588.556) (-592.178) -- 0:00:43
      293500 -- (-588.389) (-589.527) [-587.253] (-586.622) * (-586.658) (-588.537) (-587.216) [-588.914] -- 0:00:43
      294000 -- [-586.989] (-589.692) (-587.033) (-587.368) * (-587.199) [-591.863] (-586.969) (-587.660) -- 0:00:43
      294500 -- (-591.555) [-590.504] (-587.786) (-592.736) * (-587.144) (-594.822) [-589.739] (-590.109) -- 0:00:43
      295000 -- [-587.555] (-589.020) (-588.630) (-586.712) * [-587.909] (-592.543) (-589.666) (-587.758) -- 0:00:43

      Average standard deviation of split frequencies: 0.012044

      295500 -- (-588.123) (-587.505) (-590.177) [-587.748] * (-590.169) (-588.227) (-591.663) [-589.909] -- 0:00:42
      296000 -- (-587.337) (-588.387) [-589.109] (-589.912) * (-587.224) [-587.000] (-589.323) (-588.240) -- 0:00:42
      296500 -- [-587.836] (-586.791) (-588.735) (-588.074) * (-589.427) [-586.653] (-588.432) (-589.067) -- 0:00:42
      297000 -- (-588.409) [-587.375] (-590.376) (-587.807) * (-587.786) (-586.281) [-588.708] (-589.136) -- 0:00:42
      297500 -- (-588.844) (-588.502) (-588.279) [-586.835] * (-587.784) [-586.268] (-588.074) (-588.077) -- 0:00:42
      298000 -- (-587.946) (-589.839) (-588.630) [-586.645] * (-588.672) (-589.897) [-587.464] (-593.027) -- 0:00:42
      298500 -- [-588.790] (-590.511) (-587.082) (-586.090) * (-588.797) [-587.829] (-586.782) (-590.681) -- 0:00:42
      299000 -- [-587.590] (-590.367) (-588.882) (-588.498) * (-588.597) [-588.394] (-587.380) (-591.990) -- 0:00:42
      299500 -- (-591.129) [-590.761] (-588.353) (-587.797) * (-593.852) (-590.002) (-588.823) [-590.000] -- 0:00:42
      300000 -- (-587.359) (-589.466) [-588.598] (-588.961) * (-588.894) [-588.127] (-589.246) (-587.729) -- 0:00:42

      Average standard deviation of split frequencies: 0.012151

      300500 -- (-588.440) [-589.055] (-587.136) (-588.468) * (-587.681) [-587.428] (-586.829) (-591.265) -- 0:00:41
      301000 -- (-587.434) (-589.265) (-590.382) [-587.613] * [-588.588] (-588.665) (-587.074) (-588.521) -- 0:00:41
      301500 -- (-588.188) [-586.685] (-589.064) (-586.558) * (-587.293) (-594.224) [-588.778] (-591.989) -- 0:00:41
      302000 -- (-586.846) [-587.137] (-588.580) (-587.665) * (-592.079) (-588.889) (-586.733) [-587.399] -- 0:00:41
      302500 -- (-587.921) [-586.865] (-592.436) (-592.207) * (-588.643) [-588.168] (-586.964) (-587.289) -- 0:00:41
      303000 -- (-587.611) (-586.806) (-587.528) [-590.172] * (-589.455) (-587.242) (-586.358) [-587.404] -- 0:00:41
      303500 -- (-587.409) (-589.163) (-587.601) [-588.108] * (-588.024) (-587.606) (-587.607) [-587.360] -- 0:00:41
      304000 -- (-588.157) (-589.579) (-589.670) [-586.901] * (-587.486) (-588.026) [-588.136] (-588.425) -- 0:00:41
      304500 -- (-586.425) (-587.112) [-591.566] (-587.905) * [-587.772] (-594.668) (-587.651) (-592.657) -- 0:00:41
      305000 -- [-588.256] (-587.041) (-587.545) (-588.088) * [-588.260] (-589.690) (-591.598) (-588.150) -- 0:00:43

      Average standard deviation of split frequencies: 0.011843

      305500 -- (-588.520) (-586.872) (-589.588) [-586.177] * (-589.098) (-591.936) [-591.416] (-590.069) -- 0:00:43
      306000 -- (-587.525) (-590.179) (-589.287) [-586.416] * [-587.640] (-589.431) (-588.479) (-587.818) -- 0:00:43
      306500 -- (-588.500) (-588.017) (-587.636) [-586.405] * (-589.034) (-587.380) (-588.348) [-586.672] -- 0:00:42
      307000 -- (-590.911) [-590.109] (-591.544) (-587.288) * [-588.374] (-586.964) (-588.142) (-586.762) -- 0:00:42
      307500 -- (-590.849) (-588.898) (-587.239) [-587.280] * (-587.227) [-587.792] (-586.680) (-589.611) -- 0:00:42
      308000 -- (-589.887) (-589.462) (-586.689) [-587.950] * [-589.960] (-586.611) (-588.004) (-588.570) -- 0:00:42
      308500 -- (-591.383) (-589.811) [-587.118] (-588.076) * (-589.221) (-592.112) (-587.511) [-588.702] -- 0:00:42
      309000 -- (-586.421) (-589.204) (-588.346) [-587.478] * (-590.950) (-589.869) (-589.357) [-588.601] -- 0:00:42
      309500 -- (-588.649) (-588.323) (-586.629) [-587.475] * (-593.037) (-588.756) [-587.885] (-589.822) -- 0:00:42
      310000 -- (-592.122) (-588.599) (-587.785) [-587.006] * [-589.919] (-589.971) (-586.953) (-589.672) -- 0:00:42

      Average standard deviation of split frequencies: 0.012329

      310500 -- (-587.724) (-588.739) (-588.658) [-586.512] * (-592.900) (-587.695) [-586.302] (-590.345) -- 0:00:42
      311000 -- (-586.550) (-587.925) [-587.954] (-589.951) * (-589.589) (-591.080) [-587.053] (-588.280) -- 0:00:42
      311500 -- (-589.839) (-590.528) [-587.489] (-587.666) * (-586.309) (-591.003) [-587.441] (-587.866) -- 0:00:41
      312000 -- (-591.690) [-588.752] (-598.803) (-587.225) * [-586.322] (-587.467) (-591.087) (-587.468) -- 0:00:41
      312500 -- (-588.125) (-590.104) [-589.119] (-590.284) * [-588.815] (-592.506) (-591.310) (-593.235) -- 0:00:41
      313000 -- (-592.038) [-591.346] (-588.525) (-589.629) * (-589.425) [-587.429] (-588.305) (-591.047) -- 0:00:41
      313500 -- [-590.447] (-592.193) (-588.753) (-588.208) * [-587.162] (-588.074) (-587.538) (-588.453) -- 0:00:41
      314000 -- (-588.763) (-592.777) [-587.421] (-587.512) * (-591.423) [-588.010] (-591.073) (-590.812) -- 0:00:41
      314500 -- (-589.954) (-588.150) (-588.157) [-595.403] * [-590.072] (-587.181) (-587.625) (-589.309) -- 0:00:41
      315000 -- (-589.989) [-590.132] (-588.598) (-590.958) * (-590.527) (-587.763) [-587.701] (-588.554) -- 0:00:41

      Average standard deviation of split frequencies: 0.012034

      315500 -- [-587.589] (-589.921) (-588.957) (-589.926) * (-589.842) [-587.824] (-586.909) (-589.229) -- 0:00:41
      316000 -- (-586.984) (-586.440) (-587.080) [-590.010] * (-586.945) [-587.958] (-589.746) (-586.919) -- 0:00:41
      316500 -- (-588.810) (-588.913) [-587.590] (-588.818) * (-587.480) (-591.030) [-586.748] (-594.205) -- 0:00:41
      317000 -- (-592.818) [-587.813] (-589.203) (-589.321) * (-589.429) (-588.501) (-586.793) [-590.036] -- 0:00:40
      317500 -- (-589.223) [-586.895] (-587.495) (-587.382) * (-592.871) (-588.251) (-587.736) [-587.894] -- 0:00:40
      318000 -- [-587.510] (-587.742) (-586.770) (-589.387) * (-594.697) (-592.262) (-590.596) [-587.978] -- 0:00:40
      318500 -- (-588.036) (-586.873) [-589.641] (-587.177) * [-591.272] (-587.295) (-590.871) (-587.465) -- 0:00:40
      319000 -- [-589.993] (-591.600) (-592.429) (-587.189) * (-589.015) (-588.026) [-587.647] (-587.339) -- 0:00:40
      319500 -- (-593.759) (-588.208) [-590.793] (-590.696) * (-587.939) (-587.125) [-587.380] (-587.928) -- 0:00:40
      320000 -- (-593.697) (-589.816) [-588.037] (-587.976) * (-588.750) (-590.889) [-587.085] (-588.642) -- 0:00:40

      Average standard deviation of split frequencies: 0.012545

      320500 -- [-590.050] (-589.617) (-588.730) (-587.786) * [-587.802] (-587.972) (-587.821) (-587.862) -- 0:00:40
      321000 -- [-587.119] (-589.222) (-586.967) (-587.419) * [-591.087] (-590.393) (-588.653) (-588.430) -- 0:00:40
      321500 -- (-588.852) (-588.005) (-588.343) [-588.320] * (-588.550) [-588.094] (-589.476) (-589.062) -- 0:00:40
      322000 -- (-587.657) [-595.233] (-593.883) (-587.041) * [-588.185] (-587.553) (-588.754) (-590.314) -- 0:00:42
      322500 -- [-587.741] (-597.925) (-587.103) (-587.527) * (-588.508) (-590.436) (-594.184) [-588.968] -- 0:00:42
      323000 -- (-589.390) (-590.110) (-590.648) [-586.651] * (-586.784) [-587.120] (-589.552) (-588.132) -- 0:00:41
      323500 -- (-588.458) [-588.132] (-590.924) (-586.608) * (-588.196) (-586.614) (-594.801) [-586.403] -- 0:00:41
      324000 -- (-587.745) [-589.556] (-591.718) (-587.278) * (-588.212) (-588.183) [-588.561] (-590.132) -- 0:00:41
      324500 -- [-587.440] (-590.903) (-592.671) (-587.984) * (-589.684) (-589.190) [-588.498] (-589.434) -- 0:00:41
      325000 -- [-587.963] (-587.308) (-589.663) (-590.827) * (-589.616) [-589.519] (-586.811) (-587.611) -- 0:00:41

      Average standard deviation of split frequencies: 0.011297

      325500 -- [-587.973] (-586.330) (-592.983) (-589.287) * (-594.642) (-589.310) (-586.585) [-587.064] -- 0:00:41
      326000 -- (-586.883) (-589.135) [-594.424] (-594.737) * (-587.973) (-588.671) [-586.488] (-588.396) -- 0:00:41
      326500 -- (-587.232) [-592.191] (-593.496) (-590.447) * [-590.757] (-587.407) (-589.158) (-592.455) -- 0:00:41
      327000 -- (-587.483) (-588.168) (-594.315) [-589.199] * (-586.790) [-588.045] (-589.133) (-592.876) -- 0:00:41
      327500 -- (-588.118) [-587.479] (-590.429) (-591.788) * (-586.432) (-590.888) [-588.073] (-587.846) -- 0:00:41
      328000 -- (-589.642) (-588.590) (-587.879) [-590.653] * (-588.337) [-587.275] (-587.542) (-590.593) -- 0:00:40
      328500 -- (-589.002) (-588.561) [-586.896] (-587.819) * (-587.240) (-587.949) [-591.016] (-591.057) -- 0:00:40
      329000 -- (-586.650) (-587.607) [-591.914] (-586.497) * (-587.587) (-591.728) (-589.930) [-592.297] -- 0:00:40
      329500 -- (-589.741) (-588.558) [-587.843] (-592.660) * (-589.765) [-588.490] (-587.714) (-590.335) -- 0:00:40
      330000 -- [-588.546] (-587.661) (-590.175) (-591.760) * (-590.495) [-588.275] (-588.451) (-594.452) -- 0:00:40

      Average standard deviation of split frequencies: 0.010781

      330500 -- (-589.672) [-586.509] (-586.618) (-591.620) * (-589.099) [-586.885] (-591.440) (-588.011) -- 0:00:40
      331000 -- (-588.494) (-586.622) [-589.371] (-592.295) * [-587.268] (-587.791) (-589.551) (-587.390) -- 0:00:40
      331500 -- (-589.139) (-586.402) (-588.352) [-587.552] * (-586.572) (-589.428) [-593.041] (-587.661) -- 0:00:40
      332000 -- (-587.826) (-592.339) [-586.464] (-589.748) * (-587.602) (-590.560) [-589.238] (-590.316) -- 0:00:40
      332500 -- (-586.749) (-588.609) [-588.791] (-592.498) * (-587.820) (-588.707) [-587.558] (-589.886) -- 0:00:40
      333000 -- [-587.718] (-587.007) (-589.799) (-587.902) * (-590.145) (-588.044) (-587.874) [-588.025] -- 0:00:40
      333500 -- (-587.149) [-587.351] (-588.105) (-588.037) * (-587.546) (-586.741) [-587.477] (-593.988) -- 0:00:39
      334000 -- [-588.186] (-588.874) (-591.185) (-587.729) * (-590.148) [-589.065] (-588.916) (-592.946) -- 0:00:39
      334500 -- [-586.473] (-588.449) (-588.396) (-587.134) * (-588.645) (-588.681) [-589.466] (-591.675) -- 0:00:39
      335000 -- (-588.991) (-589.192) (-591.394) [-588.192] * (-594.042) [-587.666] (-587.893) (-588.376) -- 0:00:39

      Average standard deviation of split frequencies: 0.010873

      335500 -- (-590.191) (-587.780) (-591.395) [-587.658] * (-589.190) [-587.204] (-588.210) (-587.354) -- 0:00:39
      336000 -- (-594.220) (-587.905) [-589.138] (-586.550) * (-590.054) (-587.158) [-590.362] (-586.769) -- 0:00:39
      336500 -- (-587.202) [-587.790] (-590.217) (-591.623) * (-587.912) (-587.123) (-594.373) [-587.784] -- 0:00:39
      337000 -- (-592.178) (-587.400) [-589.381] (-589.168) * (-587.434) (-587.224) [-595.093] (-588.135) -- 0:00:39
      337500 -- (-588.143) [-587.879] (-589.080) (-589.255) * (-586.248) [-587.243] (-594.142) (-588.040) -- 0:00:39
      338000 -- [-588.790] (-591.095) (-590.090) (-588.641) * (-586.782) (-589.793) (-589.633) [-588.871] -- 0:00:39
      338500 -- (-591.092) (-587.404) (-587.267) [-587.533] * (-588.419) (-588.479) [-588.088] (-586.886) -- 0:00:39
      339000 -- [-589.399] (-588.301) (-587.910) (-588.089) * [-587.801] (-586.469) (-586.949) (-588.751) -- 0:00:40
      339500 -- [-587.796] (-591.609) (-588.344) (-592.901) * [-593.195] (-588.389) (-592.295) (-588.227) -- 0:00:40
      340000 -- (-588.038) (-587.728) [-589.529] (-588.169) * (-591.522) (-591.939) [-586.405] (-586.759) -- 0:00:40

      Average standard deviation of split frequencies: 0.010811

      340500 -- (-588.263) (-587.901) (-587.433) [-586.230] * [-591.858] (-591.524) (-589.680) (-586.752) -- 0:00:40
      341000 -- (-588.639) (-587.979) [-588.826] (-587.453) * [-586.881] (-590.710) (-587.738) (-587.603) -- 0:00:40
      341500 -- (-586.677) (-587.795) [-588.071] (-586.965) * (-586.914) (-592.789) (-588.260) [-587.636] -- 0:00:40
      342000 -- (-586.400) (-591.423) [-589.863] (-588.359) * [-588.767] (-591.193) (-586.284) (-588.907) -- 0:00:40
      342500 -- [-587.598] (-592.583) (-586.326) (-588.421) * (-587.778) [-587.089] (-590.395) (-590.326) -- 0:00:40
      343000 -- (-588.275) (-592.691) (-587.195) [-586.965] * [-586.411] (-588.383) (-589.977) (-587.306) -- 0:00:40
      343500 -- [-587.300] (-589.504) (-590.705) (-590.063) * (-586.676) [-589.470] (-589.888) (-591.216) -- 0:00:40
      344000 -- [-587.469] (-588.692) (-590.136) (-588.123) * (-588.914) (-590.056) [-595.080] (-591.452) -- 0:00:40
      344500 -- [-587.220] (-590.441) (-589.460) (-589.566) * (-590.215) (-588.846) (-593.848) [-590.876] -- 0:00:39
      345000 -- (-587.193) (-591.146) [-586.662] (-592.872) * [-587.256] (-593.673) (-591.676) (-588.625) -- 0:00:39

      Average standard deviation of split frequencies: 0.011410

      345500 -- (-589.237) (-587.867) [-587.892] (-589.747) * (-591.113) (-596.467) (-593.269) [-587.657] -- 0:00:39
      346000 -- (-588.571) [-588.099] (-588.422) (-587.213) * (-590.814) (-591.484) [-588.602] (-590.139) -- 0:00:39
      346500 -- [-589.066] (-589.043) (-589.372) (-587.267) * (-592.774) (-590.719) [-588.643] (-586.711) -- 0:00:39
      347000 -- (-587.366) (-587.950) (-592.197) [-589.718] * (-587.120) (-591.210) (-586.545) [-588.841] -- 0:00:39
      347500 -- (-587.036) [-587.993] (-590.161) (-591.698) * (-588.272) [-586.491] (-587.415) (-588.511) -- 0:00:39
      348000 -- (-588.573) (-587.864) (-589.187) [-593.194] * (-587.657) [-587.814] (-592.599) (-587.785) -- 0:00:39
      348500 -- (-591.119) (-587.417) [-587.763] (-586.140) * (-590.831) [-588.036] (-590.373) (-587.675) -- 0:00:39
      349000 -- (-592.208) (-587.689) (-588.166) [-588.015] * [-591.701] (-589.946) (-587.283) (-590.969) -- 0:00:39
      349500 -- (-589.374) (-588.610) (-587.737) [-587.426] * (-592.570) [-586.886] (-589.962) (-588.788) -- 0:00:39
      350000 -- (-587.659) (-592.755) (-587.235) [-588.010] * (-590.361) (-591.199) [-588.171] (-588.097) -- 0:00:39

      Average standard deviation of split frequencies: 0.010586

      350500 -- (-587.161) (-590.459) [-588.231] (-590.793) * (-587.827) (-590.801) (-588.905) [-588.350] -- 0:00:38
      351000 -- (-589.622) [-587.785] (-591.060) (-593.385) * (-587.881) (-589.692) [-590.351] (-594.924) -- 0:00:38
      351500 -- [-593.516] (-587.357) (-590.694) (-590.113) * (-589.860) [-588.852] (-586.559) (-588.650) -- 0:00:38
      352000 -- (-586.290) [-586.528] (-594.611) (-589.125) * (-591.841) (-588.055) (-594.355) [-586.716] -- 0:00:38
      352500 -- [-587.724] (-587.543) (-588.387) (-587.797) * (-586.877) (-588.182) (-588.514) [-586.865] -- 0:00:38
      353000 -- (-589.216) [-588.537] (-589.661) (-588.009) * [-586.207] (-586.852) (-591.705) (-590.174) -- 0:00:38
      353500 -- [-586.472] (-587.181) (-587.185) (-586.755) * (-588.084) (-590.236) [-587.628] (-588.018) -- 0:00:38
      354000 -- (-586.566) [-586.959] (-588.295) (-588.961) * (-588.727) (-587.808) (-589.691) [-589.848] -- 0:00:38
      354500 -- (-588.997) [-590.619] (-587.876) (-588.914) * [-587.009] (-587.340) (-586.446) (-590.899) -- 0:00:38
      355000 -- (-588.801) (-587.239) (-589.071) [-589.078] * (-588.455) (-590.834) (-586.827) [-589.140] -- 0:00:38

      Average standard deviation of split frequencies: 0.010262

      355500 -- (-586.844) (-586.552) (-590.164) [-588.854] * [-591.608] (-591.013) (-587.372) (-594.386) -- 0:00:39
      356000 -- (-588.456) [-588.382] (-590.316) (-590.414) * (-590.094) (-586.178) [-590.144] (-588.289) -- 0:00:39
      356500 -- (-590.516) (-587.953) (-589.278) [-588.911] * (-587.008) [-587.540] (-589.643) (-591.572) -- 0:00:39
      357000 -- [-591.250] (-587.253) (-588.158) (-591.468) * [-591.990] (-589.121) (-592.355) (-591.613) -- 0:00:39
      357500 -- [-589.139] (-588.986) (-588.495) (-589.005) * (-591.258) (-587.362) [-587.732] (-587.020) -- 0:00:39
      358000 -- (-586.754) [-591.631] (-588.851) (-587.945) * (-590.548) (-589.216) (-594.564) [-588.140] -- 0:00:39
      358500 -- (-588.857) [-591.203] (-591.968) (-587.204) * (-588.997) (-597.508) [-591.381] (-590.338) -- 0:00:39
      359000 -- (-592.688) (-588.431) (-590.891) [-587.130] * (-591.274) [-586.513] (-589.795) (-592.019) -- 0:00:39
      359500 -- [-591.890] (-587.980) (-587.874) (-587.779) * (-588.409) [-587.805] (-587.924) (-590.293) -- 0:00:39
      360000 -- (-588.634) (-587.664) (-587.859) [-587.698] * (-590.205) (-589.627) [-588.101] (-588.729) -- 0:00:39

      Average standard deviation of split frequencies: 0.010456

      360500 -- (-593.172) [-590.574] (-591.986) (-590.800) * (-588.772) (-594.816) (-586.644) [-588.061] -- 0:00:39
      361000 -- (-590.025) (-588.899) (-587.105) [-589.560] * (-587.104) (-592.807) (-587.106) [-588.269] -- 0:00:38
      361500 -- (-592.360) (-590.581) [-587.623] (-590.714) * (-588.779) [-593.124] (-591.803) (-587.303) -- 0:00:38
      362000 -- (-592.868) [-587.436] (-587.125) (-587.132) * [-588.897] (-589.022) (-586.890) (-588.455) -- 0:00:38
      362500 -- [-589.815] (-589.630) (-588.158) (-586.967) * [-587.624] (-587.448) (-591.070) (-588.758) -- 0:00:38
      363000 -- (-592.026) (-587.105) (-587.838) [-587.594] * [-587.515] (-587.325) (-591.409) (-587.926) -- 0:00:38
      363500 -- (-591.570) (-590.150) (-588.767) [-588.274] * (-588.023) (-587.088) [-587.061] (-588.544) -- 0:00:38
      364000 -- [-588.430] (-588.862) (-587.712) (-587.816) * (-588.748) [-588.043] (-589.227) (-588.217) -- 0:00:38
      364500 -- (-587.433) [-588.804] (-591.315) (-589.194) * (-591.946) [-587.404] (-587.677) (-587.568) -- 0:00:38
      365000 -- [-587.578] (-592.331) (-589.470) (-590.787) * (-589.061) (-590.977) [-589.162] (-588.158) -- 0:00:38

      Average standard deviation of split frequencies: 0.010384

      365500 -- (-587.013) (-593.156) [-588.485] (-587.044) * (-588.238) (-591.011) (-590.107) [-588.054] -- 0:00:38
      366000 -- [-591.545] (-587.227) (-588.970) (-587.620) * [-587.175] (-592.753) (-587.508) (-589.833) -- 0:00:38
      366500 -- [-586.805] (-587.427) (-591.463) (-590.355) * (-589.747) [-586.227] (-590.154) (-587.993) -- 0:00:38
      367000 -- [-586.650] (-593.700) (-588.015) (-588.573) * [-589.661] (-587.653) (-587.593) (-587.994) -- 0:00:37
      367500 -- (-587.934) (-588.804) (-586.997) [-588.608] * (-587.534) (-590.087) (-589.042) [-587.685] -- 0:00:37
      368000 -- (-589.828) (-589.875) (-590.078) [-587.679] * (-588.477) (-591.161) [-588.441] (-589.740) -- 0:00:37
      368500 -- (-589.793) (-588.024) [-593.343] (-588.916) * (-587.251) [-586.362] (-587.842) (-587.475) -- 0:00:37
      369000 -- (-589.752) [-588.176] (-588.525) (-591.143) * (-587.711) (-588.014) (-587.562) [-589.687] -- 0:00:37
      369500 -- (-588.041) (-586.925) [-587.820] (-586.858) * (-586.942) (-589.200) [-588.994] (-587.789) -- 0:00:37
      370000 -- (-587.883) (-586.402) [-587.932] (-587.838) * (-587.649) (-589.209) (-589.385) [-591.643] -- 0:00:37

      Average standard deviation of split frequencies: 0.010731

      370500 -- (-588.408) (-589.710) (-586.840) [-587.687] * (-587.384) (-588.004) [-587.076] (-589.263) -- 0:00:37
      371000 -- [-589.376] (-589.902) (-588.140) (-587.810) * (-588.098) (-589.124) (-586.909) [-589.145] -- 0:00:37
      371500 -- [-589.560] (-586.703) (-589.119) (-589.508) * [-590.254] (-595.566) (-591.941) (-588.465) -- 0:00:37
      372000 -- (-589.058) [-588.470] (-587.519) (-592.269) * (-588.075) [-588.377] (-587.931) (-588.063) -- 0:00:38
      372500 -- [-586.510] (-588.519) (-587.368) (-591.341) * (-587.475) (-592.016) [-586.151] (-588.709) -- 0:00:38
      373000 -- [-587.200] (-587.438) (-587.324) (-588.576) * (-587.324) [-588.145] (-586.796) (-589.356) -- 0:00:38
      373500 -- (-588.522) (-590.597) [-587.846] (-592.727) * (-587.608) (-587.945) [-586.204] (-588.537) -- 0:00:38
      374000 -- [-590.459] (-587.629) (-589.355) (-593.648) * (-588.458) (-588.426) [-586.902] (-587.735) -- 0:00:38
      374500 -- [-589.261] (-588.499) (-588.480) (-587.773) * [-586.667] (-587.550) (-587.954) (-586.901) -- 0:00:38
      375000 -- (-587.711) (-589.139) (-588.151) [-588.219] * [-586.395] (-586.995) (-588.612) (-589.045) -- 0:00:38

      Average standard deviation of split frequencies: 0.010422

      375500 -- (-587.176) (-589.378) (-587.556) [-593.089] * [-595.338] (-588.375) (-587.802) (-588.730) -- 0:00:38
      376000 -- [-587.944] (-588.960) (-591.901) (-589.297) * (-587.617) (-587.615) (-586.550) [-587.143] -- 0:00:38
      376500 -- (-589.223) (-588.768) [-591.170] (-586.589) * (-587.547) [-589.296] (-588.021) (-588.134) -- 0:00:38
      377000 -- (-591.032) (-588.395) (-591.486) [-586.125] * (-589.616) (-586.827) (-587.049) [-592.042] -- 0:00:38
      377500 -- (-588.868) (-592.519) (-587.320) [-588.128] * (-594.304) [-587.327] (-590.044) (-593.792) -- 0:00:37
      378000 -- (-586.833) (-592.001) (-590.972) [-586.756] * (-589.594) (-586.727) [-590.742] (-586.462) -- 0:00:37
      378500 -- (-589.508) (-591.940) (-590.102) [-589.154] * (-591.473) [-588.516] (-590.179) (-588.068) -- 0:00:37
      379000 -- [-590.111] (-591.189) (-588.754) (-589.176) * (-601.493) [-590.351] (-588.551) (-591.364) -- 0:00:37
      379500 -- (-591.469) [-588.401] (-588.979) (-590.003) * [-592.133] (-590.994) (-590.612) (-590.415) -- 0:00:37
      380000 -- (-590.456) [-588.531] (-588.024) (-591.579) * [-587.677] (-589.981) (-589.921) (-591.563) -- 0:00:37

      Average standard deviation of split frequencies: 0.009675

      380500 -- (-590.186) (-593.402) [-588.618] (-590.176) * (-589.666) (-595.537) [-591.284] (-589.612) -- 0:00:37
      381000 -- (-592.182) [-587.544] (-588.114) (-587.226) * (-589.996) (-598.649) (-589.421) [-591.195] -- 0:00:37
      381500 -- (-589.943) (-586.882) (-586.968) [-587.535] * (-589.446) (-588.613) (-591.479) [-588.077] -- 0:00:37
      382000 -- (-587.673) [-586.291] (-593.323) (-587.371) * (-589.288) (-588.193) (-586.211) [-589.990] -- 0:00:37
      382500 -- (-592.296) (-586.603) (-588.647) [-587.109] * (-588.514) [-589.766] (-586.241) (-590.786) -- 0:00:37
      383000 -- (-591.169) (-589.169) (-588.645) [-586.868] * [-586.623] (-587.502) (-589.989) (-594.255) -- 0:00:37
      383500 -- (-587.747) (-588.343) (-586.951) [-587.808] * [-588.988] (-588.156) (-587.971) (-587.710) -- 0:00:36
      384000 -- (-588.958) (-587.484) [-588.576] (-589.022) * (-587.860) (-589.384) [-588.428] (-589.128) -- 0:00:36
      384500 -- (-588.713) (-586.654) (-590.256) [-591.563] * (-589.970) (-588.860) [-587.310] (-586.518) -- 0:00:36
      385000 -- [-589.683] (-589.655) (-587.027) (-588.352) * (-589.799) (-589.748) [-590.668] (-586.079) -- 0:00:36

      Average standard deviation of split frequencies: 0.009617

      385500 -- (-588.179) [-587.979] (-588.467) (-588.074) * (-588.629) (-589.807) (-596.341) [-588.715] -- 0:00:36
      386000 -- (-589.161) (-586.561) (-590.755) [-587.793] * [-589.448] (-587.583) (-587.741) (-589.588) -- 0:00:36
      386500 -- (-591.183) (-589.081) [-588.424] (-587.900) * (-587.221) (-587.955) [-588.513] (-587.111) -- 0:00:36
      387000 -- (-588.802) (-587.862) [-588.043] (-586.780) * (-588.507) (-589.042) [-589.223] (-588.666) -- 0:00:36
      387500 -- (-590.763) [-588.809] (-587.408) (-588.437) * (-587.808) (-592.504) (-591.220) [-588.723] -- 0:00:36
      388000 -- (-590.728) [-588.712] (-588.878) (-588.980) * (-588.070) [-586.714] (-590.848) (-587.598) -- 0:00:36
      388500 -- (-590.420) (-587.307) [-592.440] (-589.318) * (-588.530) (-591.282) (-589.886) [-588.702] -- 0:00:37
      389000 -- (-587.426) (-588.218) (-588.023) [-591.627] * (-589.803) (-588.152) (-589.634) [-588.148] -- 0:00:37
      389500 -- (-590.006) (-588.241) (-590.994) [-587.937] * (-589.524) [-587.541] (-591.309) (-587.586) -- 0:00:37
      390000 -- (-587.486) (-588.991) [-586.919] (-589.429) * (-587.619) [-588.293] (-589.811) (-593.310) -- 0:00:37

      Average standard deviation of split frequencies: 0.010785

      390500 -- (-589.178) (-588.900) (-587.091) [-589.278] * (-587.711) (-588.895) [-587.562] (-588.297) -- 0:00:37
      391000 -- (-587.274) [-589.111] (-588.670) (-588.749) * (-586.838) (-593.757) [-591.073] (-588.720) -- 0:00:37
      391500 -- (-587.009) [-591.765] (-589.265) (-589.292) * (-589.001) [-590.758] (-593.407) (-586.431) -- 0:00:37
      392000 -- [-587.729] (-588.462) (-589.774) (-588.867) * [-587.032] (-587.752) (-588.552) (-586.487) -- 0:00:37
      392500 -- (-587.901) (-588.830) (-590.042) [-586.855] * (-587.111) (-592.281) (-589.315) [-586.248] -- 0:00:37
      393000 -- (-587.264) [-587.056] (-594.283) (-588.633) * (-587.216) (-589.057) [-588.984] (-589.102) -- 0:00:37
      393500 -- [-587.802] (-587.807) (-591.424) (-586.531) * (-592.134) (-590.785) [-589.884] (-586.878) -- 0:00:36
      394000 -- (-586.756) (-587.137) (-587.759) [-587.178] * (-589.801) [-588.775] (-591.376) (-586.466) -- 0:00:36
      394500 -- [-590.367] (-588.966) (-589.571) (-587.226) * (-591.105) (-589.409) [-589.849] (-589.227) -- 0:00:36
      395000 -- (-588.258) (-587.823) (-587.745) [-587.455] * (-586.973) (-588.029) (-589.005) [-587.476] -- 0:00:36

      Average standard deviation of split frequencies: 0.009523

      395500 -- [-587.722] (-587.251) (-587.429) (-587.207) * [-595.967] (-588.303) (-587.173) (-587.641) -- 0:00:36
      396000 -- (-591.267) (-591.314) (-589.773) [-586.134] * (-591.815) (-586.789) (-586.190) [-586.816] -- 0:00:36
      396500 -- (-586.837) (-593.874) (-588.897) [-588.985] * (-586.501) (-592.664) (-593.283) [-587.706] -- 0:00:36
      397000 -- (-588.450) (-592.123) (-589.011) [-589.336] * [-586.546] (-595.414) (-589.698) (-587.365) -- 0:00:36
      397500 -- (-587.128) (-593.823) [-588.651] (-588.676) * (-591.763) (-586.996) (-587.768) [-588.428] -- 0:00:36
      398000 -- (-590.390) (-592.260) (-590.072) [-590.220] * (-587.855) (-587.909) [-587.871] (-589.350) -- 0:00:36
      398500 -- (-587.394) (-587.610) [-589.622] (-593.346) * (-587.611) (-589.955) [-587.926] (-591.213) -- 0:00:36
      399000 -- (-588.798) (-591.921) [-590.883] (-590.394) * (-589.053) [-588.051] (-588.003) (-587.790) -- 0:00:36
      399500 -- (-587.713) (-587.491) (-590.319) [-587.413] * (-589.053) [-588.328] (-590.400) (-589.586) -- 0:00:36
      400000 -- [-587.066] (-590.249) (-588.706) (-587.846) * (-586.633) [-588.849] (-590.171) (-590.227) -- 0:00:36

      Average standard deviation of split frequencies: 0.009633

      400500 -- [-587.821] (-587.657) (-587.725) (-586.993) * (-588.023) [-588.342] (-589.191) (-586.487) -- 0:00:35
      401000 -- (-589.648) (-587.945) [-587.204] (-588.213) * (-588.722) (-588.110) [-587.682] (-587.453) -- 0:00:35
      401500 -- (-590.868) (-593.086) (-589.110) [-589.709] * [-587.716] (-590.568) (-588.535) (-589.067) -- 0:00:35
      402000 -- (-591.384) [-587.699] (-586.457) (-590.334) * (-586.242) (-590.638) [-588.184] (-587.805) -- 0:00:35
      402500 -- (-588.784) (-587.048) [-588.056] (-587.104) * (-590.746) (-591.159) [-590.366] (-589.142) -- 0:00:35
      403000 -- (-587.991) (-588.093) [-587.816] (-588.543) * (-590.016) (-587.642) [-589.237] (-588.842) -- 0:00:35
      403500 -- (-587.445) [-588.554] (-592.447) (-588.784) * [-589.506] (-591.164) (-591.222) (-588.165) -- 0:00:35
      404000 -- (-587.118) (-586.891) [-586.824] (-588.719) * (-589.389) [-587.747] (-589.899) (-587.457) -- 0:00:35
      404500 -- (-590.666) (-591.567) (-589.738) [-586.754] * [-591.726] (-590.217) (-590.309) (-588.239) -- 0:00:35
      405000 -- (-588.910) (-587.071) [-588.569] (-588.030) * (-586.863) [-590.499] (-587.222) (-590.502) -- 0:00:35

      Average standard deviation of split frequencies: 0.009652

      405500 -- (-589.626) (-593.428) (-587.756) [-587.063] * (-591.046) (-589.098) (-588.399) [-588.557] -- 0:00:36
      406000 -- (-587.374) (-590.612) [-586.995] (-588.155) * (-588.524) (-588.666) [-588.411] (-588.423) -- 0:00:36
      406500 -- (-587.354) (-588.263) [-588.253] (-587.408) * (-589.981) (-587.862) (-590.006) [-586.748] -- 0:00:36
      407000 -- (-588.115) (-590.243) (-588.027) [-587.333] * (-593.640) (-587.340) [-590.781] (-588.396) -- 0:00:36
      407500 -- [-587.426] (-592.102) (-591.448) (-588.234) * (-588.471) (-588.776) (-588.355) [-588.098] -- 0:00:36
      408000 -- (-590.013) (-590.727) [-587.171] (-587.838) * [-586.412] (-588.865) (-587.961) (-588.413) -- 0:00:36
      408500 -- (-589.456) (-588.121) [-588.150] (-587.795) * (-586.356) [-587.463] (-588.115) (-587.871) -- 0:00:36
      409000 -- [-590.858] (-587.489) (-589.941) (-589.421) * [-586.986] (-588.768) (-586.533) (-589.461) -- 0:00:36
      409500 -- (-587.947) [-589.468] (-587.261) (-591.453) * [-589.847] (-588.061) (-589.536) (-586.606) -- 0:00:36
      410000 -- (-587.671) (-592.587) [-586.674] (-588.866) * (-589.227) (-587.868) (-586.442) [-588.023] -- 0:00:35

      Average standard deviation of split frequencies: 0.009111

      410500 -- (-590.880) (-588.453) [-587.578] (-589.668) * (-589.401) (-590.399) [-587.983] (-587.285) -- 0:00:35
      411000 -- (-589.646) (-595.525) [-587.626] (-590.304) * (-587.924) (-589.852) [-587.531] (-591.219) -- 0:00:35
      411500 -- (-591.090) (-589.331) (-587.401) [-586.934] * [-587.980] (-590.200) (-588.493) (-588.457) -- 0:00:35
      412000 -- (-591.087) (-587.307) (-587.401) [-590.464] * (-589.572) (-588.651) [-587.742] (-589.910) -- 0:00:35
      412500 -- [-586.499] (-590.516) (-588.306) (-588.707) * (-589.952) [-590.733] (-588.095) (-587.285) -- 0:00:35
      413000 -- [-587.448] (-587.420) (-590.954) (-587.399) * [-590.567] (-587.236) (-589.200) (-590.505) -- 0:00:35
      413500 -- (-587.834) (-589.115) (-588.594) [-587.912] * (-589.925) (-587.610) [-588.793] (-589.492) -- 0:00:35
      414000 -- (-588.688) (-586.801) (-587.787) [-587.946] * (-596.139) [-592.910] (-588.259) (-590.442) -- 0:00:35
      414500 -- [-586.729] (-586.448) (-594.543) (-587.692) * (-589.722) (-592.135) (-589.003) [-589.900] -- 0:00:35
      415000 -- (-586.225) (-588.325) [-592.513] (-588.188) * [-587.850] (-588.584) (-589.041) (-591.022) -- 0:00:35

      Average standard deviation of split frequencies: 0.007932

      415500 -- (-589.509) [-588.816] (-591.255) (-590.501) * (-588.003) [-586.996] (-588.768) (-592.498) -- 0:00:35
      416000 -- (-587.348) (-591.813) [-588.730] (-592.673) * (-587.908) (-586.929) (-587.713) [-590.554] -- 0:00:35
      416500 -- [-587.999] (-589.414) (-586.444) (-590.087) * (-587.577) [-590.367] (-590.038) (-589.968) -- 0:00:35
      417000 -- (-587.785) [-588.258] (-586.662) (-589.128) * (-587.978) (-594.645) [-590.682] (-591.594) -- 0:00:34
      417500 -- (-588.825) [-587.772] (-588.150) (-588.927) * [-586.846] (-594.997) (-590.218) (-589.450) -- 0:00:34
      418000 -- [-588.567] (-587.828) (-590.940) (-595.051) * (-586.591) (-593.281) (-590.292) [-588.813] -- 0:00:34
      418500 -- (-587.271) (-591.115) (-589.839) [-587.519] * (-597.493) [-589.435] (-588.620) (-589.155) -- 0:00:34
      419000 -- [-586.816] (-588.876) (-589.758) (-586.896) * (-589.636) [-588.544] (-593.132) (-587.854) -- 0:00:34
      419500 -- [-587.226] (-587.210) (-590.918) (-591.070) * (-588.686) (-590.034) (-589.182) [-590.203] -- 0:00:34
      420000 -- [-587.213] (-589.670) (-586.816) (-588.907) * (-588.683) (-593.451) [-587.160] (-589.851) -- 0:00:35

      Average standard deviation of split frequencies: 0.007004

      420500 -- (-587.257) [-588.284] (-591.231) (-589.716) * (-589.411) (-588.262) [-586.703] (-587.394) -- 0:00:35
      421000 -- (-588.945) (-587.284) [-586.107] (-591.825) * (-588.949) (-589.374) (-593.829) [-589.491] -- 0:00:35
      421500 -- (-587.847) [-590.266] (-586.384) (-589.172) * (-588.165) [-588.589] (-588.144) (-590.038) -- 0:00:35
      422000 -- (-590.186) [-587.656] (-588.417) (-587.888) * (-588.118) [-590.124] (-590.209) (-589.857) -- 0:00:35
      422500 -- (-587.850) (-589.329) [-587.370] (-590.050) * (-586.615) (-596.813) [-587.430] (-595.980) -- 0:00:35
      423000 -- (-589.283) [-587.700] (-590.638) (-588.231) * (-587.314) [-592.807] (-586.982) (-594.624) -- 0:00:35
      423500 -- (-588.468) (-588.286) [-590.878] (-587.253) * (-586.789) (-589.694) (-587.572) [-591.812] -- 0:00:35
      424000 -- [-588.980] (-592.379) (-588.331) (-588.105) * [-586.386] (-589.829) (-588.521) (-589.277) -- 0:00:35
      424500 -- (-586.595) (-588.428) [-588.216] (-593.247) * (-587.478) (-590.759) [-587.958] (-586.761) -- 0:00:35
      425000 -- (-587.619) [-587.590] (-588.075) (-587.208) * [-587.753] (-591.634) (-589.065) (-588.092) -- 0:00:35

      Average standard deviation of split frequencies: 0.007469

      425500 -- (-590.777) (-588.772) [-588.697] (-589.240) * (-587.487) [-587.600] (-587.573) (-592.455) -- 0:00:35
      426000 -- (-592.529) [-587.185] (-588.251) (-591.887) * (-588.914) (-586.878) (-586.464) [-588.064] -- 0:00:35
      426500 -- (-587.177) (-592.148) (-591.620) [-588.265] * (-588.663) (-587.658) (-588.585) [-586.883] -- 0:00:34
      427000 -- [-586.672] (-589.343) (-587.025) (-588.300) * (-588.187) (-587.086) [-591.100] (-588.446) -- 0:00:34
      427500 -- (-586.429) (-590.696) (-589.404) [-590.573] * (-588.519) [-588.908] (-587.088) (-587.331) -- 0:00:34
      428000 -- (-587.116) (-588.594) [-588.315] (-591.500) * (-587.212) (-588.524) (-591.724) [-588.076] -- 0:00:34
      428500 -- (-587.234) (-587.981) (-587.012) [-588.228] * (-587.089) (-588.417) [-590.465] (-587.147) -- 0:00:34
      429000 -- (-589.721) (-589.549) [-587.105] (-586.789) * (-586.660) (-589.821) (-588.015) [-590.964] -- 0:00:34
      429500 -- (-589.062) (-587.451) (-593.942) [-586.650] * [-586.272] (-589.576) (-590.982) (-591.319) -- 0:00:34
      430000 -- [-589.302] (-588.680) (-590.678) (-586.260) * (-586.414) (-587.547) (-589.458) [-588.905] -- 0:00:34

      Average standard deviation of split frequencies: 0.007183

      430500 -- (-586.235) (-587.670) [-593.908] (-587.788) * [-588.079] (-587.597) (-586.551) (-586.901) -- 0:00:34
      431000 -- (-587.865) (-589.310) [-589.674] (-586.659) * (-587.712) [-588.971] (-587.372) (-587.497) -- 0:00:34
      431500 -- (-591.321) [-588.429] (-593.081) (-586.983) * [-586.942] (-588.846) (-593.094) (-588.768) -- 0:00:34
      432000 -- (-592.372) (-587.391) (-590.474) [-587.928] * (-586.658) (-590.554) (-589.923) [-589.877] -- 0:00:34
      432500 -- (-591.900) (-588.602) [-589.629] (-587.907) * [-586.798] (-586.679) (-589.135) (-589.663) -- 0:00:34
      433000 -- (-587.307) (-588.918) (-589.198) [-593.320] * [-586.472] (-587.182) (-591.094) (-587.955) -- 0:00:34
      433500 -- (-590.764) [-592.268] (-587.448) (-587.726) * [-587.600] (-588.428) (-589.830) (-591.971) -- 0:00:33
      434000 -- [-588.386] (-588.221) (-590.898) (-589.373) * (-588.240) [-587.114] (-587.479) (-589.428) -- 0:00:33
      434500 -- (-586.992) (-587.234) (-587.339) [-587.495] * (-587.726) (-587.415) [-588.549] (-588.457) -- 0:00:33
      435000 -- [-587.020] (-587.763) (-586.976) (-591.746) * [-587.715] (-587.879) (-590.594) (-587.206) -- 0:00:33

      Average standard deviation of split frequencies: 0.008041

      435500 -- (-588.339) (-591.508) (-587.048) [-592.728] * (-587.177) (-588.415) [-587.571] (-588.489) -- 0:00:33
      436000 -- (-593.613) (-592.424) [-589.001] (-590.293) * (-589.893) (-587.311) (-589.686) [-587.549] -- 0:00:33
      436500 -- [-587.065] (-587.674) (-589.395) (-590.309) * (-588.078) (-589.704) (-590.321) [-586.411] -- 0:00:34
      437000 -- [-588.247] (-588.745) (-591.064) (-592.126) * (-589.976) [-587.339] (-589.257) (-592.915) -- 0:00:34
      437500 -- (-588.284) (-588.445) (-591.374) [-587.824] * (-587.648) (-590.880) (-586.978) [-587.799] -- 0:00:34
      438000 -- [-586.273] (-589.415) (-588.671) (-588.274) * (-586.599) (-590.277) [-588.305] (-589.105) -- 0:00:34
      438500 -- (-588.341) (-589.551) [-588.626] (-587.789) * (-587.037) (-586.873) (-591.464) [-587.213] -- 0:00:34
      439000 -- (-591.493) [-587.665] (-590.927) (-586.954) * (-587.831) (-588.290) [-588.350] (-588.087) -- 0:00:34
      439500 -- (-587.827) (-591.147) (-588.924) [-589.875] * (-591.239) [-589.429] (-590.525) (-587.850) -- 0:00:34
      440000 -- [-591.892] (-587.532) (-590.386) (-587.284) * (-586.659) (-591.888) [-588.445] (-587.472) -- 0:00:34

      Average standard deviation of split frequencies: 0.008625

      440500 -- (-587.326) [-587.898] (-586.955) (-587.657) * (-586.212) (-591.907) (-588.511) [-587.860] -- 0:00:34
      441000 -- (-588.613) (-588.650) (-587.303) [-589.694] * (-588.422) (-590.029) [-589.559] (-587.306) -- 0:00:34
      441500 -- (-590.576) [-587.200] (-586.692) (-588.698) * [-587.532] (-589.856) (-590.588) (-595.259) -- 0:00:34
      442000 -- [-587.035] (-587.432) (-586.970) (-589.600) * (-586.942) [-587.706] (-586.548) (-587.066) -- 0:00:34
      442500 -- (-587.602) (-588.288) (-587.246) [-589.544] * (-588.671) (-589.408) (-590.501) [-588.289] -- 0:00:34
      443000 -- (-590.918) [-588.083] (-587.110) (-590.340) * (-587.075) (-589.799) (-595.636) [-586.266] -- 0:00:33
      443500 -- (-587.936) (-589.120) [-589.167] (-587.769) * (-586.311) [-589.127] (-588.713) (-588.145) -- 0:00:33
      444000 -- (-588.168) [-587.555] (-587.761) (-588.013) * [-590.362] (-589.150) (-589.489) (-587.501) -- 0:00:33
      444500 -- [-588.465] (-587.712) (-587.944) (-590.312) * (-588.427) (-590.647) [-587.669] (-587.004) -- 0:00:33
      445000 -- (-586.900) (-587.785) (-589.091) [-591.278] * [-589.209] (-590.112) (-588.377) (-588.500) -- 0:00:33

      Average standard deviation of split frequencies: 0.008949

      445500 -- [-586.395] (-590.979) (-589.487) (-589.922) * (-587.483) (-588.343) (-587.691) [-587.112] -- 0:00:33
      446000 -- (-596.780) (-587.569) [-587.837] (-590.123) * [-587.577] (-588.749) (-588.087) (-588.827) -- 0:00:33
      446500 -- (-588.911) (-587.375) (-589.956) [-587.387] * (-589.571) (-591.768) (-587.126) [-587.102] -- 0:00:33
      447000 -- [-587.470] (-589.080) (-587.350) (-590.575) * (-589.060) [-587.962] (-587.903) (-588.594) -- 0:00:33
      447500 -- [-590.350] (-592.498) (-588.564) (-588.166) * (-589.272) (-589.376) [-587.408] (-588.534) -- 0:00:33
      448000 -- (-588.053) (-588.301) [-586.546] (-591.710) * [-589.272] (-592.599) (-588.509) (-587.894) -- 0:00:33
      448500 -- (-587.265) (-586.945) (-587.384) [-588.071] * (-588.587) (-586.673) [-589.108] (-588.508) -- 0:00:33
      449000 -- (-588.005) [-586.680] (-586.559) (-589.253) * (-589.189) (-588.574) [-587.757] (-588.623) -- 0:00:33
      449500 -- [-587.295] (-587.247) (-587.622) (-586.819) * (-587.887) [-588.043] (-586.875) (-588.869) -- 0:00:33
      450000 -- (-587.259) [-589.567] (-586.380) (-590.052) * (-587.925) [-590.022] (-590.225) (-589.817) -- 0:00:33

      Average standard deviation of split frequencies: 0.010181

      450500 -- (-589.322) [-587.678] (-586.321) (-588.130) * (-589.256) (-587.547) (-591.876) [-587.146] -- 0:00:32
      451000 -- [-587.945] (-589.212) (-587.705) (-587.695) * (-587.895) [-588.173] (-587.844) (-590.401) -- 0:00:32
      451500 -- (-587.603) (-590.975) [-586.621] (-587.936) * (-588.624) [-588.042] (-588.399) (-590.242) -- 0:00:32
      452000 -- (-591.024) (-587.950) [-589.747] (-587.321) * [-589.897] (-590.829) (-588.639) (-590.169) -- 0:00:32
      452500 -- [-588.234] (-594.260) (-590.474) (-588.824) * (-588.378) (-589.051) (-587.208) [-589.673] -- 0:00:32
      453000 -- [-591.300] (-592.173) (-590.541) (-587.481) * (-590.529) [-586.775] (-587.818) (-591.364) -- 0:00:32
      453500 -- (-589.243) (-586.396) (-590.374) [-586.945] * (-586.887) [-586.726] (-590.934) (-591.611) -- 0:00:33
      454000 -- [-589.449] (-588.824) (-586.275) (-588.970) * [-588.105] (-587.759) (-587.255) (-589.616) -- 0:00:33
      454500 -- (-590.386) (-592.651) [-586.414] (-587.231) * [-591.698] (-587.680) (-587.499) (-587.073) -- 0:00:33
      455000 -- (-588.907) [-588.577] (-586.390) (-586.549) * (-587.773) [-587.993] (-589.401) (-588.014) -- 0:00:33

      Average standard deviation of split frequencies: 0.009718

      455500 -- [-586.981] (-588.077) (-588.840) (-586.487) * (-587.221) (-587.645) [-587.394] (-588.161) -- 0:00:33
      456000 -- [-589.240] (-588.416) (-587.631) (-590.295) * (-587.962) [-588.992] (-588.912) (-588.176) -- 0:00:33
      456500 -- (-586.659) [-589.902] (-587.702) (-590.379) * (-591.489) (-588.099) [-587.586] (-588.046) -- 0:00:33
      457000 -- (-588.069) [-587.736] (-587.989) (-589.477) * (-588.385) (-588.355) (-588.746) [-586.836] -- 0:00:33
      457500 -- (-587.365) (-588.387) (-589.603) [-587.143] * [-591.039] (-586.261) (-589.236) (-589.832) -- 0:00:33
      458000 -- [-586.971] (-586.850) (-588.445) (-587.543) * [-587.591] (-589.164) (-587.199) (-587.068) -- 0:00:33
      458500 -- [-586.403] (-586.981) (-587.483) (-588.932) * (-587.323) [-588.018] (-593.263) (-586.350) -- 0:00:33
      459000 -- [-586.361] (-591.049) (-589.471) (-588.770) * (-588.572) [-586.797] (-587.642) (-587.132) -- 0:00:33
      459500 -- (-588.106) (-587.822) [-590.842] (-589.292) * (-589.750) (-595.055) (-589.795) [-587.540] -- 0:00:32
      460000 -- (-589.965) (-591.297) (-591.083) [-586.833] * (-590.086) (-588.085) (-587.839) [-590.146] -- 0:00:32

      Average standard deviation of split frequencies: 0.009892

      460500 -- [-588.297] (-592.727) (-587.710) (-589.071) * [-590.953] (-590.816) (-588.831) (-588.483) -- 0:00:32
      461000 -- (-589.439) (-590.513) [-588.578] (-587.008) * (-588.113) [-589.954] (-590.100) (-588.249) -- 0:00:32
      461500 -- [-592.361] (-586.554) (-588.389) (-592.734) * (-587.631) (-589.920) (-590.275) [-588.866] -- 0:00:32
      462000 -- (-588.848) [-588.917] (-588.218) (-586.371) * [-588.603] (-588.014) (-589.261) (-586.242) -- 0:00:32
      462500 -- (-586.658) [-586.931] (-587.760) (-587.675) * (-589.087) [-590.484] (-587.614) (-588.307) -- 0:00:32
      463000 -- [-586.806] (-590.044) (-588.227) (-588.997) * (-589.054) (-587.223) (-589.507) [-587.248] -- 0:00:32
      463500 -- [-588.961] (-586.884) (-588.226) (-588.257) * (-587.257) (-588.205) [-588.485] (-588.413) -- 0:00:32
      464000 -- (-589.841) (-588.090) (-588.400) [-587.892] * (-590.479) (-590.277) [-587.166] (-589.727) -- 0:00:32
      464500 -- (-592.135) (-588.092) (-590.408) [-587.333] * (-591.376) (-592.066) (-589.031) [-589.324] -- 0:00:32
      465000 -- [-588.764] (-587.234) (-587.761) (-587.148) * [-587.833] (-587.621) (-591.135) (-587.285) -- 0:00:32

      Average standard deviation of split frequencies: 0.009644

      465500 -- (-586.429) (-587.279) (-587.510) [-589.114] * (-587.329) (-587.281) [-589.046] (-589.570) -- 0:00:32
      466000 -- (-587.886) (-590.917) (-588.740) [-591.474] * (-587.082) (-587.603) [-590.324] (-591.788) -- 0:00:32
      466500 -- (-587.945) [-589.902] (-588.067) (-587.393) * (-587.492) (-586.815) [-587.673] (-587.986) -- 0:00:32
      467000 -- (-589.649) [-591.158] (-589.327) (-587.745) * [-591.195] (-587.881) (-588.853) (-592.150) -- 0:00:31
      467500 -- (-587.960) (-588.195) (-586.653) [-587.576] * (-590.401) [-591.168] (-586.925) (-592.576) -- 0:00:31
      468000 -- (-587.614) (-591.181) (-587.089) [-588.377] * (-588.982) [-588.620] (-588.013) (-589.499) -- 0:00:31
      468500 -- (-591.130) (-588.074) [-586.388] (-587.478) * (-589.684) (-590.868) (-587.927) [-587.698] -- 0:00:31
      469000 -- (-590.120) [-587.069] (-590.384) (-589.726) * [-591.624] (-591.157) (-590.824) (-594.632) -- 0:00:31
      469500 -- (-591.487) (-587.548) (-587.478) [-588.205] * (-588.862) (-586.511) (-587.544) [-590.215] -- 0:00:31
      470000 -- (-588.693) (-586.379) (-589.726) [-589.030] * [-588.196] (-589.665) (-589.678) (-588.194) -- 0:00:31

      Average standard deviation of split frequencies: 0.010149

      470500 -- [-591.479] (-586.531) (-592.583) (-589.243) * (-590.547) [-588.498] (-587.421) (-590.028) -- 0:00:32
      471000 -- (-593.911) [-586.611] (-589.204) (-587.498) * (-590.613) [-589.170] (-589.260) (-588.995) -- 0:00:32
      471500 -- [-589.987] (-589.288) (-588.421) (-589.491) * (-588.677) (-590.270) (-586.568) [-589.585] -- 0:00:32
      472000 -- (-590.086) (-588.829) [-587.455] (-586.221) * (-587.931) (-587.566) (-590.349) [-591.548] -- 0:00:32
      472500 -- [-587.377] (-590.231) (-587.803) (-590.702) * (-586.940) [-592.084] (-591.322) (-587.824) -- 0:00:32
      473000 -- (-587.301) [-587.385] (-588.048) (-595.179) * (-586.968) [-589.056] (-589.551) (-588.445) -- 0:00:32
      473500 -- (-587.223) (-587.490) (-587.476) [-588.760] * (-588.634) [-587.565] (-591.833) (-587.533) -- 0:00:32
      474000 -- (-588.599) (-587.118) [-586.506] (-587.534) * (-589.176) [-588.670] (-589.462) (-588.313) -- 0:00:32
      474500 -- (-588.029) (-588.500) (-589.691) [-587.756] * [-591.020] (-588.784) (-592.294) (-587.613) -- 0:00:32
      475000 -- (-590.952) (-593.101) (-588.849) [-586.146] * [-587.373] (-589.664) (-589.972) (-589.493) -- 0:00:32

      Average standard deviation of split frequencies: 0.010432

      475500 -- (-587.762) (-589.506) [-588.341] (-587.506) * (-589.444) (-589.228) (-589.021) [-590.901] -- 0:00:31
      476000 -- (-587.181) (-588.226) [-586.712] (-588.710) * (-588.165) [-590.497] (-588.489) (-587.782) -- 0:00:31
      476500 -- (-594.451) [-588.319] (-586.911) (-587.539) * (-586.652) (-589.149) [-589.110] (-590.629) -- 0:00:31
      477000 -- (-589.811) [-588.077] (-586.480) (-588.587) * [-586.620] (-587.200) (-587.970) (-587.218) -- 0:00:31
      477500 -- (-588.595) (-588.963) (-587.484) [-589.705] * (-586.829) (-587.311) (-588.392) [-587.107] -- 0:00:31
      478000 -- (-588.156) (-590.220) (-587.406) [-587.961] * (-587.149) (-586.842) [-586.287] (-587.661) -- 0:00:31
      478500 -- [-586.685] (-586.927) (-591.919) (-588.445) * (-589.354) [-588.700] (-589.765) (-587.182) -- 0:00:31
      479000 -- (-586.686) [-587.093] (-588.686) (-587.091) * (-589.985) (-587.596) (-590.490) [-588.058] -- 0:00:31
      479500 -- [-586.739] (-587.816) (-588.809) (-588.889) * (-586.830) (-587.536) [-589.623] (-587.640) -- 0:00:31
      480000 -- (-589.165) (-587.865) (-588.625) [-591.995] * (-586.375) [-589.252] (-587.254) (-588.250) -- 0:00:31

      Average standard deviation of split frequencies: 0.009284

      480500 -- (-586.726) (-587.564) [-586.567] (-589.326) * (-586.934) (-588.097) [-587.930] (-589.385) -- 0:00:31
      481000 -- (-586.903) [-588.250] (-588.417) (-587.793) * [-590.571] (-588.517) (-590.237) (-589.677) -- 0:00:31
      481500 -- (-591.274) (-588.835) (-588.050) [-587.770] * (-587.527) (-587.611) (-587.335) [-588.410] -- 0:00:31
      482000 -- (-587.819) (-587.989) [-587.375] (-591.646) * (-589.589) (-586.612) (-587.690) [-587.583] -- 0:00:31
      482500 -- [-588.906] (-587.847) (-589.092) (-587.664) * (-588.426) (-588.440) [-589.778] (-590.577) -- 0:00:31
      483000 -- [-587.599] (-592.013) (-589.510) (-589.408) * [-587.697] (-588.373) (-590.184) (-593.791) -- 0:00:31
      483500 -- (-589.183) (-587.114) [-587.387] (-588.144) * (-587.767) [-586.626] (-590.237) (-588.519) -- 0:00:30
      484000 -- (-586.566) (-586.980) (-587.592) [-589.741] * (-591.150) [-588.873] (-587.864) (-588.445) -- 0:00:30
      484500 -- (-588.221) [-586.595] (-587.134) (-588.495) * (-587.238) (-589.112) (-589.197) [-587.070] -- 0:00:30
      485000 -- [-586.903] (-587.741) (-593.015) (-587.997) * (-587.975) [-587.776] (-588.527) (-586.962) -- 0:00:30

      Average standard deviation of split frequencies: 0.009635

      485500 -- (-586.349) (-587.298) [-587.748] (-591.268) * (-592.453) [-589.149] (-589.286) (-587.785) -- 0:00:30
      486000 -- (-590.230) (-588.540) (-587.694) [-588.816] * [-589.594] (-591.817) (-590.281) (-588.456) -- 0:00:30
      486500 -- [-588.037] (-589.386) (-590.037) (-587.807) * (-587.773) (-589.099) [-588.491] (-591.039) -- 0:00:30
      487000 -- (-588.209) [-587.098] (-588.555) (-589.309) * (-588.051) [-587.544] (-589.703) (-587.312) -- 0:00:31
      487500 -- (-587.267) (-588.015) [-586.226] (-591.879) * [-588.995] (-589.788) (-588.256) (-589.831) -- 0:00:31
      488000 -- (-591.917) (-590.225) (-587.634) [-588.747] * (-587.544) (-589.655) (-591.339) [-587.944] -- 0:00:31
      488500 -- [-588.212] (-587.974) (-588.094) (-591.981) * (-589.644) [-588.222] (-591.183) (-587.824) -- 0:00:31
      489000 -- (-587.321) (-589.193) (-590.308) [-592.745] * (-588.659) [-586.817] (-593.368) (-591.810) -- 0:00:31
      489500 -- (-586.595) [-589.868] (-587.956) (-587.711) * [-586.645] (-588.057) (-588.367) (-588.142) -- 0:00:31
      490000 -- [-587.169] (-588.290) (-590.148) (-587.195) * (-592.894) (-587.434) (-589.938) [-588.102] -- 0:00:31

      Average standard deviation of split frequencies: 0.009928

      490500 -- (-586.763) (-587.607) (-588.544) [-586.893] * (-593.810) (-588.645) [-587.836] (-588.931) -- 0:00:31
      491000 -- [-586.676] (-587.536) (-587.369) (-590.847) * (-590.508) [-588.888] (-586.920) (-587.647) -- 0:00:31
      491500 -- (-598.881) (-587.509) (-587.410) [-588.094] * (-592.197) [-587.298] (-587.901) (-592.466) -- 0:00:31
      492000 -- (-587.512) [-587.187] (-588.658) (-589.055) * (-587.777) (-589.338) (-589.640) [-587.074] -- 0:00:30
      492500 -- (-589.567) (-587.864) [-588.324] (-587.687) * (-590.516) (-588.820) [-589.038] (-590.691) -- 0:00:30
      493000 -- (-589.929) [-588.511] (-586.688) (-590.681) * (-592.115) [-589.177] (-591.676) (-588.293) -- 0:00:30
      493500 -- (-589.344) (-586.575) (-588.850) [-588.896] * [-587.729] (-588.098) (-590.950) (-587.715) -- 0:00:30
      494000 -- (-588.177) (-586.908) [-587.508] (-590.702) * (-595.281) (-588.396) [-592.120] (-588.368) -- 0:00:30
      494500 -- (-588.240) (-587.146) (-587.436) [-587.362] * (-589.225) (-588.013) (-592.294) [-589.884] -- 0:00:30
      495000 -- (-586.605) [-586.986] (-587.757) (-587.889) * (-588.475) [-586.609] (-586.896) (-592.793) -- 0:00:30

      Average standard deviation of split frequencies: 0.010201

      495500 -- (-591.512) [-588.491] (-588.295) (-586.982) * (-587.765) [-586.545] (-589.258) (-592.387) -- 0:00:30
      496000 -- (-588.843) [-587.391] (-589.771) (-586.674) * [-586.919] (-588.081) (-587.842) (-588.573) -- 0:00:30
      496500 -- (-591.856) [-586.468] (-592.969) (-592.115) * (-587.694) [-590.196] (-590.291) (-588.269) -- 0:00:30
      497000 -- (-587.970) (-586.665) (-588.932) [-587.826] * (-588.926) (-589.358) (-590.687) [-589.721] -- 0:00:30
      497500 -- (-587.014) (-586.555) [-587.420] (-592.151) * (-589.716) (-589.299) [-587.288] (-594.817) -- 0:00:30
      498000 -- (-589.334) (-589.029) (-587.535) [-590.332] * (-591.663) [-588.469] (-586.089) (-591.658) -- 0:00:30
      498500 -- (-586.850) [-589.173] (-588.844) (-596.537) * [-588.546] (-587.489) (-590.867) (-588.686) -- 0:00:30
      499000 -- (-588.230) [-587.594] (-590.370) (-595.105) * (-591.299) (-586.441) [-588.371] (-587.553) -- 0:00:30
      499500 -- (-589.077) (-589.124) [-593.776] (-587.653) * (-598.454) (-586.433) (-588.884) [-588.576] -- 0:00:30
      500000 -- (-589.429) [-589.306] (-587.024) (-587.602) * (-586.540) (-590.205) (-588.471) [-588.645] -- 0:00:30

      Average standard deviation of split frequencies: 0.010734

      500500 -- (-587.413) (-589.155) (-589.651) [-588.750] * (-587.963) [-589.045] (-588.419) (-590.117) -- 0:00:29
      501000 -- (-586.980) [-591.776] (-590.985) (-589.092) * [-587.960] (-588.825) (-587.363) (-588.275) -- 0:00:29
      501500 -- (-589.488) [-589.170] (-590.261) (-588.481) * (-587.610) (-588.109) (-589.181) [-588.843] -- 0:00:29
      502000 -- (-588.989) [-589.271] (-590.071) (-587.839) * [-593.275] (-588.667) (-589.577) (-587.738) -- 0:00:29
      502500 -- (-587.295) [-588.992] (-587.656) (-586.868) * (-594.669) (-590.820) (-590.891) [-587.208] -- 0:00:29
      503000 -- (-588.542) [-587.297] (-592.476) (-587.167) * (-591.181) (-592.574) (-587.786) [-586.563] -- 0:00:29
      503500 -- [-588.466] (-589.474) (-594.934) (-587.008) * (-588.149) [-588.593] (-588.630) (-591.009) -- 0:00:30
      504000 -- (-589.778) [-588.622] (-589.662) (-588.409) * (-589.288) (-588.344) (-588.252) [-592.229] -- 0:00:30
      504500 -- (-587.251) [-589.111] (-589.286) (-587.486) * (-586.757) (-587.358) (-588.052) [-586.472] -- 0:00:30
      505000 -- (-588.720) [-590.781] (-588.512) (-588.674) * (-588.745) (-587.011) (-588.666) [-586.906] -- 0:00:30

      Average standard deviation of split frequencies: 0.011428

      505500 -- (-590.913) (-586.719) [-588.018] (-586.955) * (-587.582) [-588.755] (-589.036) (-586.599) -- 0:00:30
      506000 -- (-588.231) [-589.289] (-588.202) (-587.679) * (-588.502) (-592.116) (-588.014) [-589.359] -- 0:00:30
      506500 -- [-589.352] (-590.232) (-587.966) (-588.500) * (-588.585) (-586.695) (-588.044) [-587.799] -- 0:00:30
      507000 -- (-589.694) (-589.984) (-587.328) [-586.779] * (-587.789) (-586.279) [-588.674] (-589.165) -- 0:00:30
      507500 -- [-588.800] (-589.295) (-590.516) (-589.861) * (-586.617) (-590.748) [-588.693] (-590.851) -- 0:00:30
      508000 -- (-589.925) [-588.655] (-587.373) (-592.789) * [-589.651] (-589.648) (-587.622) (-588.997) -- 0:00:30
      508500 -- (-588.511) [-588.028] (-586.870) (-588.400) * (-590.198) (-591.073) (-592.468) [-589.756] -- 0:00:29
      509000 -- [-588.642] (-589.644) (-586.268) (-589.763) * (-586.990) [-587.332] (-589.745) (-588.299) -- 0:00:29
      509500 -- (-586.469) (-591.846) (-588.191) [-592.534] * (-587.499) (-586.518) (-587.468) [-592.530] -- 0:00:29
      510000 -- (-586.864) (-589.872) [-586.630] (-591.816) * (-587.333) (-587.879) [-589.915] (-587.479) -- 0:00:29

      Average standard deviation of split frequencies: 0.011200

      510500 -- [-587.400] (-590.056) (-587.005) (-593.233) * (-587.007) (-587.228) [-589.437] (-588.112) -- 0:00:29
      511000 -- (-587.198) [-592.749] (-588.838) (-591.758) * (-596.804) [-590.077] (-591.280) (-590.584) -- 0:00:29
      511500 -- (-587.372) [-589.406] (-591.436) (-597.072) * [-588.651] (-588.786) (-586.684) (-588.785) -- 0:00:29
      512000 -- (-587.967) (-590.785) (-590.053) [-590.526] * (-587.495) (-591.053) [-588.012] (-590.404) -- 0:00:29
      512500 -- (-588.605) (-590.677) [-590.868] (-588.190) * [-587.752] (-594.990) (-590.483) (-589.038) -- 0:00:29
      513000 -- [-588.312] (-588.376) (-589.317) (-588.387) * (-587.507) (-587.706) [-590.898] (-587.756) -- 0:00:29
      513500 -- (-589.026) [-587.646] (-592.534) (-588.580) * (-587.849) [-589.666] (-587.028) (-587.413) -- 0:00:29
      514000 -- (-587.849) (-587.741) [-589.221] (-586.555) * [-586.942] (-591.283) (-590.423) (-594.783) -- 0:00:29
      514500 -- (-587.564) (-588.492) [-592.104] (-588.580) * [-588.721] (-587.416) (-590.377) (-588.545) -- 0:00:29
      515000 -- [-589.728] (-589.008) (-587.511) (-587.058) * [-588.055] (-586.947) (-591.126) (-587.087) -- 0:00:29

      Average standard deviation of split frequencies: 0.010780

      515500 -- (-592.164) [-590.429] (-589.315) (-588.004) * (-590.058) (-587.454) (-589.091) [-591.670] -- 0:00:29
      516000 -- (-589.644) [-589.536] (-588.901) (-587.010) * (-587.555) (-588.568) (-587.554) [-588.739] -- 0:00:29
      516500 -- (-587.243) (-586.104) (-587.888) [-590.546] * (-586.953) [-586.642] (-587.462) (-589.305) -- 0:00:29
      517000 -- [-586.370] (-590.699) (-591.535) (-590.020) * (-587.585) [-586.597] (-586.343) (-587.559) -- 0:00:28
      517500 -- [-587.393] (-587.566) (-587.752) (-591.192) * (-589.574) [-586.838] (-586.706) (-586.292) -- 0:00:28
      518000 -- [-589.277] (-587.947) (-592.017) (-588.103) * (-590.085) (-591.069) [-586.529] (-587.231) -- 0:00:28
      518500 -- (-586.749) (-587.610) (-588.011) [-588.312] * (-589.853) (-590.163) (-586.418) [-590.049] -- 0:00:28
      519000 -- (-587.382) [-586.647] (-587.174) (-587.470) * (-595.098) (-594.156) (-589.548) [-589.973] -- 0:00:28
      519500 -- (-587.453) [-588.396] (-590.807) (-591.630) * (-590.896) (-590.206) (-587.951) [-587.669] -- 0:00:28
      520000 -- (-589.281) (-587.932) [-587.502] (-588.884) * (-588.044) (-590.388) (-587.510) [-589.097] -- 0:00:28

      Average standard deviation of split frequencies: 0.010804

      520500 -- (-588.446) [-587.320] (-587.048) (-589.303) * (-587.826) (-587.631) [-587.972] (-589.437) -- 0:00:29
      521000 -- (-586.750) (-587.449) [-588.957] (-589.248) * (-587.224) (-594.449) [-588.547] (-586.685) -- 0:00:29
      521500 -- (-589.392) [-588.211] (-589.707) (-592.723) * (-587.715) (-589.049) [-589.960] (-586.543) -- 0:00:29
      522000 -- (-588.449) (-588.481) [-588.292] (-590.249) * (-593.436) [-586.797] (-588.761) (-586.629) -- 0:00:29
      522500 -- (-588.630) [-587.181] (-586.480) (-587.878) * (-588.144) (-587.899) (-588.082) [-586.196] -- 0:00:29
      523000 -- [-587.757] (-588.022) (-586.740) (-587.627) * [-588.311] (-594.312) (-589.450) (-587.557) -- 0:00:29
      523500 -- [-587.687] (-587.769) (-588.273) (-591.892) * (-588.268) (-587.998) [-590.668] (-587.015) -- 0:00:29
      524000 -- (-588.003) (-586.965) [-587.058] (-586.919) * (-586.628) [-586.268] (-588.343) (-586.992) -- 0:00:29
      524500 -- [-587.086] (-586.351) (-587.350) (-588.863) * (-588.311) (-589.196) [-587.809] (-591.736) -- 0:00:29
      525000 -- [-587.719] (-586.714) (-586.612) (-590.456) * (-589.250) [-588.998] (-589.685) (-591.496) -- 0:00:28

      Average standard deviation of split frequencies: 0.010993

      525500 -- (-587.604) (-588.299) (-589.201) [-586.738] * [-590.283] (-591.863) (-590.407) (-590.296) -- 0:00:28
      526000 -- [-588.181] (-590.903) (-587.279) (-589.513) * (-588.585) [-591.728] (-586.896) (-588.766) -- 0:00:28
      526500 -- (-588.398) [-587.406] (-590.127) (-589.471) * (-588.492) [-586.374] (-588.174) (-588.995) -- 0:00:28
      527000 -- (-586.941) (-592.658) (-588.615) [-589.111] * (-589.363) (-588.144) [-587.880] (-586.890) -- 0:00:28
      527500 -- (-586.793) [-588.982] (-587.738) (-591.155) * (-589.598) (-588.518) [-587.921] (-587.126) -- 0:00:28
      528000 -- (-587.162) (-586.155) (-588.115) [-590.432] * [-590.095] (-587.337) (-588.039) (-588.456) -- 0:00:28
      528500 -- (-590.436) (-587.569) [-589.481] (-587.905) * (-590.436) (-589.143) (-588.883) [-588.531] -- 0:00:28
      529000 -- (-587.907) (-590.091) [-590.785] (-591.727) * (-591.283) (-589.719) (-589.908) [-590.109] -- 0:00:28
      529500 -- [-587.372] (-587.082) (-589.476) (-590.536) * [-594.624] (-589.347) (-591.158) (-592.242) -- 0:00:28
      530000 -- (-587.158) (-588.603) [-587.453] (-587.117) * (-587.735) [-587.589] (-587.148) (-588.531) -- 0:00:28

      Average standard deviation of split frequencies: 0.010423

      530500 -- (-589.491) [-588.869] (-591.022) (-587.118) * (-588.473) (-588.233) [-587.591] (-588.843) -- 0:00:28
      531000 -- (-591.945) [-588.443] (-586.993) (-587.154) * (-592.540) [-586.975] (-586.635) (-589.955) -- 0:00:28
      531500 -- (-587.745) [-588.245] (-587.891) (-598.318) * (-590.430) (-587.007) (-588.796) [-589.074] -- 0:00:28
      532000 -- (-590.494) (-589.788) [-586.430] (-589.032) * (-587.748) (-589.936) (-591.607) [-588.365] -- 0:00:28
      532500 -- (-587.963) [-588.463] (-586.435) (-587.191) * (-589.143) (-593.018) [-589.205] (-588.680) -- 0:00:28
      533000 -- (-589.063) (-587.977) [-586.320] (-587.402) * (-588.704) (-589.182) [-589.633] (-589.230) -- 0:00:28
      533500 -- (-589.161) [-588.354] (-589.112) (-587.699) * (-587.592) (-589.696) (-588.104) [-587.717] -- 0:00:27
      534000 -- (-587.112) [-588.979] (-588.859) (-590.626) * (-586.719) [-588.455] (-589.283) (-587.995) -- 0:00:27
      534500 -- (-590.850) (-587.918) (-588.308) [-586.481] * (-588.472) (-589.008) (-588.575) [-587.295] -- 0:00:27
      535000 -- (-588.139) (-587.461) (-591.625) [-586.990] * (-588.532) (-588.802) (-593.572) [-586.215] -- 0:00:27

      Average standard deviation of split frequencies: 0.010730

      535500 -- [-590.510] (-587.432) (-587.033) (-590.638) * (-588.513) (-587.689) [-587.057] (-587.663) -- 0:00:27
      536000 -- [-586.720] (-586.960) (-587.814) (-588.723) * [-591.298] (-590.208) (-589.610) (-587.555) -- 0:00:27
      536500 -- (-588.989) [-587.809] (-587.077) (-589.210) * [-587.108] (-587.602) (-586.576) (-590.092) -- 0:00:27
      537000 -- [-589.711] (-590.844) (-588.089) (-592.613) * [-587.330] (-586.985) (-586.771) (-589.311) -- 0:00:28
      537500 -- (-588.497) (-589.597) (-587.353) [-588.207] * (-590.705) [-588.294] (-591.566) (-589.432) -- 0:00:28
      538000 -- [-586.977] (-589.037) (-588.068) (-586.502) * (-589.185) (-587.782) (-586.719) [-590.382] -- 0:00:28
      538500 -- [-586.861] (-590.720) (-588.512) (-587.948) * (-589.630) [-588.375] (-589.944) (-588.408) -- 0:00:28
      539000 -- [-587.994] (-591.796) (-588.301) (-592.116) * (-589.273) (-587.375) [-589.395] (-587.709) -- 0:00:28
      539500 -- (-589.022) (-589.262) (-588.170) [-590.228] * (-588.944) [-588.098] (-590.593) (-586.288) -- 0:00:28
      540000 -- [-592.452] (-589.590) (-586.571) (-587.194) * (-590.929) [-586.539] (-591.509) (-586.261) -- 0:00:28

      Average standard deviation of split frequencies: 0.010637

      540500 -- (-588.348) (-587.312) [-589.584] (-590.036) * [-586.344] (-587.185) (-592.699) (-586.842) -- 0:00:28
      541000 -- [-587.592] (-587.119) (-595.198) (-587.582) * (-588.995) (-587.979) (-598.849) [-592.488] -- 0:00:27
      541500 -- (-589.565) (-588.021) (-595.611) [-586.674] * (-589.053) [-589.049] (-595.616) (-589.889) -- 0:00:27
      542000 -- [-587.442] (-589.111) (-591.476) (-588.077) * (-589.873) [-587.924] (-593.093) (-587.850) -- 0:00:27
      542500 -- (-587.822) [-587.635] (-593.555) (-587.387) * (-586.245) [-590.037] (-586.760) (-587.529) -- 0:00:27
      543000 -- (-587.849) (-588.041) (-588.637) [-586.313] * (-588.131) (-588.248) (-586.911) [-587.191] -- 0:00:27
      543500 -- [-586.582] (-587.695) (-589.952) (-589.024) * (-590.806) (-587.892) (-587.847) [-589.709] -- 0:00:27
      544000 -- (-591.035) [-588.931] (-588.381) (-587.502) * (-587.905) (-588.113) [-587.917] (-589.781) -- 0:00:27
      544500 -- (-590.437) (-590.559) (-587.598) [-587.676] * (-586.917) (-588.271) (-590.943) [-588.304] -- 0:00:27
      545000 -- (-590.921) (-591.231) [-589.290] (-589.969) * (-591.044) [-589.471] (-589.832) (-590.575) -- 0:00:27

      Average standard deviation of split frequencies: 0.010015

      545500 -- (-587.201) (-589.036) [-588.904] (-588.516) * (-593.572) [-590.204] (-589.998) (-591.395) -- 0:00:27
      546000 -- (-593.451) (-590.416) (-587.869) [-587.366] * (-589.236) (-589.076) [-586.776] (-589.098) -- 0:00:27
      546500 -- (-590.736) (-588.375) (-587.750) [-588.871] * (-589.339) (-592.659) [-588.678] (-589.557) -- 0:00:27
      547000 -- [-588.075] (-587.065) (-587.837) (-588.597) * (-593.505) (-588.483) [-587.086] (-588.455) -- 0:00:27
      547500 -- (-587.228) (-587.665) (-589.085) [-587.632] * (-592.320) (-588.446) [-587.567] (-589.146) -- 0:00:27
      548000 -- (-588.289) (-589.746) [-587.347] (-588.850) * [-588.563] (-590.036) (-587.074) (-587.356) -- 0:00:27
      548500 -- [-586.902] (-587.924) (-587.408) (-592.515) * (-587.313) (-586.602) [-586.853] (-587.514) -- 0:00:27
      549000 -- (-588.834) (-589.650) (-588.166) [-588.307] * (-594.796) (-588.492) (-587.654) [-587.347] -- 0:00:27
      549500 -- [-589.240] (-589.568) (-589.914) (-588.621) * [-588.693] (-591.781) (-593.022) (-587.847) -- 0:00:27
      550000 -- [-591.533] (-589.102) (-590.214) (-587.097) * (-591.603) (-588.278) [-588.074] (-590.586) -- 0:00:27

      Average standard deviation of split frequencies: 0.010501

      550500 -- (-588.637) [-588.137] (-587.452) (-589.172) * [-592.489] (-588.396) (-588.607) (-590.560) -- 0:00:26
      551000 -- (-588.578) (-590.664) [-586.842] (-594.242) * (-588.971) [-587.488] (-588.590) (-590.584) -- 0:00:26
      551500 -- [-590.032] (-588.470) (-587.061) (-587.150) * (-587.647) (-589.733) (-588.061) [-589.456] -- 0:00:26
      552000 -- (-587.091) [-588.875] (-588.265) (-590.018) * [-586.508] (-586.341) (-589.815) (-593.071) -- 0:00:26
      552500 -- [-588.325] (-589.256) (-587.408) (-591.734) * [-588.790] (-589.779) (-589.452) (-588.665) -- 0:00:26
      553000 -- [-593.265] (-587.812) (-590.089) (-586.444) * (-587.613) (-589.938) [-588.158] (-588.314) -- 0:00:26
      553500 -- (-592.139) [-588.102] (-587.712) (-586.852) * (-588.383) [-587.637] (-587.765) (-588.357) -- 0:00:26
      554000 -- (-589.242) (-586.622) [-587.834] (-591.682) * (-590.304) (-587.477) [-586.507] (-591.816) -- 0:00:27
      554500 -- [-592.509] (-593.236) (-587.912) (-589.845) * (-588.126) [-586.975] (-588.789) (-587.927) -- 0:00:27
      555000 -- (-589.124) (-588.960) (-589.475) [-587.941] * (-588.242) (-590.487) [-587.340] (-587.177) -- 0:00:27

      Average standard deviation of split frequencies: 0.010400

      555500 -- (-591.946) (-587.354) [-587.075] (-588.338) * (-591.125) [-590.150] (-586.469) (-587.615) -- 0:00:27
      556000 -- [-587.719] (-589.154) (-586.595) (-588.523) * (-591.029) [-587.118] (-588.001) (-587.106) -- 0:00:27
      556500 -- (-589.632) (-587.547) (-589.653) [-589.953] * (-590.705) (-590.950) (-587.976) [-587.044] -- 0:00:27
      557000 -- [-592.767] (-586.956) (-588.007) (-586.828) * (-593.015) (-591.166) (-591.636) [-588.058] -- 0:00:27
      557500 -- (-587.952) (-589.732) [-588.544] (-586.905) * (-587.532) (-587.887) (-586.771) [-590.521] -- 0:00:26
      558000 -- [-588.617] (-587.456) (-588.431) (-589.796) * (-589.153) (-590.570) (-588.729) [-587.566] -- 0:00:26
      558500 -- (-587.505) (-587.067) [-587.258] (-594.751) * (-587.129) [-590.739] (-589.085) (-587.894) -- 0:00:26
      559000 -- (-589.918) (-587.664) [-587.594] (-603.939) * (-586.919) (-588.709) (-588.920) [-588.276] -- 0:00:26
      559500 -- (-587.485) [-588.617] (-592.428) (-597.869) * [-588.921] (-592.090) (-587.754) (-588.187) -- 0:00:26
      560000 -- [-593.835] (-588.582) (-589.333) (-586.842) * (-588.657) (-587.134) (-587.770) [-593.190] -- 0:00:26

      Average standard deviation of split frequencies: 0.010538

      560500 -- (-591.500) (-587.825) [-588.735] (-589.033) * [-587.163] (-586.772) (-591.609) (-589.755) -- 0:00:26
      561000 -- (-588.678) (-588.525) [-588.015] (-589.919) * (-591.405) (-588.179) [-587.804] (-588.000) -- 0:00:26
      561500 -- [-587.814] (-588.188) (-587.447) (-586.547) * (-592.293) (-587.290) (-587.336) [-588.423] -- 0:00:26
      562000 -- [-589.703] (-588.186) (-588.454) (-587.674) * [-591.205] (-590.984) (-589.210) (-586.342) -- 0:00:26
      562500 -- (-590.582) [-587.028] (-589.221) (-590.017) * (-590.883) [-588.729] (-592.178) (-586.296) -- 0:00:26
      563000 -- (-589.945) (-587.734) (-586.946) [-587.236] * [-587.786] (-594.123) (-586.843) (-591.201) -- 0:00:26
      563500 -- [-588.490] (-586.881) (-588.399) (-589.789) * [-586.675] (-601.168) (-588.304) (-594.372) -- 0:00:26
      564000 -- (-589.018) [-588.610] (-590.038) (-591.619) * [-590.025] (-592.504) (-587.585) (-596.108) -- 0:00:26
      564500 -- [-586.989] (-586.832) (-588.036) (-588.809) * (-589.646) (-594.703) (-590.812) [-588.461] -- 0:00:26
      565000 -- (-587.203) [-586.605] (-586.593) (-590.481) * [-588.325] (-593.675) (-591.084) (-590.365) -- 0:00:26

      Average standard deviation of split frequencies: 0.010994

      565500 -- (-587.973) [-589.125] (-586.653) (-589.080) * (-587.307) (-589.549) (-589.788) [-587.758] -- 0:00:26
      566000 -- [-586.148] (-587.741) (-591.367) (-587.463) * (-588.843) [-588.516] (-591.922) (-589.093) -- 0:00:26
      566500 -- [-587.108] (-588.033) (-587.022) (-587.470) * (-588.591) (-586.564) (-589.370) [-588.291] -- 0:00:26
      567000 -- (-592.102) (-593.471) (-587.361) [-587.051] * (-588.418) [-587.457] (-592.339) (-587.941) -- 0:00:25
      567500 -- (-589.250) (-589.913) (-589.556) [-587.840] * (-587.415) (-587.578) (-590.543) [-586.964] -- 0:00:25
      568000 -- [-590.373] (-588.541) (-591.157) (-590.827) * (-588.518) (-587.031) [-588.663] (-588.975) -- 0:00:25
      568500 -- (-587.299) (-589.487) (-587.890) [-589.340] * (-587.880) [-586.144] (-588.655) (-586.534) -- 0:00:25
      569000 -- (-589.371) [-588.183] (-588.171) (-590.528) * (-588.755) [-587.049] (-589.343) (-590.176) -- 0:00:25
      569500 -- (-591.350) [-589.399] (-588.039) (-589.336) * [-589.038] (-587.859) (-588.760) (-587.918) -- 0:00:25
      570000 -- [-586.999] (-587.793) (-587.461) (-589.389) * (-591.310) [-590.347] (-589.691) (-586.835) -- 0:00:25

      Average standard deviation of split frequencies: 0.010904

      570500 -- (-587.490) [-587.547] (-586.770) (-589.532) * (-586.787) (-593.182) [-586.663] (-587.497) -- 0:00:25
      571000 -- [-586.782] (-594.756) (-589.830) (-587.243) * (-588.469) [-591.302] (-587.386) (-587.060) -- 0:00:26
      571500 -- [-586.791] (-592.034) (-590.214) (-586.724) * [-591.297] (-587.037) (-587.242) (-589.583) -- 0:00:26
      572000 -- (-587.142) [-588.232] (-588.498) (-586.654) * (-590.561) [-586.575] (-590.663) (-589.457) -- 0:00:26
      572500 -- (-588.659) [-587.463] (-587.277) (-590.994) * (-589.897) [-587.103] (-588.606) (-587.040) -- 0:00:26
      573000 -- (-589.663) [-586.927] (-587.886) (-587.971) * (-589.797) (-586.472) (-593.981) [-590.227] -- 0:00:26
      573500 -- (-586.827) (-589.058) (-592.830) [-586.902] * (-586.498) (-587.019) (-587.233) [-592.613] -- 0:00:26
      574000 -- [-589.563] (-588.314) (-590.502) (-586.424) * (-587.488) (-589.441) [-587.267] (-587.772) -- 0:00:25
      574500 -- (-590.451) (-586.979) (-589.034) [-586.862] * (-586.641) [-593.951] (-589.742) (-589.380) -- 0:00:25
      575000 -- (-592.615) [-587.204] (-587.009) (-587.565) * (-587.197) (-588.606) (-589.651) [-592.340] -- 0:00:25

      Average standard deviation of split frequencies: 0.011294

      575500 -- (-586.945) (-587.634) (-588.956) [-586.403] * (-586.281) (-589.905) [-587.563] (-591.069) -- 0:00:25
      576000 -- (-588.799) [-587.208] (-587.283) (-589.095) * (-588.809) [-588.991] (-587.693) (-587.151) -- 0:00:25
      576500 -- (-589.721) [-588.866] (-587.661) (-587.785) * (-588.725) (-587.058) [-590.726] (-588.946) -- 0:00:25
      577000 -- (-589.143) (-590.900) [-586.558] (-586.552) * (-587.631) (-588.254) [-588.716] (-587.060) -- 0:00:25
      577500 -- (-586.702) [-588.807] (-588.544) (-587.420) * [-588.622] (-588.483) (-587.654) (-588.022) -- 0:00:25
      578000 -- (-588.299) (-589.512) (-588.120) [-588.506] * [-586.842] (-588.058) (-589.051) (-591.798) -- 0:00:25
      578500 -- (-588.231) (-588.714) (-592.281) [-589.016] * (-590.189) (-587.437) (-586.558) [-589.507] -- 0:00:25
      579000 -- (-594.717) [-586.923] (-587.913) (-586.282) * (-590.112) (-590.222) [-587.275] (-589.019) -- 0:00:25
      579500 -- (-587.348) (-586.866) [-587.302] (-587.643) * (-589.460) (-588.390) (-590.017) [-586.611] -- 0:00:25
      580000 -- (-587.942) [-589.431] (-592.064) (-587.341) * [-588.230] (-588.757) (-588.058) (-586.420) -- 0:00:25

      Average standard deviation of split frequencies: 0.010987

      580500 -- (-589.340) (-587.591) (-588.993) [-587.438] * (-586.594) (-590.110) [-587.336] (-592.050) -- 0:00:25
      581000 -- (-587.808) [-591.792] (-588.385) (-590.012) * (-587.647) [-588.853] (-588.661) (-586.839) -- 0:00:25
      581500 -- [-588.839] (-593.147) (-587.838) (-596.226) * (-587.381) (-590.484) (-587.554) [-588.770] -- 0:00:25
      582000 -- (-587.089) (-587.015) [-590.936] (-590.156) * (-588.131) (-586.856) [-586.615] (-589.157) -- 0:00:25
      582500 -- [-587.437] (-589.184) (-589.726) (-589.522) * (-588.293) (-588.019) [-586.879] (-587.852) -- 0:00:25
      583000 -- [-589.549] (-588.360) (-589.796) (-588.797) * (-588.860) (-586.339) [-587.024] (-591.512) -- 0:00:25
      583500 -- (-589.855) [-588.119] (-587.398) (-586.154) * (-587.697) (-586.710) (-586.244) [-590.151] -- 0:00:24
      584000 -- [-591.159] (-587.859) (-587.509) (-588.389) * [-587.293] (-586.842) (-587.538) (-587.132) -- 0:00:24
      584500 -- (-588.794) (-586.819) [-587.642] (-587.438) * [-587.104] (-587.478) (-586.583) (-586.598) -- 0:00:24
      585000 -- (-588.222) [-589.439] (-589.258) (-587.247) * (-587.899) (-586.744) (-588.865) [-587.332] -- 0:00:24

      Average standard deviation of split frequencies: 0.011316

      585500 -- (-589.209) (-587.002) (-589.320) [-587.512] * (-587.863) (-590.628) [-586.881] (-588.274) -- 0:00:24
      586000 -- (-587.568) (-587.338) [-590.175] (-587.044) * (-588.930) (-590.157) [-586.458] (-589.031) -- 0:00:24
      586500 -- (-589.399) [-587.820] (-590.181) (-588.817) * (-588.198) (-587.505) [-586.871] (-588.755) -- 0:00:24
      587000 -- [-589.425] (-586.879) (-592.917) (-588.414) * (-589.121) [-586.910] (-588.376) (-590.287) -- 0:00:24
      587500 -- (-588.356) (-590.118) (-589.240) [-587.379] * (-589.404) (-587.928) [-588.282] (-586.839) -- 0:00:25
      588000 -- (-588.071) (-590.818) (-588.914) [-588.509] * [-589.885] (-590.016) (-589.292) (-587.871) -- 0:00:25
      588500 -- (-589.686) (-590.677) [-588.557] (-587.478) * (-597.887) (-589.476) (-587.722) [-588.031] -- 0:00:25
      589000 -- (-590.057) (-590.415) (-590.402) [-587.580] * [-590.613] (-588.518) (-587.731) (-586.880) -- 0:00:25
      589500 -- [-588.917] (-588.092) (-591.534) (-588.785) * (-589.519) (-592.630) (-588.470) [-588.199] -- 0:00:25
      590000 -- (-587.346) [-586.328] (-590.384) (-587.798) * (-586.646) (-588.328) (-593.237) [-588.587] -- 0:00:25

      Average standard deviation of split frequencies: 0.011652

      590500 -- (-586.615) [-588.550] (-588.780) (-587.961) * (-587.592) [-586.607] (-586.992) (-588.245) -- 0:00:24
      591000 -- [-587.292] (-589.397) (-588.236) (-589.205) * [-588.373] (-587.155) (-587.534) (-589.079) -- 0:00:24
      591500 -- (-587.494) [-587.104] (-593.767) (-590.447) * (-590.301) (-588.091) (-590.147) [-587.452] -- 0:00:24
      592000 -- [-588.467] (-591.326) (-590.121) (-590.138) * (-589.007) (-588.247) [-586.090] (-588.054) -- 0:00:24
      592500 -- (-589.220) [-588.276] (-588.700) (-588.061) * (-589.040) (-587.786) (-586.145) [-587.533] -- 0:00:24
      593000 -- [-587.100] (-590.179) (-588.828) (-587.972) * (-589.198) (-589.707) (-590.553) [-587.842] -- 0:00:24
      593500 -- (-588.717) [-587.718] (-592.084) (-587.474) * (-588.983) (-589.614) (-586.679) [-587.911] -- 0:00:24
      594000 -- (-588.669) (-589.120) [-587.459] (-589.083) * (-592.422) [-588.170] (-586.864) (-589.390) -- 0:00:24
      594500 -- (-586.511) (-589.847) (-589.205) [-587.030] * (-588.985) (-589.473) [-587.661] (-588.180) -- 0:00:24
      595000 -- (-587.559) (-588.735) (-591.815) [-586.392] * [-587.841] (-587.749) (-587.546) (-590.031) -- 0:00:24

      Average standard deviation of split frequencies: 0.011284

      595500 -- [-586.588] (-588.238) (-588.062) (-588.518) * (-590.146) (-587.645) (-588.253) [-589.349] -- 0:00:24
      596000 -- (-587.046) [-589.157] (-588.357) (-588.675) * (-589.371) [-587.436] (-587.245) (-590.479) -- 0:00:24
      596500 -- (-588.372) (-589.064) [-587.635] (-592.186) * (-588.497) [-586.317] (-594.499) (-592.062) -- 0:00:24
      597000 -- (-590.026) (-586.860) (-592.271) [-587.819] * (-586.878) [-588.964] (-596.659) (-591.604) -- 0:00:24
      597500 -- (-588.357) (-591.090) (-589.664) [-588.383] * (-589.313) [-587.080] (-586.443) (-588.188) -- 0:00:24
      598000 -- (-589.324) (-592.022) [-588.978] (-591.076) * (-586.782) (-587.467) [-587.455] (-588.026) -- 0:00:24
      598500 -- (-591.341) [-589.455] (-589.551) (-593.547) * (-590.761) (-587.811) [-587.858] (-590.020) -- 0:00:24
      599000 -- [-588.162] (-589.986) (-588.453) (-591.342) * (-587.461) (-588.945) (-591.281) [-588.808] -- 0:00:24
      599500 -- (-590.346) (-588.744) (-588.293) [-590.604] * [-588.009] (-587.100) (-589.228) (-587.601) -- 0:00:24
      600000 -- [-588.528] (-587.987) (-591.128) (-588.522) * (-587.650) (-588.752) (-589.249) [-588.918] -- 0:00:24

      Average standard deviation of split frequencies: 0.011510

      600500 -- [-587.076] (-590.337) (-586.843) (-592.757) * (-589.208) [-589.197] (-586.846) (-587.188) -- 0:00:23
      601000 -- [-586.919] (-589.157) (-586.745) (-592.089) * (-587.806) (-588.997) (-586.467) [-591.429] -- 0:00:23
      601500 -- (-587.218) [-591.417] (-589.399) (-587.342) * (-588.758) (-588.442) [-587.035] (-591.528) -- 0:00:23
      602000 -- (-588.140) (-588.809) (-591.063) [-591.310] * (-588.740) (-586.669) [-588.413] (-589.992) -- 0:00:23
      602500 -- (-587.549) (-591.552) (-588.372) [-588.621] * (-588.676) (-588.190) [-589.755] (-590.678) -- 0:00:23
      603000 -- (-587.439) (-588.201) [-591.829] (-591.407) * (-589.441) (-590.272) [-587.799] (-587.329) -- 0:00:23
      603500 -- [-590.605] (-593.498) (-586.641) (-588.216) * (-589.904) (-587.368) [-586.262] (-589.699) -- 0:00:24
      604000 -- (-587.035) [-588.886] (-588.986) (-587.920) * (-590.840) [-588.119] (-589.371) (-591.303) -- 0:00:24
      604500 -- (-589.901) [-587.351] (-589.041) (-588.634) * (-587.499) (-587.997) (-588.066) [-590.906] -- 0:00:24
      605000 -- (-588.887) (-587.190) [-588.491] (-590.603) * (-587.490) (-589.877) (-587.698) [-591.130] -- 0:00:24

      Average standard deviation of split frequencies: 0.011305

      605500 -- [-587.183] (-589.657) (-590.727) (-590.777) * [-586.269] (-589.085) (-589.420) (-587.847) -- 0:00:24
      606000 -- (-587.096) [-590.021] (-591.196) (-588.320) * (-586.411) (-587.921) (-586.856) [-589.263] -- 0:00:24
      606500 -- (-589.602) (-588.364) (-588.255) [-586.500] * (-594.026) (-589.069) [-589.681] (-589.522) -- 0:00:24
      607000 -- (-586.935) (-589.928) (-589.454) [-587.411] * [-586.733] (-588.892) (-591.305) (-586.997) -- 0:00:23
      607500 -- [-588.928] (-589.230) (-596.720) (-588.272) * [-589.367] (-589.360) (-589.359) (-589.017) -- 0:00:23
      608000 -- (-594.331) [-589.800] (-593.152) (-594.295) * (-587.177) [-587.409] (-593.851) (-591.285) -- 0:00:23
      608500 -- [-591.298] (-587.355) (-589.636) (-590.208) * (-587.069) (-588.074) [-589.022] (-588.876) -- 0:00:23
      609000 -- (-591.111) (-587.924) [-589.031] (-588.344) * (-588.256) (-588.402) (-590.138) [-587.002] -- 0:00:23
      609500 -- (-588.949) [-587.246] (-591.320) (-591.037) * (-588.042) (-589.402) (-588.855) [-588.030] -- 0:00:23
      610000 -- (-589.080) (-588.239) [-589.964] (-591.169) * (-590.497) (-589.150) [-590.422] (-590.257) -- 0:00:23

      Average standard deviation of split frequencies: 0.010859

      610500 -- [-588.366] (-588.435) (-588.000) (-588.071) * (-589.220) (-588.850) (-590.175) [-589.883] -- 0:00:23
      611000 -- [-589.257] (-587.672) (-587.494) (-587.634) * (-588.887) [-587.365] (-589.591) (-590.930) -- 0:00:23
      611500 -- [-589.167] (-589.125) (-591.108) (-591.260) * (-588.828) (-587.903) (-587.736) [-587.790] -- 0:00:23
      612000 -- [-587.466] (-589.392) (-586.957) (-591.467) * [-586.874] (-589.626) (-589.463) (-589.658) -- 0:00:23
      612500 -- (-589.591) (-588.610) (-588.585) [-588.846] * (-589.756) (-588.386) (-587.171) [-590.535] -- 0:00:23
      613000 -- (-592.328) (-590.030) (-587.124) [-588.056] * (-589.211) [-587.226] (-588.987) (-587.342) -- 0:00:23
      613500 -- (-588.630) (-587.581) [-588.307] (-588.595) * (-587.431) (-586.379) [-588.139] (-588.004) -- 0:00:23
      614000 -- [-587.155] (-588.835) (-587.201) (-591.791) * (-589.079) [-586.299] (-586.710) (-591.664) -- 0:00:23
      614500 -- [-587.296] (-593.438) (-588.486) (-588.530) * [-588.715] (-588.260) (-588.700) (-592.152) -- 0:00:23
      615000 -- (-587.486) (-589.011) [-592.217] (-590.896) * [-587.528] (-596.119) (-601.671) (-594.294) -- 0:00:23

      Average standard deviation of split frequencies: 0.010969

      615500 -- (-587.573) [-587.627] (-588.295) (-590.882) * (-586.653) (-594.114) [-590.417] (-588.772) -- 0:00:23
      616000 -- [-588.097] (-586.903) (-591.469) (-593.473) * (-589.077) (-592.874) (-587.883) [-589.598] -- 0:00:23
      616500 -- [-587.328] (-592.252) (-589.542) (-589.576) * [-589.974] (-589.395) (-588.314) (-592.393) -- 0:00:23
      617000 -- [-588.916] (-590.475) (-587.004) (-588.926) * (-587.762) [-589.508] (-587.903) (-588.500) -- 0:00:22
      617500 -- (-588.637) [-590.061] (-588.312) (-587.579) * [-588.348] (-589.888) (-587.758) (-587.598) -- 0:00:22
      618000 -- (-592.909) [-587.702] (-588.512) (-589.319) * [-587.167] (-590.637) (-586.887) (-593.838) -- 0:00:22
      618500 -- [-587.581] (-589.221) (-588.773) (-588.212) * (-588.463) (-590.458) (-587.654) [-592.605] -- 0:00:22
      619000 -- (-587.759) (-587.484) [-592.220] (-586.439) * [-589.922] (-587.600) (-590.770) (-594.339) -- 0:00:22
      619500 -- [-587.791] (-587.612) (-587.232) (-589.435) * (-589.199) [-587.464] (-590.321) (-594.333) -- 0:00:22
      620000 -- [-586.881] (-588.403) (-589.689) (-591.335) * (-586.758) (-588.623) [-589.968] (-592.246) -- 0:00:22

      Average standard deviation of split frequencies: 0.010380

      620500 -- (-587.372) [-587.856] (-587.163) (-589.454) * (-587.678) [-588.576] (-588.504) (-589.907) -- 0:00:23
      621000 -- (-587.699) (-587.802) (-589.302) [-587.470] * (-586.507) (-589.203) (-586.602) [-588.120] -- 0:00:23
      621500 -- (-593.048) (-591.656) [-587.141] (-587.505) * (-587.395) [-588.836] (-587.742) (-589.657) -- 0:00:23
      622000 -- (-592.807) (-588.307) (-586.901) [-589.662] * [-588.461] (-590.177) (-588.710) (-586.890) -- 0:00:23
      622500 -- (-586.761) [-586.917] (-588.719) (-588.209) * (-586.830) (-586.729) [-589.565] (-590.503) -- 0:00:23
      623000 -- (-586.738) (-588.964) (-588.714) [-586.427] * [-586.634] (-588.716) (-590.167) (-589.375) -- 0:00:22
      623500 -- [-589.305] (-586.965) (-592.242) (-587.218) * [-587.634] (-586.683) (-589.151) (-587.184) -- 0:00:22
      624000 -- (-587.921) [-588.596] (-588.604) (-586.520) * (-592.697) (-586.461) (-586.863) [-587.532] -- 0:00:22
      624500 -- (-587.075) (-588.212) [-590.647] (-586.147) * (-587.447) [-589.336] (-587.559) (-588.449) -- 0:00:22
      625000 -- (-589.483) [-587.326] (-588.856) (-590.950) * [-587.966] (-591.502) (-587.249) (-591.616) -- 0:00:22

      Average standard deviation of split frequencies: 0.010041

      625500 -- (-590.240) (-587.156) [-588.522] (-588.809) * [-587.523] (-588.841) (-587.257) (-587.572) -- 0:00:22
      626000 -- (-586.810) [-588.164] (-587.104) (-592.407) * [-588.919] (-591.160) (-588.016) (-590.104) -- 0:00:22
      626500 -- (-586.923) [-587.684] (-586.877) (-591.449) * (-591.661) (-587.208) [-586.913] (-590.476) -- 0:00:22
      627000 -- (-586.847) (-590.840) (-586.668) [-587.027] * (-587.180) [-587.521] (-589.099) (-589.020) -- 0:00:22
      627500 -- (-590.347) (-590.109) [-589.081] (-588.068) * (-590.095) [-587.332] (-589.539) (-589.019) -- 0:00:22
      628000 -- [-589.188] (-587.610) (-589.696) (-592.534) * [-589.068] (-587.526) (-587.025) (-591.131) -- 0:00:22
      628500 -- (-586.922) (-588.058) [-588.016] (-590.909) * (-589.417) [-587.066] (-587.934) (-593.302) -- 0:00:22
      629000 -- (-589.604) [-587.809] (-587.578) (-587.936) * [-587.546] (-587.958) (-586.968) (-587.860) -- 0:00:22
      629500 -- (-587.700) [-586.664] (-589.850) (-590.365) * (-588.693) [-587.819] (-592.647) (-586.242) -- 0:00:22
      630000 -- (-588.007) (-588.810) [-587.839] (-588.383) * (-587.564) (-588.241) (-589.343) [-589.376] -- 0:00:22

      Average standard deviation of split frequencies: 0.010016

      630500 -- (-588.381) (-588.973) [-589.049] (-590.585) * [-589.439] (-588.360) (-586.759) (-592.201) -- 0:00:22
      631000 -- (-588.279) (-587.865) (-586.596) [-588.114] * (-589.206) (-586.956) (-587.608) [-588.785] -- 0:00:22
      631500 -- (-588.229) (-587.157) [-590.077] (-589.662) * (-588.014) [-587.196] (-589.521) (-593.650) -- 0:00:22
      632000 -- (-589.752) (-588.095) [-590.001] (-588.855) * (-586.838) (-588.736) [-586.320] (-588.483) -- 0:00:22
      632500 -- (-589.565) (-586.793) (-588.465) [-587.594] * [-586.726] (-587.862) (-588.600) (-588.695) -- 0:00:22
      633000 -- (-589.395) [-586.965] (-586.911) (-590.490) * (-588.890) (-587.979) (-590.626) [-586.916] -- 0:00:22
      633500 -- (-593.446) (-587.667) (-591.013) [-587.850] * (-595.362) [-590.496] (-590.495) (-591.147) -- 0:00:21
      634000 -- (-588.459) (-587.098) [-586.311] (-592.359) * [-589.821] (-589.718) (-587.114) (-591.240) -- 0:00:21
      634500 -- (-588.515) [-587.061] (-586.379) (-590.275) * (-589.062) (-588.741) [-589.342] (-588.150) -- 0:00:21
      635000 -- (-588.853) (-588.624) (-586.356) [-590.411] * (-591.046) (-589.765) (-590.112) [-591.587] -- 0:00:21

      Average standard deviation of split frequencies: 0.010229

      635500 -- (-590.028) (-599.955) [-588.574] (-588.771) * (-590.239) (-588.635) [-588.908] (-588.249) -- 0:00:21
      636000 -- (-587.989) [-589.681] (-592.623) (-591.785) * [-588.906] (-590.148) (-590.985) (-589.514) -- 0:00:21
      636500 -- (-588.877) [-588.537] (-592.088) (-588.263) * (-588.674) (-587.256) (-591.209) [-587.959] -- 0:00:22
      637000 -- (-588.785) [-590.094] (-590.827) (-588.553) * (-586.932) (-586.542) [-586.903] (-587.899) -- 0:00:22
      637500 -- (-589.806) [-588.207] (-587.534) (-588.488) * (-587.812) (-590.471) [-587.984] (-590.278) -- 0:00:22
      638000 -- (-587.193) [-586.799] (-587.554) (-587.926) * (-588.459) [-590.969] (-588.726) (-589.457) -- 0:00:22
      638500 -- (-589.883) [-586.420] (-588.596) (-589.437) * (-587.550) (-597.231) (-587.662) [-588.115] -- 0:00:22
      639000 -- (-588.681) [-587.823] (-586.901) (-589.211) * (-589.806) [-592.223] (-587.357) (-588.089) -- 0:00:22
      639500 -- (-588.330) (-588.996) [-586.902] (-587.764) * (-587.332) [-587.342] (-587.220) (-589.741) -- 0:00:21
      640000 -- [-586.919] (-586.685) (-588.966) (-589.085) * [-588.133] (-586.620) (-589.993) (-590.575) -- 0:00:21

      Average standard deviation of split frequencies: 0.009860

      640500 -- (-587.396) [-586.727] (-591.475) (-587.239) * [-588.174] (-586.788) (-589.940) (-587.288) -- 0:00:21
      641000 -- [-586.736] (-588.490) (-590.018) (-589.363) * [-587.631] (-586.788) (-589.028) (-590.318) -- 0:00:21
      641500 -- (-590.749) (-592.613) [-588.039] (-589.774) * (-587.338) (-586.605) [-586.555] (-590.641) -- 0:00:21
      642000 -- (-591.573) (-594.866) [-586.890] (-589.905) * (-591.404) (-592.283) [-587.836] (-587.085) -- 0:00:21
      642500 -- [-588.685] (-590.537) (-588.618) (-591.079) * (-587.705) (-587.765) [-586.800] (-588.128) -- 0:00:21
      643000 -- (-588.549) [-587.600] (-589.216) (-586.909) * (-588.160) [-590.075] (-588.504) (-588.758) -- 0:00:21
      643500 -- (-589.843) [-586.951] (-587.527) (-588.435) * (-588.609) [-588.239] (-588.064) (-586.763) -- 0:00:21
      644000 -- (-588.210) (-586.824) [-591.036] (-592.321) * (-587.186) (-588.371) (-586.858) [-586.755] -- 0:00:21
      644500 -- (-587.742) (-588.251) (-588.758) [-587.901] * (-586.655) [-588.891] (-588.285) (-587.394) -- 0:00:21
      645000 -- (-587.554) (-586.884) (-590.240) [-587.842] * (-588.653) (-593.034) (-588.199) [-587.933] -- 0:00:21

      Average standard deviation of split frequencies: 0.010557

      645500 -- (-587.711) (-591.847) (-590.037) [-587.491] * (-586.498) (-590.324) (-594.166) [-587.435] -- 0:00:21
      646000 -- (-588.418) (-590.388) (-587.717) [-587.780] * [-589.219] (-593.059) (-590.154) (-587.020) -- 0:00:21
      646500 -- (-591.704) (-594.022) (-587.905) [-587.642] * [-589.853] (-591.678) (-590.155) (-588.534) -- 0:00:21
      647000 -- (-591.493) (-588.218) (-586.922) [-591.963] * (-587.332) (-589.722) (-590.789) [-588.560] -- 0:00:21
      647500 -- (-591.724) (-589.138) [-586.439] (-586.156) * (-589.453) (-592.843) (-591.277) [-586.414] -- 0:00:21
      648000 -- (-590.997) [-592.071] (-586.546) (-588.025) * (-593.228) (-590.947) (-588.961) [-586.805] -- 0:00:21
      648500 -- (-586.887) [-592.066] (-589.473) (-587.795) * (-588.620) [-588.860] (-588.175) (-586.923) -- 0:00:21
      649000 -- [-591.082] (-588.732) (-587.934) (-589.080) * [-586.566] (-588.551) (-588.659) (-587.850) -- 0:00:21
      649500 -- [-587.853] (-586.821) (-586.846) (-587.925) * (-589.331) (-587.706) (-590.508) [-586.613] -- 0:00:21
      650000 -- [-588.038] (-588.603) (-587.949) (-587.297) * [-586.599] (-588.706) (-593.929) (-588.910) -- 0:00:21

      Average standard deviation of split frequencies: 0.010481

      650500 -- (-590.327) [-586.682] (-590.271) (-589.391) * (-587.308) [-590.129] (-588.653) (-591.236) -- 0:00:20
      651000 -- (-589.707) [-587.134] (-586.694) (-586.748) * (-592.594) (-591.102) [-589.916] (-589.245) -- 0:00:20
      651500 -- (-587.935) [-586.800] (-586.565) (-586.209) * (-587.767) (-589.738) (-589.137) [-589.012] -- 0:00:20
      652000 -- (-587.465) [-587.936] (-591.773) (-591.745) * [-588.822] (-588.311) (-587.270) (-591.463) -- 0:00:20
      652500 -- (-588.339) (-587.746) [-587.723] (-591.041) * (-590.534) [-588.202] (-587.146) (-589.464) -- 0:00:20
      653000 -- (-588.528) (-588.353) [-588.334] (-588.618) * (-589.997) (-588.139) [-591.060] (-586.984) -- 0:00:20
      653500 -- [-591.342] (-588.104) (-590.390) (-593.281) * (-591.442) (-594.579) (-589.847) [-587.070] -- 0:00:21
      654000 -- [-587.019] (-588.665) (-590.083) (-589.599) * (-591.816) (-588.987) (-590.335) [-593.652] -- 0:00:21
      654500 -- (-589.387) (-587.009) (-591.040) [-591.378] * [-589.694] (-590.744) (-587.955) (-592.142) -- 0:00:21
      655000 -- (-590.702) (-594.980) [-587.335] (-587.984) * [-586.823] (-587.768) (-589.618) (-587.951) -- 0:00:21

      Average standard deviation of split frequencies: 0.010300

      655500 -- [-588.405] (-588.175) (-591.679) (-588.017) * [-587.327] (-587.021) (-588.364) (-586.358) -- 0:00:21
      656000 -- (-587.639) (-588.695) [-590.535] (-589.165) * (-588.616) [-588.029] (-588.142) (-590.149) -- 0:00:20
      656500 -- [-587.690] (-588.172) (-587.240) (-588.354) * [-586.363] (-588.037) (-590.532) (-587.986) -- 0:00:20
      657000 -- [-587.082] (-586.614) (-587.535) (-591.888) * [-588.875] (-589.047) (-588.393) (-590.449) -- 0:00:20
      657500 -- [-588.472] (-587.770) (-590.829) (-590.742) * [-588.390] (-588.098) (-588.611) (-590.444) -- 0:00:20
      658000 -- [-587.199] (-588.014) (-591.674) (-587.251) * (-594.944) (-586.645) [-587.066] (-589.479) -- 0:00:20
      658500 -- (-587.574) [-588.057] (-588.897) (-587.324) * (-589.766) (-587.001) [-587.362] (-586.984) -- 0:00:20
      659000 -- (-589.116) (-587.862) [-590.414] (-587.905) * [-590.804] (-595.144) (-587.557) (-592.186) -- 0:00:20
      659500 -- (-592.921) (-588.434) [-589.183] (-591.137) * (-588.988) (-589.210) (-588.184) [-587.438] -- 0:00:20
      660000 -- (-587.220) (-586.901) (-591.362) [-591.569] * (-586.896) [-588.818] (-587.159) (-587.971) -- 0:00:20

      Average standard deviation of split frequencies: 0.010418

      660500 -- (-589.565) (-588.602) [-586.822] (-593.287) * (-591.119) (-586.674) [-588.530] (-589.564) -- 0:00:20
      661000 -- (-588.571) (-594.206) [-587.867] (-590.271) * (-592.013) [-587.229] (-589.051) (-588.713) -- 0:00:20
      661500 -- (-589.005) (-591.854) [-589.589] (-587.043) * (-587.339) [-588.723] (-589.849) (-587.863) -- 0:00:20
      662000 -- (-589.868) [-588.197] (-591.499) (-589.188) * (-587.742) (-590.536) (-589.379) [-587.456] -- 0:00:20
      662500 -- (-588.675) (-589.407) (-587.086) [-588.367] * (-586.784) [-588.386] (-591.726) (-592.607) -- 0:00:20
      663000 -- (-594.382) [-586.871] (-587.706) (-588.312) * (-589.382) [-590.067] (-588.975) (-590.376) -- 0:00:20
      663500 -- (-586.473) (-588.820) [-587.855] (-587.649) * (-587.369) [-592.033] (-587.902) (-586.973) -- 0:00:20
      664000 -- (-586.331) (-592.864) (-588.256) [-587.149] * (-590.210) (-588.843) [-587.004] (-588.152) -- 0:00:20
      664500 -- (-589.184) (-587.901) [-588.775] (-587.739) * (-586.807) [-588.141] (-590.830) (-591.879) -- 0:00:20
      665000 -- [-587.911] (-587.413) (-590.365) (-589.150) * (-590.759) (-589.325) [-589.153] (-591.125) -- 0:00:20

      Average standard deviation of split frequencies: 0.010806

      665500 -- (-590.742) (-592.992) [-590.077] (-587.639) * (-588.424) (-588.755) (-588.931) [-587.089] -- 0:00:20
      666000 -- (-589.609) (-588.338) [-588.397] (-587.716) * (-590.716) (-588.910) (-589.661) [-588.060] -- 0:00:20
      666500 -- (-589.383) (-591.219) [-589.304] (-589.694) * [-588.324] (-588.210) (-590.198) (-589.661) -- 0:00:20
      667000 -- (-588.298) (-590.549) (-592.117) [-589.892] * (-591.100) (-588.348) (-587.441) [-587.557] -- 0:00:19
      667500 -- (-590.153) (-593.443) [-589.675] (-587.750) * (-590.411) (-590.350) (-586.838) [-587.100] -- 0:00:19
      668000 -- (-590.683) (-588.590) (-588.501) [-586.848] * [-588.497] (-594.370) (-592.574) (-588.011) -- 0:00:19
      668500 -- (-588.941) (-590.521) [-587.314] (-588.843) * (-586.916) [-586.575] (-589.184) (-588.526) -- 0:00:19
      669000 -- [-588.777] (-589.623) (-589.027) (-586.986) * (-589.172) (-591.630) (-588.585) [-588.208] -- 0:00:19
      669500 -- (-588.210) (-588.354) [-588.346] (-587.960) * (-590.699) (-592.522) (-588.511) [-588.975] -- 0:00:19
      670000 -- (-590.012) (-586.766) [-588.081] (-587.730) * [-586.580] (-589.159) (-588.719) (-591.052) -- 0:00:19

      Average standard deviation of split frequencies: 0.010450

      670500 -- (-587.575) (-587.264) [-588.249] (-588.664) * (-587.473) (-587.115) (-591.013) [-588.564] -- 0:00:20
      671000 -- (-589.840) (-587.905) (-588.695) [-589.201] * [-588.687] (-589.488) (-589.568) (-588.206) -- 0:00:20
      671500 -- (-588.155) (-586.589) [-586.896] (-590.646) * [-590.393] (-586.430) (-589.422) (-589.511) -- 0:00:20
      672000 -- (-588.452) (-586.235) [-589.304] (-589.682) * (-598.177) [-587.317] (-587.060) (-587.287) -- 0:00:20
      672500 -- (-588.802) (-589.152) (-587.614) [-586.732] * (-588.853) [-587.315] (-588.527) (-587.972) -- 0:00:19
      673000 -- (-587.405) [-586.952] (-589.377) (-587.262) * (-589.235) (-587.534) [-587.915] (-586.812) -- 0:00:19
      673500 -- (-589.837) (-588.380) [-592.765] (-588.804) * (-593.074) [-590.438] (-590.661) (-586.459) -- 0:00:19
      674000 -- (-592.286) (-589.843) (-590.338) [-589.480] * [-590.044] (-596.726) (-589.400) (-590.310) -- 0:00:19
      674500 -- (-589.286) (-590.776) [-588.704] (-591.993) * (-586.563) (-587.551) (-590.069) [-589.130] -- 0:00:19
      675000 -- [-590.681] (-588.066) (-590.311) (-594.072) * [-587.690] (-587.144) (-589.838) (-589.700) -- 0:00:19

      Average standard deviation of split frequencies: 0.010274

      675500 -- [-588.459] (-589.581) (-591.251) (-590.558) * [-589.510] (-588.787) (-588.373) (-590.392) -- 0:00:19
      676000 -- (-589.113) [-587.307] (-588.138) (-588.219) * (-587.585) (-588.795) (-586.463) [-591.457] -- 0:00:19
      676500 -- (-593.133) (-597.665) (-590.141) [-588.484] * [-588.902] (-587.177) (-592.161) (-588.167) -- 0:00:19
      677000 -- (-590.050) (-592.716) (-588.026) [-588.091] * (-592.928) (-589.536) [-589.706] (-589.379) -- 0:00:19
      677500 -- (-588.828) (-588.310) [-587.760] (-587.532) * (-588.781) (-589.757) [-589.896] (-587.667) -- 0:00:19
      678000 -- (-591.434) [-587.202] (-592.508) (-589.354) * (-590.401) [-587.153] (-591.710) (-588.605) -- 0:00:19
      678500 -- (-588.213) (-587.538) [-589.207] (-593.508) * (-588.572) [-587.502] (-596.620) (-588.981) -- 0:00:19
      679000 -- (-589.078) [-588.245] (-587.315) (-591.855) * (-586.801) (-590.541) [-590.575] (-587.030) -- 0:00:19
      679500 -- (-589.597) [-587.771] (-587.355) (-591.708) * (-586.347) [-589.209] (-589.265) (-588.709) -- 0:00:19
      680000 -- (-587.539) (-588.212) [-588.415] (-590.454) * (-586.384) (-589.976) [-586.670] (-589.495) -- 0:00:19

      Average standard deviation of split frequencies: 0.009742

      680500 -- (-587.333) [-588.638] (-589.676) (-587.509) * [-589.230] (-588.066) (-587.955) (-589.653) -- 0:00:19
      681000 -- (-586.645) [-590.405] (-588.488) (-587.150) * (-591.173) [-591.248] (-586.953) (-588.633) -- 0:00:19
      681500 -- (-587.411) [-586.353] (-588.257) (-590.280) * (-589.599) (-589.288) [-588.901] (-589.994) -- 0:00:19
      682000 -- (-586.822) [-588.647] (-589.681) (-588.061) * (-586.911) (-587.085) (-589.389) [-588.119] -- 0:00:19
      682500 -- (-586.995) [-588.930] (-587.257) (-586.693) * (-588.058) (-588.413) [-588.902] (-590.542) -- 0:00:19
      683000 -- (-590.601) [-592.173] (-586.936) (-587.696) * (-586.872) (-587.733) [-588.399] (-592.207) -- 0:00:19
      683500 -- (-592.028) [-589.698] (-591.140) (-587.965) * [-586.770] (-588.416) (-589.718) (-595.066) -- 0:00:18
      684000 -- (-588.950) (-588.654) (-590.267) [-586.360] * (-587.193) [-588.162] (-586.888) (-595.029) -- 0:00:18
      684500 -- (-586.996) (-587.580) [-590.214] (-588.441) * (-588.210) (-588.609) [-592.566] (-589.873) -- 0:00:18
      685000 -- (-587.164) (-596.631) [-588.117] (-588.991) * (-592.318) (-587.025) (-589.944) [-586.730] -- 0:00:18

      Average standard deviation of split frequencies: 0.009346

      685500 -- [-588.922] (-589.759) (-589.422) (-591.057) * (-589.528) [-592.112] (-588.448) (-589.085) -- 0:00:18
      686000 -- (-588.610) (-588.998) [-587.719] (-590.511) * (-590.526) [-589.782] (-590.177) (-593.243) -- 0:00:18
      686500 -- (-589.050) (-589.011) [-588.833] (-589.006) * (-590.879) (-587.248) [-588.419] (-588.130) -- 0:00:18
      687000 -- (-587.405) (-592.112) [-586.630] (-586.555) * (-589.372) [-587.449] (-587.431) (-587.989) -- 0:00:18
      687500 -- (-589.074) [-592.809] (-592.447) (-586.595) * (-587.895) (-587.467) (-589.217) [-587.016] -- 0:00:19
      688000 -- (-588.914) (-587.842) [-589.445] (-588.688) * (-590.109) (-592.149) [-590.898] (-586.255) -- 0:00:19
      688500 -- (-586.571) [-589.767] (-589.460) (-589.311) * (-588.578) (-589.096) (-590.229) [-586.973] -- 0:00:19
      689000 -- (-588.001) [-590.655] (-588.252) (-587.566) * (-588.613) (-589.053) (-588.322) [-587.374] -- 0:00:18
      689500 -- [-586.840] (-590.977) (-586.879) (-589.812) * (-587.157) (-587.628) [-589.936] (-588.489) -- 0:00:18
      690000 -- (-588.512) (-590.583) [-589.646] (-588.529) * (-586.640) (-588.409) [-586.698] (-586.797) -- 0:00:18

      Average standard deviation of split frequencies: 0.009146

      690500 -- (-590.766) (-592.002) (-588.564) [-588.825] * (-589.620) (-591.520) (-588.599) [-586.314] -- 0:00:18
      691000 -- (-588.834) (-590.324) (-590.897) [-588.178] * (-587.403) (-592.862) (-593.357) [-592.118] -- 0:00:18
      691500 -- (-590.814) (-589.838) [-592.407] (-589.558) * [-588.732] (-592.073) (-586.257) (-589.365) -- 0:00:18
      692000 -- (-590.123) (-588.582) [-589.031] (-589.393) * (-590.761) [-587.999] (-588.017) (-587.100) -- 0:00:18
      692500 -- (-595.414) [-589.185] (-589.824) (-588.204) * (-587.177) (-589.219) [-590.221] (-587.172) -- 0:00:18
      693000 -- (-588.746) (-588.889) (-589.823) [-589.787] * (-589.392) (-592.385) (-588.159) [-587.866] -- 0:00:18
      693500 -- [-588.737] (-590.998) (-588.056) (-587.388) * (-591.866) (-587.730) (-586.297) [-589.126] -- 0:00:18
      694000 -- (-588.759) [-586.260] (-586.383) (-588.689) * (-587.318) [-587.553] (-590.027) (-591.302) -- 0:00:18
      694500 -- [-589.208] (-589.207) (-586.947) (-587.761) * [-587.834] (-597.932) (-588.269) (-586.960) -- 0:00:18
      695000 -- [-588.450] (-589.466) (-587.762) (-591.647) * (-588.114) (-587.664) (-586.770) [-587.199] -- 0:00:18

      Average standard deviation of split frequencies: 0.008670

      695500 -- (-588.035) (-591.395) [-587.755] (-587.535) * (-587.020) (-589.219) [-589.064] (-588.182) -- 0:00:18
      696000 -- (-588.033) (-588.468) (-588.352) [-587.546] * (-588.648) [-588.114] (-587.238) (-590.289) -- 0:00:18
      696500 -- (-587.228) (-589.151) [-588.461] (-587.222) * [-589.998] (-588.471) (-589.118) (-588.638) -- 0:00:18
      697000 -- (-587.323) (-588.305) [-590.636] (-587.337) * [-589.413] (-587.025) (-587.975) (-586.926) -- 0:00:18
      697500 -- (-590.148) [-588.664] (-592.415) (-586.990) * (-589.843) [-587.246] (-588.087) (-591.205) -- 0:00:18
      698000 -- [-593.159] (-587.847) (-589.799) (-587.114) * (-590.834) (-590.808) (-588.015) [-586.468] -- 0:00:18
      698500 -- (-588.237) [-587.084] (-590.363) (-593.493) * (-587.794) (-587.802) (-588.185) [-586.724] -- 0:00:18
      699000 -- [-588.814] (-586.264) (-587.611) (-586.357) * (-586.709) (-589.469) (-589.643) [-588.839] -- 0:00:18
      699500 -- (-591.089) (-587.342) (-589.449) [-588.674] * (-588.261) (-589.265) (-593.563) [-586.945] -- 0:00:18
      700000 -- (-591.322) (-588.256) (-587.593) [-588.031] * (-591.941) (-587.658) (-588.903) [-586.627] -- 0:00:18

      Average standard deviation of split frequencies: 0.008926

      700500 -- [-592.516] (-588.606) (-588.053) (-587.710) * (-589.463) (-590.911) (-587.858) [-588.604] -- 0:00:17
      701000 -- (-591.473) (-587.403) [-587.434] (-587.704) * (-589.287) [-588.947] (-587.491) (-588.259) -- 0:00:17
      701500 -- (-589.769) (-589.648) [-588.262] (-592.638) * (-590.747) [-587.788] (-590.070) (-590.602) -- 0:00:17
      702000 -- (-590.105) (-587.714) (-586.667) [-589.667] * [-588.025] (-586.428) (-587.137) (-587.308) -- 0:00:17
      702500 -- [-588.605] (-586.245) (-587.046) (-588.735) * [-587.911] (-589.135) (-587.588) (-588.765) -- 0:00:17
      703000 -- (-590.930) (-587.118) (-586.309) [-588.244] * (-588.936) (-591.639) (-587.745) [-588.821] -- 0:00:17
      703500 -- (-592.206) (-587.814) [-589.561] (-587.508) * (-593.047) [-587.361] (-587.911) (-586.674) -- 0:00:17
      704000 -- (-588.671) (-588.903) (-588.757) [-587.303] * (-589.285) [-589.453] (-587.616) (-588.424) -- 0:00:17
      704500 -- (-591.064) [-588.300] (-587.903) (-588.755) * [-589.813] (-588.666) (-591.148) (-588.638) -- 0:00:18
      705000 -- (-588.784) (-587.276) (-587.748) [-587.055] * (-592.252) (-586.808) [-586.755] (-590.058) -- 0:00:17

      Average standard deviation of split frequencies: 0.008369

      705500 -- (-588.804) [-587.538] (-590.028) (-586.864) * [-590.015] (-588.535) (-588.235) (-588.990) -- 0:00:17
      706000 -- (-592.932) (-590.573) [-586.693] (-588.329) * (-591.349) [-592.794] (-591.316) (-588.106) -- 0:00:17
      706500 -- (-587.887) [-588.550] (-588.813) (-587.018) * (-587.244) [-590.342] (-588.177) (-586.285) -- 0:00:17
      707000 -- [-589.027] (-589.969) (-590.992) (-587.164) * [-587.245] (-588.360) (-589.580) (-586.567) -- 0:00:17
      707500 -- (-590.424) (-589.350) [-588.575] (-590.387) * [-587.826] (-591.831) (-593.411) (-587.251) -- 0:00:17
      708000 -- (-590.041) [-587.263] (-587.979) (-586.921) * [-588.245] (-588.298) (-588.014) (-587.454) -- 0:00:17
      708500 -- (-591.503) [-588.594] (-588.432) (-592.379) * (-589.788) (-587.686) (-588.719) [-589.341] -- 0:00:17
      709000 -- (-591.403) (-589.447) [-587.297] (-591.358) * (-590.755) (-588.682) (-590.098) [-588.117] -- 0:00:17
      709500 -- [-587.309] (-592.595) (-587.746) (-588.056) * [-587.993] (-589.605) (-592.226) (-587.017) -- 0:00:17
      710000 -- (-587.119) (-591.017) [-587.603] (-588.401) * (-589.761) [-587.311] (-588.065) (-590.399) -- 0:00:17

      Average standard deviation of split frequencies: 0.008933

      710500 -- (-588.157) [-588.392] (-587.443) (-594.591) * [-586.892] (-587.279) (-588.617) (-589.117) -- 0:00:17
      711000 -- [-586.986] (-589.326) (-588.917) (-586.954) * [-586.918] (-590.624) (-587.336) (-587.434) -- 0:00:17
      711500 -- (-586.678) (-590.186) (-586.500) [-587.089] * [-586.962] (-589.079) (-588.538) (-589.235) -- 0:00:17
      712000 -- (-591.696) (-592.102) [-586.718] (-587.120) * (-588.278) (-588.655) [-587.212] (-589.600) -- 0:00:17
      712500 -- (-587.203) [-587.771] (-591.780) (-588.056) * (-587.642) (-588.513) (-587.117) [-589.523] -- 0:00:17
      713000 -- (-586.622) (-587.635) (-589.775) [-586.608] * (-592.416) (-587.865) [-589.225] (-589.338) -- 0:00:17
      713500 -- (-588.797) [-587.927] (-596.423) (-587.492) * (-588.817) (-587.334) [-589.063] (-586.746) -- 0:00:17
      714000 -- [-587.811] (-587.739) (-586.206) (-588.537) * (-589.405) (-588.526) (-591.663) [-588.764] -- 0:00:17
      714500 -- (-589.389) (-587.738) (-588.855) [-588.663] * (-589.350) [-587.838] (-591.211) (-588.768) -- 0:00:17
      715000 -- (-586.318) [-588.377] (-588.980) (-588.982) * [-587.216] (-588.322) (-588.206) (-587.612) -- 0:00:17

      Average standard deviation of split frequencies: 0.009130

      715500 -- [-587.175] (-586.897) (-588.420) (-587.885) * (-589.891) (-587.581) [-589.148] (-593.035) -- 0:00:17
      716000 -- [-586.629] (-586.532) (-589.286) (-589.724) * (-591.203) (-587.178) (-587.839) [-590.695] -- 0:00:17
      716500 -- (-588.288) (-588.833) (-587.205) [-589.363] * (-586.445) (-586.904) (-588.226) [-587.571] -- 0:00:17
      717000 -- (-590.364) [-587.804] (-588.689) (-586.943) * (-586.534) [-587.355] (-593.427) (-587.647) -- 0:00:16
      717500 -- [-588.216] (-587.834) (-587.872) (-586.250) * (-587.127) (-587.163) [-590.991] (-589.561) -- 0:00:16
      718000 -- (-587.796) [-590.805] (-592.528) (-587.942) * (-589.102) (-589.528) (-591.306) [-587.562] -- 0:00:16
      718500 -- (-587.374) (-588.070) (-589.920) [-588.951] * (-588.148) (-589.126) [-590.064] (-588.652) -- 0:00:16
      719000 -- (-587.682) (-587.550) [-586.973] (-588.843) * (-589.673) (-587.237) [-587.603] (-594.263) -- 0:00:16
      719500 -- [-588.918] (-588.559) (-589.312) (-591.099) * (-591.617) [-588.127] (-592.191) (-587.824) -- 0:00:16
      720000 -- (-586.751) (-587.582) (-592.669) [-588.008] * (-594.721) [-587.674] (-587.388) (-586.678) -- 0:00:16

      Average standard deviation of split frequencies: 0.009289

      720500 -- (-586.759) (-587.125) (-591.616) [-586.543] * (-587.613) (-589.043) (-598.438) [-587.550] -- 0:00:16
      721000 -- (-586.299) (-587.364) (-593.384) [-586.643] * (-588.890) (-588.230) (-592.171) [-587.118] -- 0:00:16
      721500 -- (-588.874) (-590.884) [-587.819] (-586.281) * (-588.180) [-587.616] (-597.207) (-587.289) -- 0:00:16
      722000 -- (-588.915) [-590.666] (-587.963) (-586.608) * (-587.187) [-587.143] (-587.633) (-594.813) -- 0:00:16
      722500 -- (-588.910) (-587.458) [-587.064] (-588.436) * (-587.921) (-587.203) (-589.055) [-589.924] -- 0:00:16
      723000 -- (-589.226) [-587.209] (-587.085) (-586.836) * (-587.437) (-588.740) [-588.856] (-588.469) -- 0:00:16
      723500 -- (-589.304) [-587.190] (-588.504) (-586.902) * (-591.001) [-588.761] (-591.431) (-587.920) -- 0:00:16
      724000 -- (-588.025) (-587.513) [-587.241] (-587.291) * (-589.889) (-587.690) [-587.028] (-591.966) -- 0:00:16
      724500 -- [-592.680] (-590.378) (-586.669) (-590.536) * [-591.264] (-589.726) (-586.959) (-586.995) -- 0:00:16
      725000 -- (-588.066) [-587.551] (-588.307) (-587.666) * (-589.945) [-592.044] (-587.132) (-589.271) -- 0:00:16

      Average standard deviation of split frequencies: 0.008874

      725500 -- (-587.749) (-587.051) (-588.738) [-587.224] * (-587.043) (-593.067) [-587.171] (-590.534) -- 0:00:16
      726000 -- (-588.387) (-587.259) [-588.483] (-586.815) * (-587.563) [-592.299] (-589.625) (-589.960) -- 0:00:16
      726500 -- (-590.555) (-590.089) (-587.889) [-589.316] * (-587.885) (-592.951) [-591.802] (-588.200) -- 0:00:16
      727000 -- (-591.510) (-589.678) (-588.082) [-586.731] * (-586.412) [-589.377] (-587.326) (-589.544) -- 0:00:16
      727500 -- (-589.971) (-587.736) [-587.766] (-588.277) * (-587.060) (-587.702) [-587.543] (-591.439) -- 0:00:16
      728000 -- (-590.208) [-586.739] (-590.458) (-589.202) * (-586.518) (-588.180) [-587.907] (-590.970) -- 0:00:16
      728500 -- [-590.103] (-586.988) (-587.631) (-590.082) * (-586.439) (-589.800) (-588.113) [-587.432] -- 0:00:16
      729000 -- [-587.184] (-586.410) (-586.239) (-591.848) * [-588.399] (-588.982) (-587.347) (-587.219) -- 0:00:16
      729500 -- [-590.016] (-588.423) (-587.296) (-594.797) * (-588.289) (-589.566) (-586.305) [-587.996] -- 0:00:16
      730000 -- (-596.524) (-590.224) (-589.208) [-586.512] * (-590.125) (-586.894) (-587.053) [-587.584] -- 0:00:16

      Average standard deviation of split frequencies: 0.008817

      730500 -- [-592.393] (-589.901) (-591.167) (-589.692) * (-588.159) (-588.513) (-588.389) [-587.564] -- 0:00:16
      731000 -- (-587.065) (-591.468) [-589.417] (-589.744) * (-587.694) (-590.534) [-588.335] (-587.386) -- 0:00:16
      731500 -- (-593.105) [-588.512] (-595.838) (-587.043) * (-587.367) (-588.292) [-588.187] (-587.823) -- 0:00:16
      732000 -- (-589.472) (-592.676) (-589.182) [-588.463] * (-589.160) (-595.667) (-591.932) [-587.229] -- 0:00:16
      732500 -- (-589.317) (-589.850) [-587.941] (-586.782) * (-588.468) (-588.307) (-590.495) [-589.820] -- 0:00:16
      733000 -- (-587.679) (-590.085) [-587.986] (-586.429) * [-587.091] (-587.891) (-590.412) (-587.223) -- 0:00:16
      733500 -- (-589.119) [-587.651] (-589.763) (-588.020) * (-587.911) (-592.074) [-588.186] (-590.853) -- 0:00:15
      734000 -- (-589.953) (-590.091) (-587.980) [-588.452] * [-590.563] (-592.029) (-591.696) (-587.152) -- 0:00:15
      734500 -- (-589.474) (-586.874) [-587.024] (-587.862) * (-589.000) [-587.528] (-588.749) (-587.183) -- 0:00:15
      735000 -- (-587.600) [-588.185] (-587.825) (-588.131) * (-588.034) [-589.541] (-588.093) (-586.662) -- 0:00:15

      Average standard deviation of split frequencies: 0.008497

      735500 -- [-587.494] (-590.907) (-588.691) (-588.000) * (-586.930) (-588.451) [-591.316] (-588.660) -- 0:00:15
      736000 -- (-587.615) (-587.551) (-590.778) [-587.054] * [-587.054] (-587.912) (-590.237) (-589.789) -- 0:00:15
      736500 -- (-588.892) [-590.286] (-586.800) (-587.913) * (-589.478) [-587.792] (-587.210) (-590.380) -- 0:00:15
      737000 -- (-588.781) (-592.748) (-587.075) [-586.493] * (-589.237) [-586.850] (-587.254) (-590.534) -- 0:00:15
      737500 -- (-587.535) (-587.548) (-586.718) [-592.444] * (-588.903) (-587.055) [-590.114] (-590.016) -- 0:00:15
      738000 -- (-587.965) [-586.411] (-586.313) (-588.471) * (-587.982) (-587.813) (-589.591) [-588.289] -- 0:00:15
      738500 -- (-588.674) (-587.237) [-586.987] (-591.406) * (-588.705) [-588.021] (-590.637) (-588.677) -- 0:00:15
      739000 -- (-590.501) (-589.656) [-588.588] (-589.169) * (-590.823) [-591.528] (-590.836) (-588.120) -- 0:00:15
      739500 -- [-589.622] (-591.425) (-588.478) (-589.555) * (-591.720) [-587.519] (-587.505) (-588.100) -- 0:00:15
      740000 -- (-587.583) (-594.034) [-592.191] (-591.056) * (-590.792) [-589.007] (-590.014) (-587.309) -- 0:00:15

      Average standard deviation of split frequencies: 0.008316

      740500 -- (-588.236) [-589.273] (-591.284) (-586.751) * [-588.090] (-587.540) (-588.222) (-589.984) -- 0:00:15
      741000 -- [-587.816] (-588.368) (-587.349) (-588.098) * [-587.677] (-587.799) (-590.233) (-586.533) -- 0:00:15
      741500 -- (-586.445) [-589.147] (-590.256) (-591.025) * (-590.261) [-586.549] (-589.623) (-587.388) -- 0:00:15
      742000 -- (-587.596) (-587.767) (-598.581) [-588.176] * [-587.345] (-588.768) (-590.051) (-586.662) -- 0:00:15
      742500 -- [-587.744] (-589.278) (-587.769) (-590.901) * (-588.831) [-587.038] (-588.025) (-590.447) -- 0:00:15
      743000 -- (-588.393) (-595.726) [-587.749] (-590.386) * (-587.150) (-589.014) (-587.989) [-590.515] -- 0:00:15
      743500 -- [-587.494] (-591.097) (-586.937) (-588.824) * [-589.791] (-589.754) (-588.977) (-590.632) -- 0:00:15
      744000 -- [-587.212] (-590.075) (-589.022) (-590.023) * (-592.418) (-591.242) (-590.694) [-587.102] -- 0:00:15
      744500 -- (-589.717) (-590.682) (-588.159) [-593.306] * (-595.273) (-591.694) [-587.779] (-591.660) -- 0:00:15
      745000 -- [-588.076] (-588.769) (-589.627) (-591.318) * (-588.405) (-595.527) (-594.015) [-589.400] -- 0:00:15

      Average standard deviation of split frequencies: 0.008594

      745500 -- (-586.601) (-588.652) [-590.723] (-586.455) * (-588.821) [-587.979] (-587.138) (-592.211) -- 0:00:15
      746000 -- [-586.354] (-589.523) (-587.118) (-586.831) * (-598.390) [-587.223] (-588.000) (-589.650) -- 0:00:15
      746500 -- [-586.437] (-590.090) (-589.268) (-588.517) * (-589.000) [-587.959] (-587.661) (-589.257) -- 0:00:15
      747000 -- (-586.976) (-589.835) (-586.626) [-587.023] * (-592.739) (-590.655) [-588.595] (-589.527) -- 0:00:15
      747500 -- (-586.643) (-591.295) (-587.381) [-590.440] * [-589.199] (-587.198) (-587.691) (-590.979) -- 0:00:15
      748000 -- [-586.493] (-590.318) (-591.730) (-592.405) * (-589.326) [-590.444] (-587.953) (-589.480) -- 0:00:15
      748500 -- [-586.393] (-586.510) (-587.603) (-592.446) * (-587.183) [-587.447] (-587.239) (-590.948) -- 0:00:15
      749000 -- (-588.705) [-589.683] (-587.369) (-587.339) * (-588.222) [-587.722] (-586.594) (-586.543) -- 0:00:15
      749500 -- (-591.036) (-589.001) [-590.985] (-589.915) * (-587.914) (-587.105) [-586.664] (-586.584) -- 0:00:15
      750000 -- (-593.927) (-588.896) (-589.904) [-587.550] * (-586.575) (-588.065) [-586.664] (-587.131) -- 0:00:15

      Average standard deviation of split frequencies: 0.008164

      750500 -- (-590.197) (-590.084) (-589.693) [-589.081] * [-587.619] (-588.394) (-593.999) (-588.661) -- 0:00:14
      751000 -- (-591.002) [-588.886] (-591.136) (-589.353) * [-588.530] (-589.610) (-593.841) (-586.960) -- 0:00:14
      751500 -- [-589.200] (-590.375) (-595.363) (-588.406) * (-587.740) (-590.940) [-590.673] (-592.416) -- 0:00:14
      752000 -- (-587.757) (-588.311) (-592.361) [-587.564] * (-588.242) [-588.698] (-588.782) (-590.253) -- 0:00:14
      752500 -- [-588.526] (-588.236) (-587.818) (-591.814) * (-588.827) [-588.789] (-590.302) (-587.894) -- 0:00:14
      753000 -- (-590.221) (-593.968) [-587.168] (-589.923) * (-590.259) (-591.464) [-588.554] (-592.718) -- 0:00:14
      753500 -- (-590.910) [-589.099] (-587.534) (-589.110) * (-588.336) [-587.764] (-587.707) (-587.622) -- 0:00:14
      754000 -- (-588.979) [-588.144] (-588.493) (-589.670) * [-589.371] (-588.850) (-588.339) (-586.768) -- 0:00:14
      754500 -- (-592.634) [-588.687] (-588.408) (-588.954) * (-588.664) [-588.746] (-589.216) (-586.389) -- 0:00:14
      755000 -- (-588.936) (-588.282) [-589.419] (-592.385) * (-590.382) [-588.199] (-588.680) (-587.813) -- 0:00:14

      Average standard deviation of split frequencies: 0.007857

      755500 -- (-587.878) [-586.144] (-591.865) (-590.124) * [-590.277] (-587.052) (-587.030) (-588.230) -- 0:00:14
      756000 -- (-588.561) (-589.312) (-588.675) [-588.143] * (-588.378) [-588.742] (-588.238) (-590.294) -- 0:00:14
      756500 -- (-587.358) (-587.572) [-588.841] (-588.674) * (-587.915) [-587.558] (-589.424) (-587.930) -- 0:00:14
      757000 -- (-591.938) (-590.851) [-587.582] (-592.780) * [-588.477] (-587.986) (-588.926) (-587.867) -- 0:00:14
      757500 -- [-587.390] (-590.740) (-589.943) (-589.216) * (-591.495) [-591.434] (-589.987) (-588.408) -- 0:00:14
      758000 -- [-586.724] (-586.977) (-586.847) (-586.859) * (-587.505) (-587.290) (-590.933) [-589.139] -- 0:00:14
      758500 -- (-591.67