--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:10:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/panD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -587.74 -591.88
2 -587.76 -591.46
--------------------------------------
TOTAL -587.75 -591.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890302 0.088247 0.330790 1.446417 0.853635 1421.22 1461.11 1.000
r(A<->C){all} 0.162002 0.018816 0.000124 0.435537 0.124249 216.05 217.44 1.000
r(A<->G){all} 0.160506 0.018846 0.000112 0.433472 0.124935 155.94 224.91 1.004
r(A<->T){all} 0.174020 0.019580 0.000025 0.446177 0.139401 203.70 308.54 1.004
r(C<->G){all} 0.155814 0.018042 0.000086 0.419243 0.118661 225.46 245.91 1.000
r(C<->T){all} 0.162538 0.019662 0.000027 0.459295 0.126638 131.76 190.31 1.000
r(G<->T){all} 0.185120 0.021937 0.000018 0.472351 0.154779 161.52 179.70 1.000
pi(A){all} 0.196819 0.000374 0.156531 0.232789 0.196326 1235.98 1241.14 1.000
pi(C){all} 0.274712 0.000441 0.234690 0.316848 0.274759 1310.42 1383.81 1.000
pi(G){all} 0.290598 0.000494 0.249718 0.335884 0.289878 1294.98 1336.70 1.000
pi(T){all} 0.237871 0.000435 0.198349 0.279207 0.237391 1193.33 1242.77 1.000
alpha{1,2} 0.436866 0.233661 0.000193 1.418664 0.270404 989.54 1174.71 1.000
alpha{3} 0.449342 0.224962 0.000294 1.427722 0.293254 1172.76 1275.34 1.000
pinvar{all} 0.996334 0.000020 0.988214 0.999999 0.997733 1282.30 1355.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -555.297471
Model 2: PositiveSelection -555.297451
Model 0: one-ratio -555.297608
Model 7: beta -555.297451
Model 8: beta&w>1 -555.297451
Model 0 vs 1 2.7399999999033753E-4
Model 2 vs 1 3.999999989900971E-5
Model 8 vs 7 0.0
>C1
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C2
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C3
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C4
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C5
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C6
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=142
C1 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C2 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C3 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C4 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C5 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C6 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
**************************************************
C1 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C2 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C3 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C4 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C5 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C6 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
**************************************************
C1 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C2 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C3 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C4 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C5 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C6 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 142 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 142 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4260]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4260]--->[4260]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.674 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C2 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C3 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C4 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C5 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
C6 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
**************************************************
C1 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C2 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C3 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C4 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C5 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
C6 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
**************************************************
C1 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C2 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C3 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C4 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C5 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
C6 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C2 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C3 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C4 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C5 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
C6 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
**************************************************
C1 GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C2 GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C3 GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C4 GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C5 GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
C6 GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
**************************************************
C1 GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C2 GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C3 GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C4 GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C5 GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
C6 GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
**************************************************
C1 AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C2 AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C3 AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C4 AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C5 AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
C6 AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
**************************************************
C1 TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C2 TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C3 TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C4 TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C5 TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
C6 TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
**************************************************
C1 TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C2 TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C3 TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C4 TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C5 TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
C6 TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
**************************************************
C1 TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C2 TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C3 TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C4 TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C5 TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
C6 TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
**************************************************
C1 GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C2 GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C3 GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C4 GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C5 GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
C6 GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
**************************************************
C1 TATTTGATCCCCGGATCGGTGCGCGG
C2 TATTTGATCCCCGGATCGGTGCGCGG
C3 TATTTGATCCCCGGATCGGTGCGCGG
C4 TATTTGATCCCCGGATCGGTGCGCGG
C5 TATTTGATCCCCGGATCGGTGCGCGG
C6 TATTTGATCCCCGGATCGGTGCGCGG
**************************
>C1
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C2
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C3
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C4
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C5
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C6
ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA
GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG
GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT
AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG
TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC
TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT
TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT
GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC
TATTTGATCCCCGGATCGGTGCGCGG
>C1
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C2
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C3
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C4
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C5
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
>C6
MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 426 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579784927
Setting output file names to "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1936447336
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9071215193
Seed = 390605383
Swapseed = 1579784927
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -953.408422 -- -24.965149
Chain 2 -- -953.408367 -- -24.965149
Chain 3 -- -953.408277 -- -24.965149
Chain 4 -- -953.408422 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -953.408422 -- -24.965149
Chain 2 -- -953.408422 -- -24.965149
Chain 3 -- -953.408422 -- -24.965149
Chain 4 -- -953.408367 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-953.408] (-953.408) (-953.408) (-953.408) * [-953.408] (-953.408) (-953.408) (-953.408)
500 -- (-598.078) [-601.627] (-606.518) (-597.751) * [-591.650] (-596.589) (-595.897) (-596.877) -- 0:00:00
1000 -- (-604.716) [-594.836] (-606.728) (-595.844) * (-595.320) [-594.826] (-595.834) (-597.858) -- 0:00:00
1500 -- (-593.917) (-602.374) [-597.864] (-601.151) * (-598.595) [-591.351] (-604.999) (-594.477) -- 0:00:00
2000 -- (-597.831) (-605.621) (-593.690) [-597.824] * (-597.304) (-606.397) [-594.067] (-598.348) -- 0:00:00
2500 -- [-593.550] (-597.902) (-600.958) (-595.915) * (-603.381) [-598.565] (-596.434) (-598.401) -- 0:00:00
3000 -- (-599.636) (-598.575) (-597.392) [-593.143] * (-598.480) [-599.475] (-594.906) (-602.868) -- 0:05:32
3500 -- (-595.997) (-600.402) [-595.909] (-594.576) * (-596.919) (-597.110) (-596.891) [-599.056] -- 0:04:44
4000 -- (-596.816) (-597.203) (-602.326) [-591.330] * (-598.704) (-605.411) (-598.304) [-597.206] -- 0:04:09
4500 -- (-599.841) (-599.588) (-600.743) [-593.121] * [-596.265] (-600.761) (-599.149) (-603.304) -- 0:03:41
5000 -- [-592.076] (-598.879) (-596.130) (-598.870) * (-596.547) (-593.247) (-606.356) [-595.245] -- 0:03:19
Average standard deviation of split frequencies: 0.086424
5500 -- (-604.469) (-600.561) [-597.367] (-597.291) * [-597.820] (-600.967) (-602.282) (-601.667) -- 0:03:00
6000 -- (-596.601) (-602.284) (-597.073) [-597.386] * [-596.273] (-599.912) (-599.528) (-594.221) -- 0:02:45
6500 -- (-592.657) (-597.659) [-594.777] (-594.687) * [-594.059] (-603.473) (-605.080) (-595.198) -- 0:02:32
7000 -- (-597.353) (-602.589) [-592.866] (-599.238) * (-600.816) [-593.229] (-600.594) (-595.162) -- 0:02:21
7500 -- (-601.227) (-594.752) (-602.844) [-601.180] * (-606.067) (-597.716) (-600.269) [-592.149] -- 0:02:12
8000 -- [-600.745] (-604.265) (-601.742) (-602.193) * (-592.716) (-600.876) (-593.993) [-593.135] -- 0:02:04
8500 -- (-594.681) (-610.428) [-596.542] (-597.823) * (-604.340) (-604.718) [-590.625] (-599.726) -- 0:01:56
9000 -- (-589.781) [-595.748] (-600.266) (-597.262) * [-594.362] (-598.734) (-594.144) (-600.311) -- 0:01:50
9500 -- (-592.511) (-596.932) (-599.307) [-592.274] * [-596.381] (-607.434) (-594.909) (-594.876) -- 0:01:44
10000 -- [-594.260] (-605.907) (-609.725) (-598.697) * (-595.959) (-594.910) (-591.309) [-596.069] -- 0:01:39
Average standard deviation of split frequencies: 0.076335
10500 -- (-589.738) (-604.390) [-594.973] (-601.053) * [-597.540] (-589.234) (-589.022) (-594.995) -- 0:01:34
11000 -- (-588.120) (-600.554) (-601.283) [-597.797] * (-595.586) (-588.113) [-587.417] (-599.250) -- 0:01:29
11500 -- [-591.429] (-595.303) (-601.610) (-599.462) * (-597.973) [-586.639] (-587.751) (-599.003) -- 0:01:25
12000 -- (-587.717) (-600.714) (-606.009) [-594.901] * (-602.917) (-588.909) (-590.637) [-597.258] -- 0:01:22
12500 -- (-587.548) (-599.545) [-595.215] (-602.433) * (-598.214) (-586.339) (-588.779) [-593.993] -- 0:01:19
13000 -- (-588.757) (-596.513) [-595.122] (-598.047) * (-595.141) [-587.936] (-587.669) (-610.538) -- 0:01:15
13500 -- [-588.137] (-597.578) (-596.098) (-600.864) * (-594.398) (-594.621) [-588.274] (-602.851) -- 0:01:13
14000 -- (-587.637) (-596.042) (-598.004) [-598.799] * (-595.404) (-591.310) [-589.628] (-597.785) -- 0:01:10
14500 -- (-588.090) (-597.349) [-601.662] (-594.479) * (-599.631) [-588.370] (-587.744) (-597.035) -- 0:01:07
15000 -- (-587.372) [-600.292] (-612.890) (-596.648) * (-597.709) [-588.814] (-590.705) (-603.163) -- 0:01:05
Average standard deviation of split frequencies: 0.071331
15500 -- (-587.099) (-603.429) (-595.329) [-599.802] * [-601.340] (-587.833) (-588.090) (-594.021) -- 0:01:03
16000 -- (-587.271) (-599.085) [-597.015] (-600.416) * [-593.222] (-590.212) (-589.047) (-598.438) -- 0:01:01
16500 -- (-588.355) [-593.876] (-607.833) (-596.231) * [-595.913] (-591.123) (-588.808) (-596.563) -- 0:00:59
17000 -- (-590.782) (-600.374) [-603.638] (-602.867) * (-598.914) (-589.108) [-587.106] (-603.303) -- 0:00:57
17500 -- (-591.749) [-594.565] (-593.990) (-599.945) * (-600.275) (-590.726) (-590.250) [-599.321] -- 0:00:56
18000 -- (-587.586) (-601.564) (-598.346) [-598.801] * (-596.152) (-589.067) (-586.403) [-593.496] -- 0:00:54
18500 -- (-592.159) (-597.790) (-606.066) [-595.796] * (-597.160) (-592.275) (-587.455) [-601.145] -- 0:00:53
19000 -- (-587.335) (-600.697) [-591.316] (-599.353) * (-598.329) (-595.654) [-587.403] (-601.086) -- 0:01:43
19500 -- (-587.750) [-596.244] (-608.794) (-606.999) * (-593.509) [-589.719] (-588.323) (-595.481) -- 0:01:40
20000 -- (-588.583) [-595.371] (-596.870) (-603.554) * (-596.761) [-587.662] (-589.782) (-598.823) -- 0:01:38
Average standard deviation of split frequencies: 0.067289
20500 -- (-588.607) [-596.447] (-595.718) (-606.302) * (-596.895) [-589.053] (-588.509) (-599.887) -- 0:01:35
21000 -- (-588.855) [-596.460] (-598.028) (-605.173) * (-596.358) [-589.952] (-589.142) (-606.958) -- 0:01:33
21500 -- [-589.352] (-603.131) (-592.230) (-597.338) * (-600.592) (-586.509) (-589.443) [-597.493] -- 0:01:31
22000 -- (-589.812) (-599.215) [-596.869] (-590.878) * (-598.772) (-592.886) [-590.038] (-611.653) -- 0:01:28
22500 -- (-588.265) [-594.634] (-606.660) (-587.691) * [-601.854] (-588.645) (-586.543) (-606.930) -- 0:01:26
23000 -- (-587.986) (-597.596) (-599.319) [-587.562] * (-601.257) [-587.380] (-587.487) (-595.332) -- 0:01:24
23500 -- (-586.481) [-598.066] (-609.882) (-587.919) * (-600.512) (-586.964) [-586.751] (-603.942) -- 0:01:23
24000 -- (-587.022) (-596.889) (-615.622) [-589.106] * (-610.629) (-586.612) (-586.759) [-596.982] -- 0:01:21
24500 -- (-587.016) (-600.565) [-588.373] (-587.703) * (-606.049) (-588.448) [-586.351] (-601.572) -- 0:01:19
25000 -- (-589.134) (-603.033) (-587.486) [-587.531] * (-595.388) (-589.917) (-586.207) [-594.647] -- 0:01:18
Average standard deviation of split frequencies: 0.051096
25500 -- (-590.732) [-597.856] (-587.431) (-586.474) * (-592.308) (-591.252) (-588.681) [-601.612] -- 0:01:16
26000 -- [-594.747] (-597.360) (-589.125) (-586.561) * [-586.270] (-590.260) (-592.660) (-598.385) -- 0:01:14
26500 -- (-591.205) (-604.313) (-594.401) [-587.142] * (-586.992) (-588.339) (-595.947) [-590.792] -- 0:01:13
27000 -- [-589.592] (-598.364) (-587.893) (-594.157) * (-590.661) [-589.081] (-597.672) (-597.237) -- 0:01:12
27500 -- (-587.165) (-596.608) (-588.640) [-587.056] * (-586.914) (-590.283) (-589.297) [-593.293] -- 0:01:10
28000 -- (-591.996) [-598.745] (-591.099) (-589.813) * (-588.889) (-590.355) [-588.146] (-601.006) -- 0:01:09
28500 -- (-589.759) [-592.444] (-589.576) (-588.036) * (-589.429) (-589.415) [-587.872] (-597.336) -- 0:01:08
29000 -- (-589.261) [-597.923] (-591.362) (-588.113) * (-589.274) [-587.206] (-590.830) (-595.317) -- 0:01:06
29500 -- [-591.158] (-596.234) (-589.152) (-595.099) * (-589.135) [-588.038] (-589.272) (-597.068) -- 0:01:05
30000 -- [-587.868] (-596.852) (-593.765) (-589.417) * (-589.416) [-586.644] (-587.330) (-608.602) -- 0:01:04
Average standard deviation of split frequencies: 0.054570
30500 -- (-589.953) (-600.276) [-590.123] (-587.385) * [-587.243] (-586.718) (-587.893) (-610.145) -- 0:01:03
31000 -- [-587.773] (-593.631) (-589.776) (-587.069) * (-589.857) (-592.510) [-587.460] (-596.251) -- 0:01:02
31500 -- (-587.946) (-606.978) [-589.835] (-590.567) * [-594.275] (-591.181) (-593.277) (-603.279) -- 0:01:01
32000 -- (-587.808) [-594.166] (-587.779) (-590.391) * (-588.373) (-597.190) [-590.964] (-597.712) -- 0:01:00
32500 -- (-594.098) (-593.980) (-587.511) [-587.119] * [-586.500] (-588.263) (-587.084) (-598.946) -- 0:00:59
33000 -- [-589.051] (-592.602) (-588.964) (-588.519) * (-587.104) [-589.339] (-586.888) (-597.158) -- 0:00:58
33500 -- (-595.790) (-593.391) (-589.133) [-592.971] * [-589.292] (-595.529) (-587.974) (-602.517) -- 0:00:57
34000 -- (-588.317) (-601.954) (-589.516) [-587.750] * (-586.239) (-592.338) (-589.874) [-602.951] -- 0:00:56
34500 -- (-587.009) (-609.154) (-591.806) [-586.419] * [-587.396] (-589.496) (-590.550) (-597.078) -- 0:00:55
35000 -- (-590.968) (-590.994) [-589.673] (-587.485) * (-588.579) (-589.198) (-588.611) [-596.942] -- 0:00:55
Average standard deviation of split frequencies: 0.044108
35500 -- (-586.704) (-588.036) [-587.557] (-591.433) * [-589.107] (-596.219) (-588.112) (-598.312) -- 0:01:21
36000 -- (-588.227) [-591.621] (-587.100) (-588.235) * (-588.688) (-586.895) [-586.680] (-598.324) -- 0:01:20
36500 -- (-587.224) (-591.352) [-587.329] (-588.465) * (-591.254) (-590.944) (-586.962) [-598.403] -- 0:01:19
37000 -- (-587.575) (-588.316) (-586.848) [-588.300] * (-589.101) (-593.097) [-588.222] (-592.505) -- 0:01:18
37500 -- [-589.137] (-588.320) (-588.759) (-587.467) * (-588.468) [-587.167] (-589.983) (-596.476) -- 0:01:17
38000 -- [-592.090] (-591.342) (-587.099) (-586.837) * (-587.915) (-588.404) (-590.484) [-598.711] -- 0:01:15
38500 -- (-590.753) (-592.191) (-587.353) [-586.837] * (-590.958) [-588.860] (-588.609) (-593.314) -- 0:01:14
39000 -- (-587.104) (-588.625) (-592.333) [-588.426] * [-587.114] (-591.641) (-586.723) (-596.512) -- 0:01:13
39500 -- (-588.572) [-588.971] (-589.591) (-587.117) * [-588.780] (-588.315) (-587.770) (-599.282) -- 0:01:12
40000 -- (-589.135) [-589.824] (-588.778) (-592.447) * (-592.920) (-586.654) [-588.665] (-586.979) -- 0:01:12
Average standard deviation of split frequencies: 0.038436
40500 -- (-589.225) (-592.401) [-587.949] (-587.486) * (-587.657) (-590.615) [-587.665] (-590.374) -- 0:01:11
41000 -- (-588.933) (-588.052) [-588.579] (-589.884) * (-587.732) (-591.313) (-587.521) [-588.408] -- 0:01:10
41500 -- (-589.108) (-590.254) [-589.990] (-587.507) * (-592.424) [-588.071] (-587.345) (-589.336) -- 0:01:09
42000 -- (-587.505) (-589.442) (-590.776) [-589.721] * (-588.757) (-587.580) [-589.712] (-589.186) -- 0:01:08
42500 -- (-589.230) [-587.994] (-588.426) (-588.954) * (-588.832) (-589.079) [-588.987] (-590.543) -- 0:01:07
43000 -- [-587.912] (-588.464) (-588.460) (-589.975) * (-587.692) (-591.790) (-588.864) [-588.123] -- 0:01:06
43500 -- (-588.400) (-590.438) (-590.798) [-591.411] * (-588.259) (-587.312) [-589.931] (-590.057) -- 0:01:05
44000 -- (-590.951) (-589.963) [-587.244] (-587.871) * (-590.463) (-588.985) (-587.161) [-589.036] -- 0:01:05
44500 -- [-590.574] (-589.551) (-590.147) (-587.825) * (-588.728) (-588.672) [-588.144] (-591.155) -- 0:01:04
45000 -- (-590.119) [-587.572] (-587.532) (-595.082) * (-589.104) [-587.513] (-588.615) (-590.183) -- 0:01:03
Average standard deviation of split frequencies: 0.035355
45500 -- (-591.754) (-587.532) [-587.216] (-590.847) * (-586.456) (-587.888) (-588.103) [-587.457] -- 0:01:02
46000 -- (-592.604) (-587.591) [-589.352] (-589.418) * (-586.603) (-587.706) (-588.030) [-588.047] -- 0:01:02
46500 -- (-590.043) (-588.353) (-590.186) [-590.086] * (-587.163) (-587.216) [-588.877] (-586.418) -- 0:01:01
47000 -- (-588.619) (-596.053) (-589.148) [-589.113] * (-586.737) [-587.357] (-590.554) (-588.077) -- 0:01:00
47500 -- (-586.631) (-590.487) [-590.651] (-587.196) * (-590.303) (-588.732) [-587.325] (-588.683) -- 0:01:00
48000 -- (-586.582) [-587.123] (-587.586) (-592.111) * [-590.128] (-591.908) (-588.967) (-589.596) -- 0:00:59
48500 -- (-588.804) (-587.771) (-589.523) [-587.211] * [-588.612] (-592.618) (-589.398) (-588.073) -- 0:00:58
49000 -- (-589.331) (-587.382) [-590.835] (-588.959) * (-588.278) [-587.918] (-589.898) (-590.544) -- 0:00:58
49500 -- (-588.782) [-590.235] (-589.650) (-587.210) * (-590.994) (-588.302) [-590.778] (-588.579) -- 0:00:57
50000 -- [-589.646] (-589.957) (-590.500) (-587.784) * (-589.974) (-587.943) [-586.364] (-589.589) -- 0:00:57
Average standard deviation of split frequencies: 0.027447
50500 -- (-590.653) [-587.750] (-588.238) (-589.801) * [-588.966] (-587.802) (-591.090) (-589.985) -- 0:00:56
51000 -- (-589.290) (-588.365) [-589.467] (-587.590) * [-591.236] (-588.086) (-590.517) (-588.514) -- 0:00:55
51500 -- (-587.626) [-589.588] (-588.738) (-587.863) * (-590.374) (-587.340) (-590.573) [-586.266] -- 0:00:55
52000 -- [-586.526] (-589.226) (-587.593) (-590.302) * [-587.463] (-588.574) (-593.073) (-591.187) -- 0:00:54
52500 -- [-586.373] (-591.468) (-589.849) (-589.186) * (-586.805) (-588.026) (-591.501) [-590.942] -- 0:01:12
53000 -- (-590.523) [-590.238] (-586.996) (-588.843) * (-587.646) [-586.733] (-590.220) (-592.762) -- 0:01:11
53500 -- (-587.799) (-588.548) [-589.431] (-589.587) * (-586.360) (-588.940) (-586.914) [-590.753] -- 0:01:10
54000 -- [-587.660] (-589.100) (-589.562) (-591.381) * [-589.231] (-587.349) (-588.799) (-587.893) -- 0:01:10
54500 -- (-590.003) (-588.664) (-588.022) [-587.173] * (-590.489) (-591.773) [-591.641] (-587.479) -- 0:01:09
55000 -- [-588.520] (-588.419) (-590.907) (-589.495) * (-590.922) (-589.745) [-589.414] (-587.438) -- 0:01:08
Average standard deviation of split frequencies: 0.027469
55500 -- (-588.844) (-588.639) (-589.478) [-588.460] * (-587.243) (-587.125) [-589.988] (-588.305) -- 0:01:08
56000 -- (-588.525) (-586.872) (-588.662) [-590.893] * (-587.863) (-587.578) (-586.422) [-587.868] -- 0:01:07
56500 -- (-591.179) [-586.605] (-588.417) (-587.647) * (-588.782) (-588.041) [-589.601] (-587.277) -- 0:01:06
57000 -- (-589.508) (-586.254) (-586.265) [-586.858] * (-588.678) (-587.880) (-589.125) [-588.749] -- 0:01:06
57500 -- [-589.895] (-586.613) (-587.582) (-589.123) * [-590.701] (-587.427) (-588.099) (-592.304) -- 0:01:05
58000 -- (-586.898) (-587.961) (-591.812) [-587.599] * (-590.328) (-588.057) (-589.889) [-590.854] -- 0:01:04
58500 -- (-587.429) [-586.552] (-589.343) (-588.750) * [-590.337] (-589.183) (-588.862) (-589.097) -- 0:01:04
59000 -- (-586.496) (-586.457) [-589.444] (-586.290) * [-587.067] (-591.887) (-588.879) (-589.794) -- 0:01:03
59500 -- (-587.992) (-587.743) (-587.920) [-587.087] * [-588.980] (-593.606) (-589.082) (-591.576) -- 0:01:03
60000 -- [-589.322] (-588.540) (-592.771) (-592.701) * (-587.044) (-586.220) [-591.138] (-587.728) -- 0:01:02
Average standard deviation of split frequencies: 0.024175
60500 -- (-589.113) (-588.811) (-587.640) [-588.599] * (-587.060) (-587.548) (-591.321) [-588.539] -- 0:01:02
61000 -- [-589.170] (-587.808) (-586.520) (-587.677) * [-589.941] (-587.158) (-589.655) (-591.960) -- 0:01:01
61500 -- (-592.245) (-589.015) [-588.271] (-590.960) * (-590.032) (-586.916) [-593.109] (-588.720) -- 0:01:01
62000 -- (-586.863) (-592.826) [-590.187] (-590.858) * (-587.588) [-590.998] (-590.148) (-589.990) -- 0:01:00
62500 -- (-586.834) (-588.268) [-586.729] (-588.748) * [-588.142] (-587.509) (-586.977) (-590.880) -- 0:01:00
63000 -- (-590.410) (-587.725) [-588.565] (-589.283) * (-587.973) [-587.658] (-588.493) (-588.772) -- 0:00:59
63500 -- (-588.532) (-587.829) [-590.155] (-588.486) * (-586.867) (-587.823) [-586.894] (-587.653) -- 0:00:58
64000 -- (-587.282) (-591.638) [-588.018] (-590.175) * (-587.970) (-589.082) [-587.112] (-586.791) -- 0:00:58
64500 -- [-594.757] (-588.544) (-588.717) (-590.526) * (-590.779) (-590.311) (-594.231) [-590.798] -- 0:00:58
65000 -- (-592.991) (-587.243) [-590.752] (-588.977) * [-588.487] (-588.223) (-591.816) (-587.301) -- 0:00:57
Average standard deviation of split frequencies: 0.024148
65500 -- (-590.394) [-588.156] (-591.569) (-587.441) * (-590.354) [-588.673] (-597.188) (-588.823) -- 0:00:57
66000 -- (-588.517) (-588.021) [-589.123] (-588.559) * (-594.104) [-587.243] (-589.978) (-589.373) -- 0:00:56
66500 -- (-587.649) [-587.434] (-589.580) (-589.028) * (-595.167) (-591.162) (-586.585) [-587.867] -- 0:00:56
67000 -- (-587.377) (-587.813) (-590.884) [-590.419] * [-590.251] (-587.821) (-586.756) (-589.251) -- 0:00:55
67500 -- (-588.371) (-587.536) [-590.430] (-587.143) * (-588.403) [-588.729] (-589.585) (-591.104) -- 0:00:55
68000 -- (-590.710) (-587.961) [-588.251] (-589.178) * (-591.457) (-586.335) [-587.208] (-587.755) -- 0:00:54
68500 -- [-588.483] (-588.515) (-587.953) (-588.922) * [-589.264] (-587.989) (-588.825) (-587.186) -- 0:01:07
69000 -- (-588.085) (-586.876) (-588.991) [-592.254] * (-590.139) (-588.387) (-589.927) [-588.177] -- 0:01:07
69500 -- [-589.841] (-589.023) (-589.392) (-589.491) * (-588.280) (-592.035) [-588.482] (-594.156) -- 0:01:06
70000 -- [-589.654] (-588.144) (-594.841) (-588.693) * (-587.171) (-589.614) (-591.227) [-590.162] -- 0:01:06
Average standard deviation of split frequencies: 0.022554
70500 -- [-587.420] (-591.378) (-588.145) (-589.416) * (-589.486) [-586.367] (-591.118) (-591.145) -- 0:01:05
71000 -- [-586.786] (-590.375) (-587.518) (-590.042) * (-589.323) [-586.882] (-588.638) (-589.383) -- 0:01:05
71500 -- (-587.502) (-588.340) (-587.945) [-590.872] * (-591.594) [-588.620] (-588.439) (-589.084) -- 0:01:04
72000 -- (-587.945) (-587.756) (-591.437) [-586.529] * [-591.632] (-588.127) (-586.966) (-589.218) -- 0:01:04
72500 -- (-591.957) (-589.697) (-589.382) [-590.614] * (-587.614) (-589.467) (-588.708) [-588.631] -- 0:01:03
73000 -- (-589.239) (-587.930) (-588.439) [-588.314] * [-587.226] (-587.684) (-590.554) (-590.581) -- 0:01:03
73500 -- (-592.107) [-586.268] (-588.025) (-588.828) * [-587.865] (-586.869) (-586.583) (-587.178) -- 0:01:03
74000 -- [-590.240] (-588.313) (-590.323) (-590.294) * (-587.480) (-588.539) [-586.399] (-588.067) -- 0:01:02
74500 -- (-587.784) [-589.761] (-590.924) (-595.156) * [-588.715] (-592.251) (-590.914) (-588.023) -- 0:01:02
75000 -- [-587.941] (-587.991) (-591.724) (-594.720) * (-587.219) [-588.080] (-589.494) (-586.712) -- 0:01:01
Average standard deviation of split frequencies: 0.022020
75500 -- (-588.409) (-587.962) [-589.413] (-592.609) * (-588.336) (-590.968) (-588.192) [-586.512] -- 0:01:01
76000 -- [-587.743] (-587.855) (-589.892) (-587.607) * (-587.578) (-587.813) [-588.108] (-587.185) -- 0:01:00
76500 -- [-587.956] (-592.428) (-589.487) (-586.106) * [-586.079] (-589.134) (-587.716) (-586.789) -- 0:01:00
77000 -- (-589.686) (-591.549) (-588.322) [-586.106] * [-586.426] (-588.458) (-591.390) (-588.786) -- 0:00:59
77500 -- (-588.819) [-588.660] (-587.228) (-586.605) * [-587.290] (-588.223) (-590.367) (-589.669) -- 0:00:59
78000 -- [-586.571] (-587.360) (-588.201) (-586.968) * [-588.040] (-586.555) (-591.475) (-586.598) -- 0:00:59
78500 -- [-588.945] (-587.559) (-589.119) (-587.444) * (-588.202) (-587.757) [-587.313] (-588.053) -- 0:00:58
79000 -- (-588.921) (-588.883) [-588.997] (-587.689) * (-588.338) (-588.912) [-587.806] (-590.159) -- 0:00:58
79500 -- [-588.229] (-588.686) (-590.585) (-593.406) * [-586.606] (-589.545) (-589.175) (-589.422) -- 0:00:57
80000 -- (-586.678) [-586.730] (-590.231) (-589.074) * (-586.972) [-591.780] (-589.219) (-593.616) -- 0:00:57
Average standard deviation of split frequencies: 0.020915
80500 -- [-588.551] (-590.589) (-587.152) (-588.999) * (-588.238) (-587.741) [-589.578] (-587.167) -- 0:00:57
81000 -- [-588.895] (-587.864) (-590.413) (-587.916) * (-589.924) (-590.450) (-591.869) [-587.685] -- 0:00:56
81500 -- (-589.462) [-592.224] (-594.110) (-587.141) * [-588.373] (-589.731) (-589.945) (-588.323) -- 0:00:56
82000 -- (-590.178) [-588.903] (-594.226) (-591.864) * (-587.454) (-587.247) [-588.463] (-589.285) -- 0:00:55
82500 -- (-587.787) (-590.052) [-594.003] (-586.594) * [-588.252] (-588.766) (-587.153) (-588.089) -- 0:00:55
83000 -- (-588.891) (-588.961) [-594.422] (-589.594) * (-588.805) [-588.081] (-591.937) (-589.143) -- 0:00:55
83500 -- [-587.519] (-589.554) (-587.202) (-586.828) * (-592.243) (-591.930) (-592.957) [-589.564] -- 0:00:54
84000 -- (-593.010) (-587.663) [-592.340] (-589.341) * [-588.779] (-587.406) (-590.522) (-588.841) -- 0:00:54
84500 -- (-587.278) (-586.354) [-588.544] (-590.075) * (-587.949) (-587.365) (-589.739) [-586.902] -- 0:00:54
85000 -- [-587.373] (-591.327) (-587.622) (-588.440) * (-586.626) (-586.570) (-590.145) [-588.605] -- 0:01:04
Average standard deviation of split frequencies: 0.020621
85500 -- (-588.226) (-589.154) (-592.603) [-588.160] * (-589.372) (-590.273) (-588.824) [-587.275] -- 0:01:04
86000 -- (-588.416) (-588.320) [-587.132] (-587.322) * [-590.653] (-588.182) (-587.618) (-589.666) -- 0:01:03
86500 -- [-587.589] (-587.166) (-588.993) (-588.900) * (-589.700) (-587.701) [-586.520] (-586.094) -- 0:01:03
87000 -- (-587.006) (-587.711) (-587.245) [-587.553] * (-592.036) (-587.721) (-586.889) [-587.343] -- 0:01:02
87500 -- (-588.375) (-588.522) (-587.079) [-592.142] * [-590.054] (-588.042) (-590.964) (-587.565) -- 0:01:02
88000 -- (-590.028) (-587.095) [-588.656] (-587.768) * (-587.862) (-588.174) (-589.347) [-588.992] -- 0:01:02
88500 -- (-591.237) (-586.550) [-587.300] (-587.950) * (-588.040) (-587.614) [-589.056] (-587.802) -- 0:01:01
89000 -- (-589.730) [-588.305] (-589.276) (-588.355) * (-588.052) (-588.935) (-588.172) [-587.319] -- 0:01:01
89500 -- (-591.114) (-586.253) [-587.263] (-588.048) * (-587.555) [-586.987] (-588.795) (-586.167) -- 0:01:01
90000 -- (-590.655) [-587.048] (-588.417) (-593.076) * (-590.591) (-586.440) [-586.944] (-586.935) -- 0:01:00
Average standard deviation of split frequencies: 0.020277
90500 -- (-589.347) [-587.067] (-590.097) (-588.618) * (-588.659) (-587.527) [-587.328] (-586.642) -- 0:01:00
91000 -- (-588.690) (-586.555) [-589.415] (-587.626) * (-587.285) (-594.648) [-592.777] (-586.923) -- 0:00:59
91500 -- [-587.115] (-590.075) (-594.355) (-587.175) * (-586.490) (-588.724) (-591.065) [-588.537] -- 0:00:59
92000 -- (-586.490) (-588.141) (-593.521) [-588.972] * (-587.331) (-588.000) [-587.069] (-593.908) -- 0:00:59
92500 -- (-590.311) (-588.175) (-590.053) [-587.944] * (-589.790) (-588.356) [-586.522] (-588.303) -- 0:00:58
93000 -- [-588.398] (-589.128) (-588.358) (-586.803) * (-590.340) [-587.433] (-587.500) (-588.644) -- 0:00:58
93500 -- (-586.928) [-589.374] (-587.780) (-589.171) * (-587.358) (-586.965) [-586.494] (-588.875) -- 0:00:58
94000 -- (-589.540) (-588.107) [-590.508] (-588.020) * (-588.503) (-588.382) (-589.407) [-586.877] -- 0:00:57
94500 -- [-589.029] (-589.665) (-588.236) (-589.845) * (-589.225) (-602.597) (-588.888) [-591.095] -- 0:00:57
95000 -- (-596.555) [-587.642] (-586.838) (-587.915) * [-587.829] (-596.207) (-586.921) (-586.730) -- 0:00:57
Average standard deviation of split frequencies: 0.019151
95500 -- [-593.047] (-588.534) (-587.425) (-588.681) * (-588.948) [-587.856] (-588.572) (-587.688) -- 0:00:56
96000 -- (-587.002) [-593.481] (-588.184) (-587.739) * (-589.503) [-586.450] (-588.135) (-588.030) -- 0:00:56
96500 -- [-586.711] (-587.120) (-587.320) (-586.725) * (-593.236) [-589.318] (-587.661) (-587.649) -- 0:00:56
97000 -- (-589.018) [-588.201] (-587.317) (-586.355) * (-599.104) [-588.379] (-587.340) (-587.231) -- 0:00:55
97500 -- [-590.458] (-592.815) (-589.457) (-587.025) * (-591.874) (-591.254) (-587.023) [-586.353] -- 0:00:55
98000 -- (-589.421) (-587.053) (-587.955) [-586.602] * [-587.644] (-592.016) (-591.744) (-586.345) -- 0:00:55
98500 -- (-588.094) (-588.343) (-589.951) [-588.533] * (-586.720) (-592.224) [-590.754] (-590.787) -- 0:00:54
99000 -- (-587.926) (-591.164) [-589.771] (-586.980) * (-587.363) (-595.500) (-588.539) [-589.105] -- 0:00:54
99500 -- (-587.843) (-592.986) [-587.966] (-586.734) * (-586.663) (-592.979) [-590.846] (-588.301) -- 0:00:54
100000 -- (-587.831) [-589.077] (-591.066) (-587.595) * (-586.985) (-591.644) [-589.408] (-587.161) -- 0:00:54
Average standard deviation of split frequencies: 0.017795
100500 -- (-586.271) [-589.180] (-589.686) (-586.897) * (-589.490) (-588.612) [-588.272] (-587.445) -- 0:00:53
101000 -- (-588.467) (-588.317) (-587.847) [-587.344] * (-588.353) [-591.778] (-589.126) (-589.158) -- 0:00:53
101500 -- (-588.197) (-589.482) [-587.477] (-587.649) * (-589.169) (-588.429) (-587.941) [-587.113] -- 0:00:53
102000 -- [-589.405] (-590.225) (-591.247) (-587.942) * (-588.708) [-587.634] (-587.845) (-592.725) -- 0:01:01
102500 -- [-588.434] (-589.909) (-590.719) (-586.753) * [-591.678] (-590.000) (-589.156) (-588.552) -- 0:01:01
103000 -- (-587.986) [-590.323] (-593.641) (-589.746) * [-588.047] (-588.017) (-590.849) (-590.740) -- 0:01:00
103500 -- [-590.661] (-592.059) (-589.787) (-587.403) * (-587.627) (-587.492) (-587.791) [-587.839] -- 0:01:00
104000 -- (-590.745) (-593.488) (-586.884) [-592.045] * (-586.951) (-587.910) (-586.868) [-592.182] -- 0:01:00
104500 -- (-592.655) (-588.371) [-587.370] (-587.617) * (-587.990) [-588.138] (-588.210) (-588.940) -- 0:00:59
105000 -- (-589.154) (-590.306) [-587.459] (-588.265) * (-586.841) (-588.052) (-588.679) [-590.046] -- 0:00:59
Average standard deviation of split frequencies: 0.015788
105500 -- (-587.565) (-592.623) (-589.266) [-588.765] * (-587.564) (-588.059) (-586.672) [-589.256] -- 0:00:59
106000 -- (-589.530) [-589.085] (-587.385) (-591.317) * (-589.181) [-586.316] (-590.507) (-589.671) -- 0:00:59
106500 -- [-589.428] (-589.142) (-588.196) (-591.589) * (-589.443) (-588.315) [-587.964] (-592.326) -- 0:00:58
107000 -- (-588.906) [-587.713] (-586.799) (-590.383) * (-588.578) (-587.147) (-589.947) [-587.095] -- 0:00:58
107500 -- (-589.527) [-588.422] (-588.649) (-588.704) * (-588.907) (-588.083) [-589.140] (-587.112) -- 0:00:58
108000 -- (-589.014) (-587.797) (-587.153) [-587.954] * (-588.460) (-586.407) [-587.381] (-587.183) -- 0:00:57
108500 -- (-588.521) (-586.891) (-588.876) [-592.393] * (-591.155) [-587.931] (-586.963) (-590.044) -- 0:00:57
109000 -- (-590.838) (-587.438) [-588.948] (-590.280) * (-588.979) (-588.288) [-591.258] (-587.058) -- 0:00:57
109500 -- [-590.829] (-588.769) (-588.287) (-586.710) * [-589.968] (-586.716) (-589.762) (-590.890) -- 0:00:56
110000 -- [-587.945] (-590.296) (-587.002) (-587.617) * (-588.062) [-587.640] (-590.398) (-589.414) -- 0:00:56
Average standard deviation of split frequencies: 0.015974
110500 -- (-589.058) (-590.811) [-589.208] (-592.595) * (-590.016) (-588.266) (-590.107) [-588.105] -- 0:00:56
111000 -- (-586.493) (-588.339) (-589.877) [-592.216] * (-589.444) (-586.321) [-587.073] (-591.765) -- 0:00:56
111500 -- (-589.392) [-586.734] (-587.986) (-588.268) * (-588.101) (-587.475) [-587.443] (-591.947) -- 0:00:55
112000 -- (-588.082) (-588.980) [-590.835] (-586.628) * [-588.545] (-588.058) (-588.568) (-592.825) -- 0:00:55
112500 -- [-587.860] (-589.271) (-590.962) (-587.367) * (-591.496) (-590.067) [-587.096] (-590.763) -- 0:00:55
113000 -- (-587.311) (-587.802) (-588.042) [-586.587] * (-586.921) (-587.258) (-587.097) [-589.574] -- 0:00:54
113500 -- [-587.504] (-590.297) (-587.329) (-587.897) * [-587.946] (-588.114) (-587.608) (-587.544) -- 0:00:54
114000 -- (-591.172) (-588.069) (-588.895) [-586.486] * [-589.718] (-588.882) (-586.640) (-589.777) -- 0:00:54
114500 -- (-588.935) (-589.749) [-589.812] (-587.054) * (-591.135) (-587.776) (-589.681) [-586.314] -- 0:00:54
115000 -- (-591.252) [-586.567] (-589.738) (-590.028) * (-587.564) [-588.233] (-589.508) (-588.189) -- 0:00:53
Average standard deviation of split frequencies: 0.017474
115500 -- (-588.074) (-590.201) [-588.259] (-587.450) * (-588.844) (-587.937) (-589.732) [-587.330] -- 0:00:53
116000 -- (-589.586) (-591.062) (-587.574) [-586.566] * (-587.745) (-588.835) (-588.291) [-586.508] -- 0:00:53
116500 -- (-587.211) [-588.916] (-589.882) (-588.518) * (-589.311) (-587.570) [-586.871] (-587.622) -- 0:00:53
117000 -- (-586.814) (-586.367) [-589.780] (-590.634) * (-595.449) (-589.062) [-587.621] (-587.833) -- 0:00:52
117500 -- (-590.808) (-587.799) (-589.665) [-587.766] * (-590.785) (-594.029) (-588.292) [-589.394] -- 0:00:52
118000 -- (-587.624) (-589.076) [-589.370] (-590.095) * [-588.515] (-590.779) (-588.754) (-591.110) -- 0:00:52
118500 -- [-587.569] (-589.471) (-588.471) (-586.411) * [-587.508] (-591.226) (-587.227) (-587.551) -- 0:00:52
119000 -- (-586.765) (-590.359) (-589.370) [-591.346] * [-586.604] (-587.339) (-591.446) (-587.818) -- 0:00:59
119500 -- (-589.445) [-586.995] (-587.331) (-586.498) * [-588.410] (-588.081) (-586.914) (-586.712) -- 0:00:58
120000 -- (-590.980) [-587.696] (-588.407) (-586.571) * [-589.403] (-588.478) (-586.487) (-589.095) -- 0:00:58
Average standard deviation of split frequencies: 0.016449
120500 -- (-588.130) (-596.154) (-586.966) [-593.452] * (-591.653) (-587.568) (-587.609) [-589.042] -- 0:00:58
121000 -- (-586.807) [-591.446] (-588.553) (-592.282) * [-588.967] (-587.872) (-587.353) (-591.864) -- 0:00:58
121500 -- (-587.885) (-590.654) [-588.687] (-590.204) * (-589.318) (-588.618) (-587.329) [-590.615] -- 0:00:57
122000 -- (-588.607) (-588.733) [-586.836] (-592.947) * (-586.702) (-588.287) [-587.866] (-590.722) -- 0:00:57
122500 -- [-587.873] (-589.657) (-592.036) (-587.772) * (-586.474) [-588.038] (-587.134) (-590.843) -- 0:00:57
123000 -- (-593.896) (-589.047) (-589.317) [-590.070] * [-586.433] (-588.266) (-590.469) (-589.393) -- 0:00:57
123500 -- (-587.426) (-592.243) (-589.283) [-589.813] * (-586.673) (-589.046) (-588.314) [-586.876] -- 0:00:56
124000 -- [-591.228] (-589.557) (-586.442) (-592.061) * [-587.343] (-586.770) (-589.732) (-586.531) -- 0:00:56
124500 -- (-589.964) (-588.454) (-586.069) [-590.006] * (-588.132) (-590.478) [-588.503] (-590.695) -- 0:00:56
125000 -- (-589.045) [-589.771] (-588.705) (-588.678) * (-589.139) (-588.533) [-589.591] (-590.428) -- 0:00:56
Average standard deviation of split frequencies: 0.013784
125500 -- (-587.848) (-589.036) [-588.511] (-590.059) * (-587.853) (-588.176) [-590.277] (-588.280) -- 0:00:55
126000 -- (-590.244) (-587.242) (-590.643) [-587.769] * [-589.096] (-589.693) (-589.039) (-588.004) -- 0:00:55
126500 -- (-588.775) (-588.453) (-590.791) [-587.143] * (-588.130) [-590.314] (-588.006) (-587.541) -- 0:00:55
127000 -- (-588.882) (-588.658) (-590.299) [-588.075] * (-588.245) (-587.925) (-588.987) [-587.806] -- 0:00:54
127500 -- (-586.672) (-586.499) (-589.534) [-589.577] * (-588.542) (-591.463) (-589.129) [-588.738] -- 0:00:54
128000 -- (-586.762) (-586.855) [-589.269] (-592.685) * [-586.861] (-590.335) (-590.947) (-588.859) -- 0:00:54
128500 -- (-589.785) (-588.209) (-587.135) [-588.926] * (-588.051) (-587.352) (-590.740) [-588.992] -- 0:00:54
129000 -- (-586.667) (-592.759) [-588.376] (-589.268) * (-590.248) (-589.017) (-590.710) [-589.153] -- 0:00:54
129500 -- [-587.758] (-588.086) (-587.626) (-589.367) * (-587.154) (-589.837) [-591.832] (-589.879) -- 0:00:53
130000 -- (-588.763) (-592.543) [-588.841] (-588.123) * (-586.982) (-590.457) [-590.263] (-590.074) -- 0:00:53
Average standard deviation of split frequencies: 0.016140
130500 -- [-593.013] (-589.479) (-587.410) (-589.041) * (-587.282) [-587.575] (-586.879) (-592.682) -- 0:00:53
131000 -- (-588.583) (-591.606) (-586.565) [-588.292] * (-586.870) [-588.494] (-586.962) (-589.616) -- 0:00:53
131500 -- (-586.560) (-588.715) [-590.041] (-589.478) * [-586.882] (-587.999) (-587.587) (-592.683) -- 0:00:52
132000 -- [-586.816] (-589.148) (-589.165) (-588.228) * (-589.947) (-590.786) [-587.119] (-589.871) -- 0:00:52
132500 -- (-588.181) (-589.149) (-587.775) [-586.796] * (-588.080) (-590.491) [-586.912] (-589.237) -- 0:00:52
133000 -- (-589.068) (-594.716) (-590.199) [-589.716] * (-587.786) (-590.625) [-587.036] (-587.107) -- 0:00:52
133500 -- (-586.743) [-588.222] (-592.540) (-587.865) * (-588.564) [-589.883] (-589.319) (-590.146) -- 0:00:51
134000 -- [-592.921] (-588.273) (-589.593) (-588.771) * (-587.723) (-590.467) (-592.437) [-587.055] -- 0:00:51
134500 -- [-589.344] (-591.052) (-587.589) (-590.445) * (-586.699) (-587.172) [-587.238] (-587.703) -- 0:00:51
135000 -- (-588.875) (-587.611) [-590.462] (-589.171) * (-587.796) [-589.765] (-587.928) (-586.884) -- 0:00:51
Average standard deviation of split frequencies: 0.018061
135500 -- (-587.341) [-588.020] (-592.831) (-597.800) * (-586.807) (-587.954) [-588.141] (-586.259) -- 0:00:51
136000 -- (-587.073) (-588.930) (-589.768) [-590.189] * (-588.268) [-588.052] (-587.986) (-587.329) -- 0:00:57
136500 -- (-590.483) (-588.114) (-587.691) [-588.171] * (-586.533) (-590.262) (-590.797) [-587.194] -- 0:00:56
137000 -- (-588.403) [-587.747] (-588.764) (-587.558) * (-587.057) [-586.501] (-590.217) (-587.730) -- 0:00:56
137500 -- (-588.202) (-587.266) [-587.946] (-588.192) * [-587.591] (-589.388) (-589.573) (-590.239) -- 0:00:56
138000 -- [-587.355] (-588.892) (-588.977) (-586.997) * (-587.015) (-588.716) [-589.893] (-587.800) -- 0:00:56
138500 -- (-587.438) [-587.430] (-588.660) (-586.861) * [-588.909] (-591.693) (-591.146) (-589.451) -- 0:00:55
139000 -- (-587.775) [-586.173] (-586.284) (-588.515) * [-587.165] (-597.496) (-588.994) (-589.430) -- 0:00:55
139500 -- (-587.906) (-590.518) [-588.775] (-587.338) * [-587.385] (-590.493) (-587.721) (-590.923) -- 0:00:55
140000 -- (-588.664) (-593.700) (-586.959) [-587.829] * (-592.740) (-589.536) (-586.942) [-588.946] -- 0:00:55
Average standard deviation of split frequencies: 0.017259
140500 -- (-586.453) (-589.912) (-588.934) [-587.483] * (-588.794) (-591.219) [-587.204] (-589.180) -- 0:00:55
141000 -- (-592.841) (-589.374) [-587.829] (-591.258) * (-587.662) (-588.187) [-588.892] (-588.459) -- 0:00:54
141500 -- (-592.785) [-588.430] (-593.189) (-586.955) * [-587.127] (-587.920) (-590.676) (-587.210) -- 0:00:54
142000 -- (-589.622) (-589.090) (-589.303) [-586.691] * (-586.555) (-586.820) (-586.604) [-586.236] -- 0:00:54
142500 -- (-587.313) (-589.603) (-588.426) [-587.817] * (-586.757) [-591.265] (-587.532) (-587.229) -- 0:00:54
143000 -- [-588.074] (-590.605) (-587.401) (-587.810) * (-589.999) [-588.385] (-590.300) (-588.859) -- 0:00:53
143500 -- (-589.010) (-590.548) (-590.256) [-587.188] * (-587.260) (-587.806) (-590.592) [-588.076] -- 0:00:53
144000 -- [-589.652] (-587.859) (-592.965) (-589.649) * (-588.082) [-587.244] (-587.522) (-586.777) -- 0:00:53
144500 -- (-590.666) (-589.674) [-591.068] (-593.213) * (-591.799) (-586.258) [-591.189] (-588.457) -- 0:00:53
145000 -- (-590.065) [-589.958] (-587.079) (-586.666) * (-589.361) (-586.258) (-594.238) [-592.467] -- 0:00:53
Average standard deviation of split frequencies: 0.016628
145500 -- [-588.011] (-588.098) (-590.115) (-587.322) * (-590.847) (-588.340) [-591.680] (-591.732) -- 0:00:52
146000 -- (-588.383) (-586.606) (-591.248) [-587.769] * (-590.742) [-587.259] (-590.663) (-589.427) -- 0:00:52
146500 -- [-588.591] (-587.030) (-589.097) (-590.304) * (-588.002) (-586.631) [-586.873] (-586.234) -- 0:00:52
147000 -- (-588.097) (-589.688) [-591.350] (-590.537) * (-587.035) (-588.326) (-589.330) [-587.714] -- 0:00:52
147500 -- (-587.990) (-590.003) (-590.097) [-592.647] * (-587.960) (-586.603) [-590.792] (-586.317) -- 0:00:52
148000 -- [-587.880] (-590.029) (-588.359) (-592.821) * (-589.547) (-590.407) [-588.490] (-587.214) -- 0:00:51
148500 -- (-586.977) (-588.502) [-588.765] (-596.877) * (-589.699) (-589.311) [-587.929] (-590.984) -- 0:00:51
149000 -- (-591.956) (-586.835) [-588.865] (-589.309) * (-589.154) (-588.413) (-594.718) [-589.949] -- 0:00:51
149500 -- (-587.884) (-588.950) (-587.605) [-589.216] * (-587.912) [-593.571] (-588.187) (-587.531) -- 0:00:51
150000 -- [-586.719] (-588.278) (-588.476) (-590.827) * (-589.305) [-588.310] (-589.108) (-588.604) -- 0:00:51
Average standard deviation of split frequencies: 0.014705
150500 -- (-590.782) (-590.564) [-588.685] (-587.994) * [-589.020] (-591.072) (-592.390) (-589.000) -- 0:00:50
151000 -- (-592.834) (-587.776) (-589.331) [-586.798] * (-589.093) (-591.249) [-589.160] (-589.890) -- 0:00:50
151500 -- [-591.896] (-591.128) (-587.565) (-587.136) * [-587.505] (-589.545) (-590.131) (-586.558) -- 0:00:50
152000 -- (-587.887) (-590.063) (-591.916) [-586.722] * (-587.812) [-589.496] (-591.497) (-586.781) -- 0:00:50
152500 -- (-589.321) (-587.398) [-588.401] (-587.680) * (-591.040) (-587.513) (-587.837) [-590.156] -- 0:00:55
153000 -- (-594.343) [-587.340] (-592.085) (-589.681) * (-591.260) (-588.476) (-589.981) [-587.874] -- 0:00:55
153500 -- (-588.093) (-587.129) [-590.216] (-587.666) * (-590.519) (-592.876) [-587.225] (-590.419) -- 0:00:55
154000 -- (-586.968) (-589.383) [-589.561] (-586.929) * (-587.932) (-588.589) (-587.155) [-587.227] -- 0:00:54
154500 -- (-589.721) (-588.361) [-586.549] (-587.378) * [-587.593] (-588.054) (-589.549) (-587.663) -- 0:00:54
155000 -- [-588.149] (-588.938) (-586.515) (-587.823) * (-588.920) [-588.673] (-588.085) (-588.013) -- 0:00:54
Average standard deviation of split frequencies: 0.014950
155500 -- (-592.534) (-587.562) [-586.255] (-586.703) * (-589.824) (-589.450) (-589.593) [-588.176] -- 0:00:54
156000 -- (-586.707) (-587.521) [-587.016] (-586.395) * [-588.297] (-588.055) (-587.680) (-592.347) -- 0:00:54
156500 -- (-586.857) (-587.369) (-586.748) [-590.213] * (-588.584) [-588.833] (-587.250) (-587.317) -- 0:00:53
157000 -- [-591.208] (-589.439) (-588.292) (-588.017) * (-587.932) (-588.065) [-590.454] (-587.918) -- 0:00:53
157500 -- (-588.688) (-587.136) [-587.070] (-586.810) * (-587.964) (-588.330) (-587.091) [-586.209] -- 0:00:53
158000 -- (-586.957) (-586.910) (-590.097) [-586.950] * (-587.803) (-588.146) (-587.788) [-590.925] -- 0:00:53
158500 -- (-587.188) (-590.213) (-590.986) [-589.063] * (-588.521) [-587.508] (-588.282) (-589.883) -- 0:00:53
159000 -- [-588.887] (-587.749) (-589.333) (-588.976) * [-590.151] (-586.651) (-587.405) (-589.932) -- 0:00:52
159500 -- (-588.148) (-587.191) (-590.074) [-587.393] * (-587.676) (-587.057) [-590.433] (-586.969) -- 0:00:52
160000 -- (-586.421) (-587.630) [-587.415] (-588.507) * [-587.082] (-587.517) (-587.335) (-587.172) -- 0:00:52
Average standard deviation of split frequencies: 0.015134
160500 -- (-590.832) (-589.961) [-588.008] (-588.394) * (-588.047) (-589.845) (-587.811) [-586.326] -- 0:00:52
161000 -- (-593.467) (-589.124) (-587.661) [-588.090] * (-588.298) (-587.420) (-587.525) [-587.657] -- 0:00:52
161500 -- (-591.362) (-591.580) [-589.765] (-587.442) * (-587.722) (-588.636) (-588.569) [-586.677] -- 0:00:51
162000 -- [-589.132] (-587.335) (-589.550) (-588.252) * (-588.656) (-588.320) [-586.948] (-587.877) -- 0:00:51
162500 -- (-592.780) (-590.225) [-587.747] (-593.052) * (-586.365) (-588.873) [-586.967] (-588.227) -- 0:00:51
163000 -- (-588.002) (-588.958) [-587.885] (-596.702) * (-586.652) (-588.956) [-588.570] (-588.048) -- 0:00:51
163500 -- [-590.316] (-587.969) (-589.660) (-588.481) * [-588.158] (-586.514) (-588.003) (-588.140) -- 0:00:51
164000 -- (-589.857) (-590.502) [-590.832] (-588.367) * (-590.258) [-588.920] (-590.168) (-586.758) -- 0:00:50
164500 -- (-590.105) [-588.005] (-589.274) (-589.066) * (-590.010) (-586.580) [-587.547] (-588.868) -- 0:00:50
165000 -- (-593.476) (-588.614) [-589.749] (-587.690) * (-587.235) [-587.832] (-591.302) (-592.333) -- 0:00:50
Average standard deviation of split frequencies: 0.014946
165500 -- (-591.478) [-587.740] (-588.244) (-588.480) * [-586.938] (-589.694) (-591.102) (-592.056) -- 0:00:50
166000 -- (-589.925) (-589.595) [-588.342] (-588.079) * (-592.804) [-587.533] (-588.030) (-590.355) -- 0:00:50
166500 -- [-589.627] (-586.313) (-587.803) (-587.015) * (-587.104) (-588.919) [-587.434] (-588.024) -- 0:00:50
167000 -- (-590.455) (-590.854) (-588.015) [-587.291] * [-586.915] (-587.412) (-590.759) (-589.888) -- 0:00:49
167500 -- (-587.406) [-587.534] (-587.921) (-589.719) * (-588.307) [-588.301] (-588.277) (-588.460) -- 0:00:49
168000 -- [-588.161] (-589.804) (-587.598) (-590.059) * (-591.133) (-587.500) [-588.213] (-587.853) -- 0:00:49
168500 -- [-588.212] (-594.152) (-587.441) (-588.037) * [-592.010] (-587.188) (-587.876) (-587.055) -- 0:00:49
169000 -- (-586.738) (-590.791) (-587.558) [-591.450] * (-590.388) (-587.626) [-586.607] (-591.103) -- 0:00:49
169500 -- (-588.618) [-589.945] (-586.572) (-590.665) * [-589.254] (-587.126) (-587.043) (-591.591) -- 0:00:48
170000 -- [-589.372] (-588.448) (-587.954) (-593.280) * (-586.908) (-588.262) (-586.650) [-588.612] -- 0:00:53
Average standard deviation of split frequencies: 0.015119
170500 -- (-588.444) (-586.899) [-586.540] (-590.361) * (-591.743) (-592.642) (-587.595) [-586.318] -- 0:00:53
171000 -- (-589.574) (-588.343) [-589.411] (-588.835) * (-589.759) [-587.935] (-588.818) (-590.154) -- 0:00:53
171500 -- (-589.552) (-589.657) [-588.787] (-596.905) * (-591.304) (-589.863) [-589.656] (-590.306) -- 0:00:53
172000 -- (-587.577) (-595.946) (-589.047) [-586.820] * [-586.789] (-599.567) (-591.581) (-587.238) -- 0:00:52
172500 -- (-587.348) (-592.920) [-587.044] (-587.313) * (-589.250) (-587.412) (-588.069) [-590.807] -- 0:00:52
173000 -- (-589.117) [-587.115] (-588.595) (-589.604) * [-586.773] (-588.206) (-591.247) (-590.926) -- 0:00:52
173500 -- [-588.659] (-587.224) (-590.053) (-589.947) * [-588.207] (-590.732) (-590.186) (-591.086) -- 0:00:52
174000 -- (-589.944) (-587.476) (-588.146) [-593.326] * (-587.032) [-589.756] (-586.514) (-589.760) -- 0:00:52
174500 -- (-589.622) (-587.338) [-586.646] (-587.186) * [-586.834] (-590.581) (-589.641) (-589.066) -- 0:00:52
175000 -- (-587.736) (-587.936) [-586.243] (-587.492) * [-586.536] (-588.978) (-588.826) (-588.642) -- 0:00:51
Average standard deviation of split frequencies: 0.014802
175500 -- (-587.574) (-586.916) (-587.307) [-587.341] * [-587.722] (-588.798) (-590.224) (-592.287) -- 0:00:51
176000 -- [-591.128] (-589.753) (-586.523) (-587.509) * [-591.820] (-591.506) (-588.340) (-589.341) -- 0:00:51
176500 -- (-590.648) (-587.254) (-586.587) [-588.826] * (-588.750) (-588.976) (-588.968) [-589.055] -- 0:00:51
177000 -- (-587.736) [-588.576] (-588.171) (-587.972) * (-588.328) (-588.253) (-587.849) [-590.612] -- 0:00:51
177500 -- [-590.114] (-591.176) (-587.319) (-586.493) * (-589.672) [-588.002] (-587.349) (-589.777) -- 0:00:50
178000 -- [-587.556] (-587.070) (-588.755) (-587.486) * (-587.941) [-587.562] (-587.737) (-590.672) -- 0:00:50
178500 -- (-587.129) [-587.565] (-586.877) (-587.748) * (-590.302) (-586.898) [-588.166] (-587.588) -- 0:00:50
179000 -- (-589.109) [-587.547] (-592.430) (-589.138) * [-587.706] (-588.492) (-589.043) (-586.898) -- 0:00:50
179500 -- (-587.882) (-590.259) (-590.613) [-588.752] * (-588.649) (-587.703) (-595.321) [-586.635] -- 0:00:50
180000 -- (-587.458) (-587.548) [-587.613] (-592.978) * [-592.153] (-588.311) (-588.925) (-587.744) -- 0:00:50
Average standard deviation of split frequencies: 0.014121
180500 -- [-589.056] (-589.319) (-588.334) (-590.105) * (-586.977) [-587.572] (-590.211) (-590.596) -- 0:00:49
181000 -- (-590.533) [-588.809] (-588.647) (-589.458) * (-586.459) (-586.977) (-589.868) [-590.462] -- 0:00:49
181500 -- (-589.653) (-591.816) (-587.725) [-588.862] * (-588.855) (-586.291) (-589.462) [-587.994] -- 0:00:49
182000 -- [-588.700] (-590.202) (-587.467) (-590.488) * (-592.375) [-587.944] (-589.590) (-588.536) -- 0:00:49
182500 -- (-589.191) (-589.196) (-589.193) [-588.449] * (-592.719) (-586.895) (-589.336) [-588.085] -- 0:00:49
183000 -- (-588.111) (-587.650) (-596.204) [-588.854] * (-588.779) (-592.195) [-586.417] (-589.452) -- 0:00:49
183500 -- (-587.375) [-591.387] (-591.015) (-590.063) * [-588.239] (-590.712) (-593.337) (-588.439) -- 0:00:48
184000 -- (-591.532) (-592.623) [-591.762] (-590.556) * [-587.894] (-590.527) (-588.696) (-591.528) -- 0:00:48
184500 -- (-590.526) (-593.845) [-591.094] (-588.388) * (-591.530) (-587.881) (-591.733) [-587.695] -- 0:00:48
185000 -- (-587.554) (-586.256) (-589.388) [-588.785] * (-587.844) (-587.201) [-587.414] (-588.518) -- 0:00:48
Average standard deviation of split frequencies: 0.013567
185500 -- (-587.234) [-586.705] (-589.650) (-587.563) * (-589.617) (-586.788) (-587.456) [-586.377] -- 0:00:48
186000 -- [-588.049] (-586.952) (-590.646) (-589.739) * (-590.225) [-588.422] (-586.436) (-586.748) -- 0:00:48
186500 -- (-586.593) [-587.606] (-591.311) (-589.933) * (-589.471) (-587.485) [-586.826] (-587.759) -- 0:00:52
187000 -- (-590.687) (-590.638) [-589.685] (-588.742) * (-593.621) [-589.027] (-587.836) (-587.816) -- 0:00:52
187500 -- (-586.983) (-587.557) (-589.010) [-587.945] * (-586.837) (-587.980) [-587.949] (-587.424) -- 0:00:52
188000 -- [-586.519] (-593.674) (-587.127) (-590.162) * (-590.571) (-588.201) (-587.533) [-588.847] -- 0:00:51
188500 -- [-586.543] (-587.453) (-588.447) (-589.738) * (-592.578) (-591.842) (-588.591) [-586.718] -- 0:00:51
189000 -- (-586.768) (-589.271) (-588.088) [-587.035] * (-590.852) [-592.576] (-586.493) (-587.272) -- 0:00:51
189500 -- [-586.771] (-587.884) (-587.933) (-588.718) * [-589.850] (-588.665) (-587.810) (-588.030) -- 0:00:51
190000 -- (-587.100) (-588.963) (-588.616) [-586.766] * (-589.740) [-589.133] (-586.792) (-587.125) -- 0:00:51
Average standard deviation of split frequencies: 0.014107
190500 -- (-588.156) (-590.209) [-590.819] (-588.768) * (-588.005) (-589.851) (-588.179) [-588.376] -- 0:00:50
191000 -- [-589.594] (-589.706) (-586.466) (-589.989) * (-589.169) (-590.594) (-587.585) [-592.284] -- 0:00:50
191500 -- (-587.782) [-587.887] (-588.965) (-587.507) * (-587.620) (-590.285) (-588.372) [-587.676] -- 0:00:50
192000 -- (-587.247) (-588.960) [-586.469] (-590.668) * [-587.365] (-591.687) (-588.361) (-587.539) -- 0:00:50
192500 -- (-587.364) (-589.288) [-586.467] (-592.596) * (-588.625) (-593.253) [-588.603] (-587.658) -- 0:00:50
193000 -- (-589.057) (-587.056) [-586.399] (-588.034) * [-587.831] (-587.482) (-591.012) (-586.458) -- 0:00:50
193500 -- (-588.874) (-590.769) [-590.182] (-588.736) * (-587.619) [-587.146] (-588.790) (-587.466) -- 0:00:50
194000 -- [-587.569] (-592.096) (-588.274) (-587.784) * (-586.735) [-586.871] (-587.126) (-587.653) -- 0:00:49
194500 -- (-587.861) (-591.353) (-587.213) [-586.913] * (-587.606) (-588.930) (-587.046) [-588.370] -- 0:00:49
195000 -- (-588.386) (-589.533) [-592.576] (-586.672) * (-587.912) (-589.448) (-588.595) [-589.530] -- 0:00:49
Average standard deviation of split frequencies: 0.013829
195500 -- (-592.854) [-588.844] (-590.199) (-587.688) * (-589.197) (-593.574) (-587.645) [-589.086] -- 0:00:49
196000 -- (-589.343) (-587.788) [-588.100] (-587.119) * (-587.976) [-587.664] (-587.484) (-589.353) -- 0:00:49
196500 -- (-589.290) (-589.372) [-586.640] (-588.288) * (-588.275) (-588.700) (-588.127) [-589.975] -- 0:00:49
197000 -- (-588.036) (-589.287) [-587.033] (-595.241) * (-592.985) (-587.974) [-587.546] (-587.919) -- 0:00:48
197500 -- (-589.567) [-587.152] (-587.232) (-590.892) * (-592.124) (-588.795) (-588.143) [-588.381] -- 0:00:48
198000 -- (-589.628) (-587.694) [-588.344] (-587.401) * (-588.381) [-589.022] (-589.226) (-589.332) -- 0:00:48
198500 -- (-587.405) (-589.087) [-588.445] (-586.550) * (-586.590) (-586.209) (-589.738) [-587.660] -- 0:00:48
199000 -- [-587.940] (-588.092) (-588.189) (-587.559) * (-587.197) (-588.664) (-588.531) [-587.230] -- 0:00:48
199500 -- [-587.964] (-588.048) (-586.970) (-590.142) * [-587.787] (-588.266) (-589.454) (-586.725) -- 0:00:48
200000 -- [-590.156] (-588.338) (-588.163) (-592.932) * [-586.708] (-588.973) (-590.114) (-588.092) -- 0:00:48
Average standard deviation of split frequencies: 0.013948
200500 -- [-590.413] (-593.031) (-587.953) (-588.391) * (-587.378) (-588.494) [-588.444] (-590.368) -- 0:00:47
201000 -- [-588.495] (-596.921) (-589.142) (-587.852) * (-587.394) (-588.941) (-588.948) [-587.126] -- 0:00:47
201500 -- (-588.329) [-587.327] (-590.122) (-593.120) * (-589.491) (-591.395) [-589.173] (-587.267) -- 0:00:47
202000 -- [-586.328] (-591.370) (-589.504) (-593.061) * [-588.221] (-587.307) (-591.129) (-587.010) -- 0:00:47
202500 -- (-588.662) (-593.228) (-588.939) [-587.179] * (-587.278) (-587.662) [-588.152] (-586.823) -- 0:00:47
203000 -- (-587.769) [-589.445] (-589.806) (-592.138) * (-587.122) (-589.325) [-588.571] (-588.786) -- 0:00:47
203500 -- [-586.545] (-590.717) (-592.270) (-588.026) * (-588.927) [-586.754] (-587.701) (-589.991) -- 0:00:50
204000 -- (-589.629) [-586.140] (-590.448) (-588.051) * [-588.353] (-587.434) (-589.053) (-589.769) -- 0:00:50
204500 -- (-589.113) (-586.754) [-588.978] (-590.721) * (-588.808) [-587.105] (-587.418) (-589.357) -- 0:00:50
205000 -- (-586.394) [-588.556] (-589.407) (-588.160) * (-588.109) (-587.468) [-588.935] (-588.918) -- 0:00:50
Average standard deviation of split frequencies: 0.015211
205500 -- (-590.635) [-589.069] (-587.433) (-589.647) * (-588.355) (-591.814) [-588.501] (-586.917) -- 0:00:50
206000 -- [-589.215] (-588.134) (-589.295) (-591.695) * (-587.858) (-588.288) (-592.440) [-587.410] -- 0:00:50
206500 -- (-587.797) [-587.969] (-587.961) (-589.647) * (-586.973) [-586.755] (-588.716) (-587.410) -- 0:00:49
207000 -- (-586.419) (-589.520) [-589.180] (-590.626) * (-588.495) (-587.886) [-588.087] (-589.120) -- 0:00:49
207500 -- (-588.370) [-588.675] (-587.785) (-590.567) * (-589.022) (-587.295) (-591.319) [-589.741] -- 0:00:49
208000 -- (-588.723) [-588.262] (-591.555) (-589.407) * (-588.417) (-587.482) (-590.854) [-588.034] -- 0:00:49
208500 -- (-588.384) (-588.882) (-587.167) [-588.234] * (-588.774) [-587.674] (-592.784) (-589.148) -- 0:00:49
209000 -- (-588.062) (-589.015) [-591.825] (-590.280) * (-587.799) [-587.420] (-589.617) (-588.411) -- 0:00:49
209500 -- (-593.111) [-588.453] (-593.534) (-590.973) * (-592.043) (-587.617) (-595.254) [-587.215] -- 0:00:49
210000 -- (-589.206) [-589.244] (-593.258) (-589.225) * [-586.455] (-587.766) (-587.016) (-586.467) -- 0:00:48
Average standard deviation of split frequencies: 0.014479
210500 -- (-591.038) (-592.336) (-591.647) [-587.789] * (-588.809) (-590.114) [-592.728] (-587.706) -- 0:00:48
211000 -- (-592.564) (-587.530) [-587.506] (-589.150) * (-586.381) [-588.660] (-591.960) (-586.963) -- 0:00:48
211500 -- [-589.259] (-589.257) (-587.210) (-586.552) * (-587.075) (-588.590) [-591.537] (-587.696) -- 0:00:48
212000 -- (-588.698) (-589.201) (-588.420) [-588.290] * (-588.343) (-588.675) (-590.022) [-587.028] -- 0:00:48
212500 -- [-587.959] (-586.733) (-588.694) (-586.881) * (-587.925) (-590.586) [-586.667] (-589.569) -- 0:00:48
213000 -- (-586.921) [-590.825] (-587.817) (-588.047) * [-590.050] (-588.337) (-588.783) (-589.783) -- 0:00:48
213500 -- (-589.363) (-589.488) [-588.377] (-589.036) * (-589.102) [-589.007] (-588.828) (-587.902) -- 0:00:47
214000 -- [-590.563] (-587.263) (-587.167) (-588.977) * (-587.134) (-588.913) (-589.560) [-587.462] -- 0:00:47
214500 -- (-588.561) (-586.497) [-587.632] (-587.465) * (-591.778) [-588.624] (-590.445) (-587.343) -- 0:00:47
215000 -- (-588.351) [-586.314] (-589.414) (-587.684) * (-586.483) (-588.927) [-587.980] (-586.201) -- 0:00:47
Average standard deviation of split frequencies: 0.013822
215500 -- (-586.526) (-586.966) [-589.060] (-586.412) * (-588.092) (-589.994) (-594.465) [-587.452] -- 0:00:47
216000 -- [-589.754] (-586.295) (-586.725) (-587.180) * (-590.635) [-590.243] (-589.201) (-588.483) -- 0:00:47
216500 -- (-591.122) (-589.813) [-589.218] (-588.430) * (-592.507) (-586.377) [-587.096] (-587.333) -- 0:00:47
217000 -- [-588.392] (-589.893) (-587.695) (-587.331) * (-588.162) [-586.731] (-589.142) (-589.973) -- 0:00:46
217500 -- (-588.124) (-587.383) (-592.818) [-589.005] * (-588.854) [-589.302] (-588.707) (-587.342) -- 0:00:46
218000 -- [-587.629] (-589.306) (-597.361) (-586.305) * (-595.190) (-588.706) [-590.605] (-588.177) -- 0:00:46
218500 -- (-588.512) (-587.062) (-587.777) [-587.724] * [-598.258] (-591.357) (-590.543) (-589.883) -- 0:00:46
219000 -- (-589.466) (-588.106) [-587.071] (-590.865) * [-587.533] (-589.055) (-587.931) (-587.951) -- 0:00:46
219500 -- (-589.583) (-590.497) [-588.737] (-592.649) * (-587.738) [-589.744] (-587.851) (-592.741) -- 0:00:46
220000 -- [-586.288] (-589.330) (-588.130) (-588.326) * (-588.279) (-586.738) (-586.402) [-591.073] -- 0:00:46
Average standard deviation of split frequencies: 0.013446
220500 -- (-588.142) (-592.054) (-587.312) [-589.232] * (-589.769) [-586.213] (-588.715) (-590.126) -- 0:00:49
221000 -- (-587.681) (-593.343) (-587.104) [-588.222] * [-588.462] (-586.190) (-589.785) (-588.237) -- 0:00:49
221500 -- (-591.193) [-587.543] (-587.323) (-588.080) * (-593.220) (-586.178) (-587.634) [-590.285] -- 0:00:49
222000 -- (-590.201) (-590.601) [-587.114] (-587.191) * (-588.429) [-590.050] (-587.965) (-586.911) -- 0:00:49
222500 -- (-586.746) (-588.063) (-588.388) [-589.055] * (-590.245) (-588.378) [-587.315] (-590.848) -- 0:00:48
223000 -- (-586.947) (-588.229) (-589.029) [-588.420] * (-588.674) (-591.705) [-588.986] (-590.536) -- 0:00:48
223500 -- (-588.241) (-591.196) (-588.615) [-587.519] * (-589.681) (-589.481) [-587.673] (-587.505) -- 0:00:48
224000 -- (-588.082) [-589.145] (-589.762) (-588.252) * (-589.455) (-587.572) [-587.604] (-590.184) -- 0:00:48
224500 -- (-588.159) [-587.657] (-590.226) (-587.324) * (-589.721) (-587.344) (-589.603) [-587.734] -- 0:00:48
225000 -- [-586.906] (-590.092) (-589.877) (-588.287) * (-589.462) [-587.780] (-587.615) (-587.437) -- 0:00:48
Average standard deviation of split frequencies: 0.014138
225500 -- (-587.925) (-589.709) (-589.613) [-587.882] * (-587.050) (-588.313) (-587.612) [-588.242] -- 0:00:48
226000 -- (-588.687) [-589.783] (-588.666) (-589.057) * (-591.737) (-586.239) [-587.798] (-589.730) -- 0:00:47
226500 -- (-588.519) (-587.737) (-587.126) [-587.352] * (-587.512) (-590.460) [-588.298] (-588.176) -- 0:00:47
227000 -- [-587.203] (-587.851) (-589.849) (-587.960) * [-586.853] (-589.465) (-588.082) (-587.105) -- 0:00:47
227500 -- (-591.006) [-587.403] (-589.748) (-590.900) * (-589.934) [-588.157] (-586.673) (-591.051) -- 0:00:47
228000 -- (-591.223) (-586.607) [-587.354] (-586.830) * (-587.729) [-586.827] (-586.675) (-586.518) -- 0:00:47
228500 -- (-592.437) (-588.238) [-587.076] (-587.789) * (-587.783) (-591.372) (-587.184) [-586.790] -- 0:00:47
229000 -- (-589.175) [-586.671] (-587.524) (-588.077) * (-588.577) (-590.925) (-587.757) [-586.877] -- 0:00:47
229500 -- (-586.885) (-588.898) [-588.582] (-594.646) * (-590.232) (-592.234) [-588.131] (-587.242) -- 0:00:47
230000 -- (-588.595) [-587.018] (-588.741) (-587.738) * (-592.269) (-590.197) (-589.759) [-586.947] -- 0:00:46
Average standard deviation of split frequencies: 0.013965
230500 -- (-587.871) (-590.377) (-588.255) [-587.994] * (-589.162) [-589.078] (-588.083) (-592.080) -- 0:00:46
231000 -- [-590.994] (-591.680) (-586.936) (-588.840) * (-589.276) (-587.486) (-589.124) [-590.205] -- 0:00:46
231500 -- (-592.240) (-594.206) (-587.709) [-588.117] * [-587.914] (-588.769) (-586.281) (-589.067) -- 0:00:46
232000 -- (-589.552) [-587.963] (-589.856) (-588.187) * [-587.037] (-589.911) (-587.765) (-590.367) -- 0:00:46
232500 -- (-588.286) [-589.740] (-587.035) (-590.495) * (-591.260) (-588.913) (-587.350) [-588.063] -- 0:00:46
233000 -- (-589.403) (-587.209) [-588.611] (-588.423) * (-587.983) (-590.595) [-587.192] (-592.977) -- 0:00:46
233500 -- (-589.461) (-588.325) (-589.936) [-586.163] * (-590.339) (-588.989) (-589.500) [-587.920] -- 0:00:45
234000 -- (-587.123) (-587.534) [-586.983] (-589.006) * (-588.448) [-587.491] (-587.916) (-589.180) -- 0:00:45
234500 -- (-587.623) (-587.213) (-587.818) [-586.847] * (-589.314) [-588.344] (-589.079) (-586.422) -- 0:00:45
235000 -- (-588.131) (-587.947) [-587.996] (-595.629) * [-588.458] (-587.220) (-592.790) (-590.302) -- 0:00:45
Average standard deviation of split frequencies: 0.013317
235500 -- (-592.187) (-586.968) [-587.672] (-592.892) * (-587.918) (-588.841) (-592.329) [-586.862] -- 0:00:45
236000 -- (-588.983) [-587.307] (-588.569) (-591.076) * [-586.905] (-588.682) (-586.899) (-587.367) -- 0:00:45
236500 -- (-587.925) [-592.718] (-587.841) (-590.970) * [-592.926] (-588.258) (-587.854) (-588.100) -- 0:00:45
237000 -- (-587.989) (-589.874) (-588.947) [-588.202] * [-586.902] (-590.447) (-589.279) (-587.177) -- 0:00:48
237500 -- (-588.658) (-587.081) [-587.268] (-587.188) * [-588.278] (-587.322) (-587.532) (-591.682) -- 0:00:48
238000 -- (-590.911) (-588.640) (-587.838) [-588.237] * [-588.931] (-589.128) (-586.955) (-589.126) -- 0:00:48
238500 -- [-586.974] (-589.460) (-586.536) (-586.744) * (-588.319) (-589.784) [-587.810] (-590.574) -- 0:00:47
239000 -- (-586.456) [-591.502] (-590.574) (-588.550) * [-590.999] (-588.261) (-589.148) (-597.736) -- 0:00:47
239500 -- (-586.436) [-586.793] (-592.682) (-588.393) * [-588.222] (-590.748) (-591.064) (-589.042) -- 0:00:47
240000 -- (-589.037) (-588.060) [-587.633] (-587.884) * (-588.518) [-586.208] (-586.498) (-586.666) -- 0:00:47
Average standard deviation of split frequencies: 0.013602
240500 -- (-587.926) (-589.874) [-588.335] (-589.428) * [-589.233] (-587.813) (-587.221) (-588.648) -- 0:00:47
241000 -- [-589.544] (-591.030) (-589.531) (-588.409) * [-588.882] (-587.282) (-588.089) (-589.616) -- 0:00:47
241500 -- [-586.831] (-591.466) (-589.149) (-591.512) * (-590.772) (-587.369) [-587.320] (-587.788) -- 0:00:47
242000 -- [-586.966] (-588.857) (-589.861) (-593.275) * [-586.100] (-588.784) (-588.661) (-588.173) -- 0:00:46
242500 -- (-589.814) (-587.984) (-586.951) [-587.118] * (-588.792) (-592.380) [-589.414] (-587.360) -- 0:00:46
243000 -- (-586.467) [-587.890] (-587.510) (-586.297) * (-592.001) (-588.776) (-588.057) [-586.889] -- 0:00:46
243500 -- [-587.478] (-589.974) (-589.897) (-588.177) * [-588.412] (-590.025) (-587.334) (-587.482) -- 0:00:46
244000 -- (-586.925) (-590.178) [-588.090] (-587.750) * [-587.087] (-588.274) (-587.684) (-587.801) -- 0:00:46
244500 -- (-588.743) (-588.735) (-588.566) [-588.395] * (-590.957) (-587.291) [-588.039] (-588.691) -- 0:00:46
245000 -- (-587.518) (-591.068) (-588.029) [-586.841] * [-590.841] (-588.036) (-591.219) (-588.137) -- 0:00:46
Average standard deviation of split frequencies: 0.014316
245500 -- (-586.291) (-586.564) [-587.541] (-591.924) * (-587.612) (-594.734) [-588.519] (-586.523) -- 0:00:46
246000 -- (-586.861) (-586.153) [-589.591] (-588.623) * [-587.333] (-587.625) (-588.280) (-591.985) -- 0:00:45
246500 -- (-593.269) (-587.876) (-590.145) [-588.048] * [-588.338] (-590.701) (-591.591) (-587.051) -- 0:00:45
247000 -- (-587.752) (-589.550) (-589.389) [-586.359] * (-588.172) [-592.875] (-588.535) (-588.172) -- 0:00:45
247500 -- (-587.140) (-590.157) [-588.132] (-587.453) * (-587.592) [-587.641] (-593.585) (-587.090) -- 0:00:45
248000 -- [-589.370] (-586.809) (-589.193) (-586.179) * [-587.853] (-590.990) (-590.523) (-588.937) -- 0:00:45
248500 -- [-588.265] (-590.019) (-588.686) (-586.312) * (-588.451) [-587.730] (-586.468) (-586.383) -- 0:00:45
249000 -- (-588.716) [-586.476] (-589.762) (-587.832) * (-586.929) (-591.557) [-587.250] (-590.102) -- 0:00:45
249500 -- [-588.456] (-586.338) (-587.142) (-588.365) * (-589.434) (-591.026) (-587.171) [-586.706] -- 0:00:45
250000 -- (-589.305) (-587.090) (-589.166) [-587.292] * (-587.833) (-591.900) (-588.811) [-587.378] -- 0:00:45
Average standard deviation of split frequencies: 0.014049
250500 -- [-590.326] (-586.755) (-586.549) (-586.844) * (-587.533) [-586.616] (-589.741) (-591.214) -- 0:00:44
251000 -- [-589.098] (-587.151) (-591.281) (-588.041) * (-587.323) [-590.844] (-586.470) (-588.695) -- 0:00:44
251500 -- [-589.185] (-586.893) (-587.176) (-588.344) * (-589.587) [-587.379] (-587.319) (-587.750) -- 0:00:44
252000 -- (-586.817) (-587.422) (-587.371) [-589.621] * (-591.610) (-588.049) [-587.901] (-587.410) -- 0:00:44
252500 -- [-586.918] (-587.391) (-587.062) (-588.550) * (-590.357) (-587.075) (-587.666) [-588.601] -- 0:00:44
253000 -- (-588.473) (-589.671) [-587.185] (-591.396) * (-590.929) [-586.190] (-590.314) (-591.236) -- 0:00:44
253500 -- (-594.548) (-588.035) (-588.526) [-591.058] * (-592.132) [-590.280] (-589.415) (-588.356) -- 0:00:44
254000 -- (-591.807) [-589.075] (-588.347) (-593.137) * (-591.311) (-589.474) (-588.440) [-588.672] -- 0:00:46
254500 -- (-591.484) (-587.966) (-589.135) [-587.743] * (-587.898) (-590.707) (-588.079) [-586.887] -- 0:00:46
255000 -- (-588.372) [-589.671] (-588.943) (-587.679) * (-588.166) [-588.565] (-587.065) (-594.539) -- 0:00:46
Average standard deviation of split frequencies: 0.013005
255500 -- (-588.095) (-588.297) [-589.126] (-587.620) * [-589.939] (-588.812) (-590.592) (-589.249) -- 0:00:46
256000 -- [-590.812] (-589.804) (-590.151) (-586.922) * [-592.891] (-589.565) (-587.846) (-589.368) -- 0:00:46
256500 -- (-587.391) (-589.360) [-587.964] (-589.279) * (-589.677) (-588.456) (-592.729) [-588.220] -- 0:00:46
257000 -- [-586.673] (-588.756) (-587.724) (-589.241) * (-588.927) (-589.761) (-589.963) [-589.748] -- 0:00:46
257500 -- (-586.448) (-587.446) [-586.132] (-590.224) * [-589.739] (-590.791) (-588.292) (-588.793) -- 0:00:46
258000 -- (-587.729) [-587.757] (-590.750) (-592.110) * (-587.994) [-591.310] (-590.673) (-588.525) -- 0:00:46
258500 -- (-587.479) (-592.211) (-591.447) [-591.427] * (-588.499) (-591.395) (-592.721) [-591.069] -- 0:00:45
259000 -- [-587.822] (-586.272) (-587.318) (-590.551) * (-587.657) (-587.773) [-587.639] (-591.395) -- 0:00:45
259500 -- (-588.552) (-587.665) (-586.633) [-590.560] * (-591.908) [-588.640] (-590.479) (-587.550) -- 0:00:45
260000 -- (-587.891) (-589.391) [-587.026] (-591.284) * [-589.071] (-587.396) (-588.795) (-591.485) -- 0:00:45
Average standard deviation of split frequencies: 0.012659
260500 -- [-587.493] (-590.042) (-587.215) (-595.443) * (-588.300) (-589.327) (-586.963) [-589.214] -- 0:00:45
261000 -- (-591.433) [-589.117] (-590.289) (-591.602) * (-590.130) (-589.493) (-587.347) [-587.926] -- 0:00:45
261500 -- (-587.550) [-587.971] (-589.351) (-590.258) * (-589.782) (-587.975) [-587.488] (-590.748) -- 0:00:45
262000 -- (-587.094) (-590.176) (-589.115) [-590.455] * (-590.453) (-589.910) [-590.631] (-587.684) -- 0:00:45
262500 -- (-590.429) (-591.680) [-589.992] (-588.468) * (-594.336) (-591.959) (-589.537) [-587.313] -- 0:00:44
263000 -- (-587.143) (-589.036) (-590.186) [-588.236] * (-589.072) [-597.813] (-589.055) (-587.931) -- 0:00:44
263500 -- [-587.776] (-587.861) (-593.604) (-589.564) * [-590.468] (-595.022) (-587.781) (-588.251) -- 0:00:44
264000 -- (-590.835) (-588.469) [-591.445] (-586.654) * (-587.950) (-590.427) (-589.258) [-586.770] -- 0:00:44
264500 -- (-589.010) (-587.007) [-590.187] (-586.981) * (-587.380) (-588.449) (-588.113) [-586.709] -- 0:00:44
265000 -- (-588.120) (-588.995) (-594.753) [-588.394] * (-587.963) (-587.267) (-590.413) [-589.708] -- 0:00:44
Average standard deviation of split frequencies: 0.011298
265500 -- [-588.477] (-586.090) (-589.946) (-588.072) * (-587.446) [-588.382] (-590.572) (-593.969) -- 0:00:44
266000 -- (-588.111) (-590.315) (-589.526) [-592.183] * (-587.637) (-587.715) (-591.912) [-591.281] -- 0:00:44
266500 -- (-588.162) (-586.691) [-590.577] (-590.422) * [-587.842] (-587.307) (-589.127) (-588.065) -- 0:00:44
267000 -- (-589.546) (-588.144) (-591.196) [-587.880] * (-589.918) [-586.633] (-587.548) (-588.961) -- 0:00:43
267500 -- (-593.065) (-587.298) (-588.658) [-587.082] * [-592.288] (-590.000) (-586.885) (-587.091) -- 0:00:43
268000 -- (-589.030) (-588.785) (-587.725) [-587.366] * (-593.260) [-590.398] (-587.199) (-589.914) -- 0:00:43
268500 -- (-587.718) (-586.665) (-588.556) [-589.274] * (-586.835) [-588.991] (-586.549) (-592.749) -- 0:00:43
269000 -- (-587.541) (-587.514) [-587.184] (-587.983) * (-588.079) (-590.635) (-586.579) [-590.087] -- 0:00:43
269500 -- (-589.028) [-587.771] (-587.841) (-588.693) * (-589.521) [-587.015] (-586.505) (-589.056) -- 0:00:43
270000 -- (-586.910) (-586.747) (-588.166) [-590.607] * [-587.178] (-587.222) (-587.455) (-589.976) -- 0:00:43
Average standard deviation of split frequencies: 0.011865
270500 -- (-587.515) [-586.883] (-588.626) (-589.105) * (-589.567) (-590.723) [-588.913] (-591.552) -- 0:00:43
271000 -- (-588.408) (-587.392) (-587.605) [-592.738] * [-588.657] (-588.788) (-586.834) (-587.215) -- 0:00:45
271500 -- (-590.897) (-587.343) [-587.898] (-588.806) * (-587.845) (-590.996) (-586.642) [-586.875] -- 0:00:45
272000 -- (-588.099) [-587.222] (-587.684) (-586.820) * (-586.944) (-588.246) (-587.372) [-588.700] -- 0:00:45
272500 -- (-586.820) (-588.149) (-586.674) [-587.561] * (-590.298) (-589.501) [-593.237] (-588.462) -- 0:00:45
273000 -- (-586.555) (-586.917) (-586.464) [-587.096] * [-588.034] (-588.897) (-591.824) (-593.991) -- 0:00:45
273500 -- (-587.677) [-586.973] (-589.954) (-587.029) * [-587.412] (-586.902) (-593.994) (-592.610) -- 0:00:45
274000 -- (-590.131) [-586.951] (-597.681) (-588.366) * (-587.790) (-586.862) [-588.101] (-590.221) -- 0:00:45
274500 -- [-587.926] (-588.965) (-588.368) (-590.197) * (-588.289) (-587.977) (-589.259) [-589.587] -- 0:00:44
275000 -- (-592.543) (-587.467) (-587.179) [-594.649] * (-590.041) [-587.874] (-588.511) (-590.048) -- 0:00:44
Average standard deviation of split frequencies: 0.011273
275500 -- [-588.219] (-587.650) (-589.895) (-595.516) * (-588.859) (-589.161) [-588.922] (-589.439) -- 0:00:44
276000 -- (-588.116) (-586.974) (-590.372) [-587.968] * (-587.392) [-587.518] (-590.813) (-587.223) -- 0:00:44
276500 -- (-589.859) (-589.089) (-588.494) [-587.159] * (-587.356) (-588.560) [-588.519] (-587.548) -- 0:00:44
277000 -- (-588.979) (-591.081) [-588.625] (-587.522) * (-588.478) (-588.656) [-590.156] (-586.965) -- 0:00:44
277500 -- (-588.101) [-588.259] (-588.629) (-591.173) * (-593.458) (-592.103) (-588.566) [-586.662] -- 0:00:44
278000 -- (-589.157) (-587.680) (-587.353) [-588.174] * (-590.028) (-590.029) [-586.995] (-592.590) -- 0:00:44
278500 -- [-586.850] (-590.145) (-587.622) (-588.204) * [-589.103] (-587.843) (-586.536) (-591.839) -- 0:00:44
279000 -- (-587.255) [-588.657] (-593.391) (-589.892) * (-593.998) (-587.097) [-588.531] (-586.690) -- 0:00:43
279500 -- (-587.987) (-589.114) [-589.570] (-589.930) * (-590.311) (-588.679) [-588.737] (-588.597) -- 0:00:43
280000 -- [-588.328] (-587.656) (-590.617) (-588.842) * (-593.203) [-587.414] (-586.994) (-588.900) -- 0:00:43
Average standard deviation of split frequencies: 0.011981
280500 -- [-587.150] (-589.409) (-588.704) (-592.685) * (-587.635) (-590.253) [-587.373] (-588.310) -- 0:00:43
281000 -- [-587.122] (-586.356) (-589.408) (-586.558) * (-592.662) (-588.204) [-586.632] (-588.354) -- 0:00:43
281500 -- (-590.379) (-587.746) (-588.035) [-587.618] * [-588.077] (-588.157) (-586.786) (-590.357) -- 0:00:43
282000 -- (-587.690) (-590.344) [-588.346] (-589.422) * (-588.108) (-588.637) (-586.834) [-587.712] -- 0:00:43
282500 -- (-586.766) [-588.987] (-587.784) (-586.500) * (-589.993) [-587.557] (-586.832) (-586.475) -- 0:00:43
283000 -- (-587.931) (-590.099) (-588.167) [-588.394] * (-590.436) (-589.401) (-586.884) [-587.469] -- 0:00:43
283500 -- [-586.909] (-587.362) (-586.726) (-588.403) * (-589.531) (-589.903) [-589.609] (-588.555) -- 0:00:42
284000 -- [-586.748] (-586.964) (-589.051) (-588.240) * [-588.572] (-591.769) (-587.287) (-593.436) -- 0:00:42
284500 -- (-590.109) (-586.838) [-590.659] (-587.387) * (-589.802) [-587.787] (-589.291) (-588.255) -- 0:00:42
285000 -- (-588.051) [-586.713] (-589.872) (-590.890) * (-588.647) [-586.507] (-587.509) (-589.499) -- 0:00:42
Average standard deviation of split frequencies: 0.012527
285500 -- (-589.455) (-586.495) (-588.293) [-591.070] * (-586.940) (-587.182) [-586.833] (-590.866) -- 0:00:42
286000 -- (-586.377) [-586.620] (-589.006) (-592.347) * (-586.892) (-586.339) [-586.482] (-589.681) -- 0:00:42
286500 -- [-588.506] (-589.220) (-591.197) (-589.020) * [-586.633] (-588.858) (-588.160) (-590.613) -- 0:00:42
287000 -- [-587.821] (-586.756) (-596.629) (-589.717) * [-587.861] (-589.412) (-594.001) (-588.347) -- 0:00:42
287500 -- (-586.667) (-587.855) (-589.245) [-587.741] * (-589.157) [-589.001] (-587.628) (-587.365) -- 0:00:42
288000 -- (-589.832) (-588.295) [-586.698] (-587.641) * (-599.525) (-588.273) [-588.249] (-587.408) -- 0:00:44
288500 -- (-587.965) (-589.921) (-590.766) [-587.909] * (-599.707) [-588.168] (-588.184) (-587.793) -- 0:00:44
289000 -- [-588.222] (-589.292) (-590.779) (-586.531) * [-590.271] (-590.402) (-588.246) (-587.094) -- 0:00:44
289500 -- [-589.352] (-587.739) (-588.780) (-591.199) * (-587.940) (-592.749) (-590.611) [-587.059] -- 0:00:44
290000 -- (-589.401) (-587.723) [-591.826] (-587.950) * (-590.224) [-591.608] (-591.906) (-586.400) -- 0:00:44
Average standard deviation of split frequencies: 0.012366
290500 -- (-587.528) [-586.323] (-593.949) (-589.778) * (-587.597) [-586.608] (-587.762) (-588.892) -- 0:00:43
291000 -- (-587.854) (-588.277) [-589.640] (-588.269) * (-589.148) (-588.828) (-587.750) [-586.957] -- 0:00:43
291500 -- [-586.198] (-587.170) (-587.994) (-589.694) * [-588.743] (-588.714) (-586.112) (-586.733) -- 0:00:43
292000 -- (-588.223) [-586.466] (-592.305) (-589.453) * (-589.396) (-588.862) [-589.867] (-586.258) -- 0:00:43
292500 -- (-591.451) (-589.756) (-586.903) [-586.256] * (-588.490) (-587.040) (-593.074) [-587.514] -- 0:00:43
293000 -- [-586.816] (-589.339) (-590.284) (-587.323) * (-587.840) [-587.794] (-588.556) (-592.178) -- 0:00:43
293500 -- (-588.389) (-589.527) [-587.253] (-586.622) * (-586.658) (-588.537) (-587.216) [-588.914] -- 0:00:43
294000 -- [-586.989] (-589.692) (-587.033) (-587.368) * (-587.199) [-591.863] (-586.969) (-587.660) -- 0:00:43
294500 -- (-591.555) [-590.504] (-587.786) (-592.736) * (-587.144) (-594.822) [-589.739] (-590.109) -- 0:00:43
295000 -- [-587.555] (-589.020) (-588.630) (-586.712) * [-587.909] (-592.543) (-589.666) (-587.758) -- 0:00:43
Average standard deviation of split frequencies: 0.012044
295500 -- (-588.123) (-587.505) (-590.177) [-587.748] * (-590.169) (-588.227) (-591.663) [-589.909] -- 0:00:42
296000 -- (-587.337) (-588.387) [-589.109] (-589.912) * (-587.224) [-587.000] (-589.323) (-588.240) -- 0:00:42
296500 -- [-587.836] (-586.791) (-588.735) (-588.074) * (-589.427) [-586.653] (-588.432) (-589.067) -- 0:00:42
297000 -- (-588.409) [-587.375] (-590.376) (-587.807) * (-587.786) (-586.281) [-588.708] (-589.136) -- 0:00:42
297500 -- (-588.844) (-588.502) (-588.279) [-586.835] * (-587.784) [-586.268] (-588.074) (-588.077) -- 0:00:42
298000 -- (-587.946) (-589.839) (-588.630) [-586.645] * (-588.672) (-589.897) [-587.464] (-593.027) -- 0:00:42
298500 -- [-588.790] (-590.511) (-587.082) (-586.090) * (-588.797) [-587.829] (-586.782) (-590.681) -- 0:00:42
299000 -- [-587.590] (-590.367) (-588.882) (-588.498) * (-588.597) [-588.394] (-587.380) (-591.990) -- 0:00:42
299500 -- (-591.129) [-590.761] (-588.353) (-587.797) * (-593.852) (-590.002) (-588.823) [-590.000] -- 0:00:42
300000 -- (-587.359) (-589.466) [-588.598] (-588.961) * (-588.894) [-588.127] (-589.246) (-587.729) -- 0:00:42
Average standard deviation of split frequencies: 0.012151
300500 -- (-588.440) [-589.055] (-587.136) (-588.468) * (-587.681) [-587.428] (-586.829) (-591.265) -- 0:00:41
301000 -- (-587.434) (-589.265) (-590.382) [-587.613] * [-588.588] (-588.665) (-587.074) (-588.521) -- 0:00:41
301500 -- (-588.188) [-586.685] (-589.064) (-586.558) * (-587.293) (-594.224) [-588.778] (-591.989) -- 0:00:41
302000 -- (-586.846) [-587.137] (-588.580) (-587.665) * (-592.079) (-588.889) (-586.733) [-587.399] -- 0:00:41
302500 -- (-587.921) [-586.865] (-592.436) (-592.207) * (-588.643) [-588.168] (-586.964) (-587.289) -- 0:00:41
303000 -- (-587.611) (-586.806) (-587.528) [-590.172] * (-589.455) (-587.242) (-586.358) [-587.404] -- 0:00:41
303500 -- (-587.409) (-589.163) (-587.601) [-588.108] * (-588.024) (-587.606) (-587.607) [-587.360] -- 0:00:41
304000 -- (-588.157) (-589.579) (-589.670) [-586.901] * (-587.486) (-588.026) [-588.136] (-588.425) -- 0:00:41
304500 -- (-586.425) (-587.112) [-591.566] (-587.905) * [-587.772] (-594.668) (-587.651) (-592.657) -- 0:00:41
305000 -- [-588.256] (-587.041) (-587.545) (-588.088) * [-588.260] (-589.690) (-591.598) (-588.150) -- 0:00:43
Average standard deviation of split frequencies: 0.011843
305500 -- (-588.520) (-586.872) (-589.588) [-586.177] * (-589.098) (-591.936) [-591.416] (-590.069) -- 0:00:43
306000 -- (-587.525) (-590.179) (-589.287) [-586.416] * [-587.640] (-589.431) (-588.479) (-587.818) -- 0:00:43
306500 -- (-588.500) (-588.017) (-587.636) [-586.405] * (-589.034) (-587.380) (-588.348) [-586.672] -- 0:00:42
307000 -- (-590.911) [-590.109] (-591.544) (-587.288) * [-588.374] (-586.964) (-588.142) (-586.762) -- 0:00:42
307500 -- (-590.849) (-588.898) (-587.239) [-587.280] * (-587.227) [-587.792] (-586.680) (-589.611) -- 0:00:42
308000 -- (-589.887) (-589.462) (-586.689) [-587.950] * [-589.960] (-586.611) (-588.004) (-588.570) -- 0:00:42
308500 -- (-591.383) (-589.811) [-587.118] (-588.076) * (-589.221) (-592.112) (-587.511) [-588.702] -- 0:00:42
309000 -- (-586.421) (-589.204) (-588.346) [-587.478] * (-590.950) (-589.869) (-589.357) [-588.601] -- 0:00:42
309500 -- (-588.649) (-588.323) (-586.629) [-587.475] * (-593.037) (-588.756) [-587.885] (-589.822) -- 0:00:42
310000 -- (-592.122) (-588.599) (-587.785) [-587.006] * [-589.919] (-589.971) (-586.953) (-589.672) -- 0:00:42
Average standard deviation of split frequencies: 0.012329
310500 -- (-587.724) (-588.739) (-588.658) [-586.512] * (-592.900) (-587.695) [-586.302] (-590.345) -- 0:00:42
311000 -- (-586.550) (-587.925) [-587.954] (-589.951) * (-589.589) (-591.080) [-587.053] (-588.280) -- 0:00:42
311500 -- (-589.839) (-590.528) [-587.489] (-587.666) * (-586.309) (-591.003) [-587.441] (-587.866) -- 0:00:41
312000 -- (-591.690) [-588.752] (-598.803) (-587.225) * [-586.322] (-587.467) (-591.087) (-587.468) -- 0:00:41
312500 -- (-588.125) (-590.104) [-589.119] (-590.284) * [-588.815] (-592.506) (-591.310) (-593.235) -- 0:00:41
313000 -- (-592.038) [-591.346] (-588.525) (-589.629) * (-589.425) [-587.429] (-588.305) (-591.047) -- 0:00:41
313500 -- [-590.447] (-592.193) (-588.753) (-588.208) * [-587.162] (-588.074) (-587.538) (-588.453) -- 0:00:41
314000 -- (-588.763) (-592.777) [-587.421] (-587.512) * (-591.423) [-588.010] (-591.073) (-590.812) -- 0:00:41
314500 -- (-589.954) (-588.150) (-588.157) [-595.403] * [-590.072] (-587.181) (-587.625) (-589.309) -- 0:00:41
315000 -- (-589.989) [-590.132] (-588.598) (-590.958) * (-590.527) (-587.763) [-587.701] (-588.554) -- 0:00:41
Average standard deviation of split frequencies: 0.012034
315500 -- [-587.589] (-589.921) (-588.957) (-589.926) * (-589.842) [-587.824] (-586.909) (-589.229) -- 0:00:41
316000 -- (-586.984) (-586.440) (-587.080) [-590.010] * (-586.945) [-587.958] (-589.746) (-586.919) -- 0:00:41
316500 -- (-588.810) (-588.913) [-587.590] (-588.818) * (-587.480) (-591.030) [-586.748] (-594.205) -- 0:00:41
317000 -- (-592.818) [-587.813] (-589.203) (-589.321) * (-589.429) (-588.501) (-586.793) [-590.036] -- 0:00:40
317500 -- (-589.223) [-586.895] (-587.495) (-587.382) * (-592.871) (-588.251) (-587.736) [-587.894] -- 0:00:40
318000 -- [-587.510] (-587.742) (-586.770) (-589.387) * (-594.697) (-592.262) (-590.596) [-587.978] -- 0:00:40
318500 -- (-588.036) (-586.873) [-589.641] (-587.177) * [-591.272] (-587.295) (-590.871) (-587.465) -- 0:00:40
319000 -- [-589.993] (-591.600) (-592.429) (-587.189) * (-589.015) (-588.026) [-587.647] (-587.339) -- 0:00:40
319500 -- (-593.759) (-588.208) [-590.793] (-590.696) * (-587.939) (-587.125) [-587.380] (-587.928) -- 0:00:40
320000 -- (-593.697) (-589.816) [-588.037] (-587.976) * (-588.750) (-590.889) [-587.085] (-588.642) -- 0:00:40
Average standard deviation of split frequencies: 0.012545
320500 -- [-590.050] (-589.617) (-588.730) (-587.786) * [-587.802] (-587.972) (-587.821) (-587.862) -- 0:00:40
321000 -- [-587.119] (-589.222) (-586.967) (-587.419) * [-591.087] (-590.393) (-588.653) (-588.430) -- 0:00:40
321500 -- (-588.852) (-588.005) (-588.343) [-588.320] * (-588.550) [-588.094] (-589.476) (-589.062) -- 0:00:40
322000 -- (-587.657) [-595.233] (-593.883) (-587.041) * [-588.185] (-587.553) (-588.754) (-590.314) -- 0:00:42
322500 -- [-587.741] (-597.925) (-587.103) (-587.527) * (-588.508) (-590.436) (-594.184) [-588.968] -- 0:00:42
323000 -- (-589.390) (-590.110) (-590.648) [-586.651] * (-586.784) [-587.120] (-589.552) (-588.132) -- 0:00:41
323500 -- (-588.458) [-588.132] (-590.924) (-586.608) * (-588.196) (-586.614) (-594.801) [-586.403] -- 0:00:41
324000 -- (-587.745) [-589.556] (-591.718) (-587.278) * (-588.212) (-588.183) [-588.561] (-590.132) -- 0:00:41
324500 -- [-587.440] (-590.903) (-592.671) (-587.984) * (-589.684) (-589.190) [-588.498] (-589.434) -- 0:00:41
325000 -- [-587.963] (-587.308) (-589.663) (-590.827) * (-589.616) [-589.519] (-586.811) (-587.611) -- 0:00:41
Average standard deviation of split frequencies: 0.011297
325500 -- [-587.973] (-586.330) (-592.983) (-589.287) * (-594.642) (-589.310) (-586.585) [-587.064] -- 0:00:41
326000 -- (-586.883) (-589.135) [-594.424] (-594.737) * (-587.973) (-588.671) [-586.488] (-588.396) -- 0:00:41
326500 -- (-587.232) [-592.191] (-593.496) (-590.447) * [-590.757] (-587.407) (-589.158) (-592.455) -- 0:00:41
327000 -- (-587.483) (-588.168) (-594.315) [-589.199] * (-586.790) [-588.045] (-589.133) (-592.876) -- 0:00:41
327500 -- (-588.118) [-587.479] (-590.429) (-591.788) * (-586.432) (-590.888) [-588.073] (-587.846) -- 0:00:41
328000 -- (-589.642) (-588.590) (-587.879) [-590.653] * (-588.337) [-587.275] (-587.542) (-590.593) -- 0:00:40
328500 -- (-589.002) (-588.561) [-586.896] (-587.819) * (-587.240) (-587.949) [-591.016] (-591.057) -- 0:00:40
329000 -- (-586.650) (-587.607) [-591.914] (-586.497) * (-587.587) (-591.728) (-589.930) [-592.297] -- 0:00:40
329500 -- (-589.741) (-588.558) [-587.843] (-592.660) * (-589.765) [-588.490] (-587.714) (-590.335) -- 0:00:40
330000 -- [-588.546] (-587.661) (-590.175) (-591.760) * (-590.495) [-588.275] (-588.451) (-594.452) -- 0:00:40
Average standard deviation of split frequencies: 0.010781
330500 -- (-589.672) [-586.509] (-586.618) (-591.620) * (-589.099) [-586.885] (-591.440) (-588.011) -- 0:00:40
331000 -- (-588.494) (-586.622) [-589.371] (-592.295) * [-587.268] (-587.791) (-589.551) (-587.390) -- 0:00:40
331500 -- (-589.139) (-586.402) (-588.352) [-587.552] * (-586.572) (-589.428) [-593.041] (-587.661) -- 0:00:40
332000 -- (-587.826) (-592.339) [-586.464] (-589.748) * (-587.602) (-590.560) [-589.238] (-590.316) -- 0:00:40
332500 -- (-586.749) (-588.609) [-588.791] (-592.498) * (-587.820) (-588.707) [-587.558] (-589.886) -- 0:00:40
333000 -- [-587.718] (-587.007) (-589.799) (-587.902) * (-590.145) (-588.044) (-587.874) [-588.025] -- 0:00:40
333500 -- (-587.149) [-587.351] (-588.105) (-588.037) * (-587.546) (-586.741) [-587.477] (-593.988) -- 0:00:39
334000 -- [-588.186] (-588.874) (-591.185) (-587.729) * (-590.148) [-589.065] (-588.916) (-592.946) -- 0:00:39
334500 -- [-586.473] (-588.449) (-588.396) (-587.134) * (-588.645) (-588.681) [-589.466] (-591.675) -- 0:00:39
335000 -- (-588.991) (-589.192) (-591.394) [-588.192] * (-594.042) [-587.666] (-587.893) (-588.376) -- 0:00:39
Average standard deviation of split frequencies: 0.010873
335500 -- (-590.191) (-587.780) (-591.395) [-587.658] * (-589.190) [-587.204] (-588.210) (-587.354) -- 0:00:39
336000 -- (-594.220) (-587.905) [-589.138] (-586.550) * (-590.054) (-587.158) [-590.362] (-586.769) -- 0:00:39
336500 -- (-587.202) [-587.790] (-590.217) (-591.623) * (-587.912) (-587.123) (-594.373) [-587.784] -- 0:00:39
337000 -- (-592.178) (-587.400) [-589.381] (-589.168) * (-587.434) (-587.224) [-595.093] (-588.135) -- 0:00:39
337500 -- (-588.143) [-587.879] (-589.080) (-589.255) * (-586.248) [-587.243] (-594.142) (-588.040) -- 0:00:39
338000 -- [-588.790] (-591.095) (-590.090) (-588.641) * (-586.782) (-589.793) (-589.633) [-588.871] -- 0:00:39
338500 -- (-591.092) (-587.404) (-587.267) [-587.533] * (-588.419) (-588.479) [-588.088] (-586.886) -- 0:00:39
339000 -- [-589.399] (-588.301) (-587.910) (-588.089) * [-587.801] (-586.469) (-586.949) (-588.751) -- 0:00:40
339500 -- [-587.796] (-591.609) (-588.344) (-592.901) * [-593.195] (-588.389) (-592.295) (-588.227) -- 0:00:40
340000 -- (-588.038) (-587.728) [-589.529] (-588.169) * (-591.522) (-591.939) [-586.405] (-586.759) -- 0:00:40
Average standard deviation of split frequencies: 0.010811
340500 -- (-588.263) (-587.901) (-587.433) [-586.230] * [-591.858] (-591.524) (-589.680) (-586.752) -- 0:00:40
341000 -- (-588.639) (-587.979) [-588.826] (-587.453) * [-586.881] (-590.710) (-587.738) (-587.603) -- 0:00:40
341500 -- (-586.677) (-587.795) [-588.071] (-586.965) * (-586.914) (-592.789) (-588.260) [-587.636] -- 0:00:40
342000 -- (-586.400) (-591.423) [-589.863] (-588.359) * [-588.767] (-591.193) (-586.284) (-588.907) -- 0:00:40
342500 -- [-587.598] (-592.583) (-586.326) (-588.421) * (-587.778) [-587.089] (-590.395) (-590.326) -- 0:00:40
343000 -- (-588.275) (-592.691) (-587.195) [-586.965] * [-586.411] (-588.383) (-589.977) (-587.306) -- 0:00:40
343500 -- [-587.300] (-589.504) (-590.705) (-590.063) * (-586.676) [-589.470] (-589.888) (-591.216) -- 0:00:40
344000 -- [-587.469] (-588.692) (-590.136) (-588.123) * (-588.914) (-590.056) [-595.080] (-591.452) -- 0:00:40
344500 -- [-587.220] (-590.441) (-589.460) (-589.566) * (-590.215) (-588.846) (-593.848) [-590.876] -- 0:00:39
345000 -- (-587.193) (-591.146) [-586.662] (-592.872) * [-587.256] (-593.673) (-591.676) (-588.625) -- 0:00:39
Average standard deviation of split frequencies: 0.011410
345500 -- (-589.237) (-587.867) [-587.892] (-589.747) * (-591.113) (-596.467) (-593.269) [-587.657] -- 0:00:39
346000 -- (-588.571) [-588.099] (-588.422) (-587.213) * (-590.814) (-591.484) [-588.602] (-590.139) -- 0:00:39
346500 -- [-589.066] (-589.043) (-589.372) (-587.267) * (-592.774) (-590.719) [-588.643] (-586.711) -- 0:00:39
347000 -- (-587.366) (-587.950) (-592.197) [-589.718] * (-587.120) (-591.210) (-586.545) [-588.841] -- 0:00:39
347500 -- (-587.036) [-587.993] (-590.161) (-591.698) * (-588.272) [-586.491] (-587.415) (-588.511) -- 0:00:39
348000 -- (-588.573) (-587.864) (-589.187) [-593.194] * (-587.657) [-587.814] (-592.599) (-587.785) -- 0:00:39
348500 -- (-591.119) (-587.417) [-587.763] (-586.140) * (-590.831) [-588.036] (-590.373) (-587.675) -- 0:00:39
349000 -- (-592.208) (-587.689) (-588.166) [-588.015] * [-591.701] (-589.946) (-587.283) (-590.969) -- 0:00:39
349500 -- (-589.374) (-588.610) (-587.737) [-587.426] * (-592.570) [-586.886] (-589.962) (-588.788) -- 0:00:39
350000 -- (-587.659) (-592.755) (-587.235) [-588.010] * (-590.361) (-591.199) [-588.171] (-588.097) -- 0:00:39
Average standard deviation of split frequencies: 0.010586
350500 -- (-587.161) (-590.459) [-588.231] (-590.793) * (-587.827) (-590.801) (-588.905) [-588.350] -- 0:00:38
351000 -- (-589.622) [-587.785] (-591.060) (-593.385) * (-587.881) (-589.692) [-590.351] (-594.924) -- 0:00:38
351500 -- [-593.516] (-587.357) (-590.694) (-590.113) * (-589.860) [-588.852] (-586.559) (-588.650) -- 0:00:38
352000 -- (-586.290) [-586.528] (-594.611) (-589.125) * (-591.841) (-588.055) (-594.355) [-586.716] -- 0:00:38
352500 -- [-587.724] (-587.543) (-588.387) (-587.797) * (-586.877) (-588.182) (-588.514) [-586.865] -- 0:00:38
353000 -- (-589.216) [-588.537] (-589.661) (-588.009) * [-586.207] (-586.852) (-591.705) (-590.174) -- 0:00:38
353500 -- [-586.472] (-587.181) (-587.185) (-586.755) * (-588.084) (-590.236) [-587.628] (-588.018) -- 0:00:38
354000 -- (-586.566) [-586.959] (-588.295) (-588.961) * (-588.727) (-587.808) (-589.691) [-589.848] -- 0:00:38
354500 -- (-588.997) [-590.619] (-587.876) (-588.914) * [-587.009] (-587.340) (-586.446) (-590.899) -- 0:00:38
355000 -- (-588.801) (-587.239) (-589.071) [-589.078] * (-588.455) (-590.834) (-586.827) [-589.140] -- 0:00:38
Average standard deviation of split frequencies: 0.010262
355500 -- (-586.844) (-586.552) (-590.164) [-588.854] * [-591.608] (-591.013) (-587.372) (-594.386) -- 0:00:39
356000 -- (-588.456) [-588.382] (-590.316) (-590.414) * (-590.094) (-586.178) [-590.144] (-588.289) -- 0:00:39
356500 -- (-590.516) (-587.953) (-589.278) [-588.911] * (-587.008) [-587.540] (-589.643) (-591.572) -- 0:00:39
357000 -- [-591.250] (-587.253) (-588.158) (-591.468) * [-591.990] (-589.121) (-592.355) (-591.613) -- 0:00:39
357500 -- [-589.139] (-588.986) (-588.495) (-589.005) * (-591.258) (-587.362) [-587.732] (-587.020) -- 0:00:39
358000 -- (-586.754) [-591.631] (-588.851) (-587.945) * (-590.548) (-589.216) (-594.564) [-588.140] -- 0:00:39
358500 -- (-588.857) [-591.203] (-591.968) (-587.204) * (-588.997) (-597.508) [-591.381] (-590.338) -- 0:00:39
359000 -- (-592.688) (-588.431) (-590.891) [-587.130] * (-591.274) [-586.513] (-589.795) (-592.019) -- 0:00:39
359500 -- [-591.890] (-587.980) (-587.874) (-587.779) * (-588.409) [-587.805] (-587.924) (-590.293) -- 0:00:39
360000 -- (-588.634) (-587.664) (-587.859) [-587.698] * (-590.205) (-589.627) [-588.101] (-588.729) -- 0:00:39
Average standard deviation of split frequencies: 0.010456
360500 -- (-593.172) [-590.574] (-591.986) (-590.800) * (-588.772) (-594.816) (-586.644) [-588.061] -- 0:00:39
361000 -- (-590.025) (-588.899) (-587.105) [-589.560] * (-587.104) (-592.807) (-587.106) [-588.269] -- 0:00:38
361500 -- (-592.360) (-590.581) [-587.623] (-590.714) * (-588.779) [-593.124] (-591.803) (-587.303) -- 0:00:38
362000 -- (-592.868) [-587.436] (-587.125) (-587.132) * [-588.897] (-589.022) (-586.890) (-588.455) -- 0:00:38
362500 -- [-589.815] (-589.630) (-588.158) (-586.967) * [-587.624] (-587.448) (-591.070) (-588.758) -- 0:00:38
363000 -- (-592.026) (-587.105) (-587.838) [-587.594] * [-587.515] (-587.325) (-591.409) (-587.926) -- 0:00:38
363500 -- (-591.570) (-590.150) (-588.767) [-588.274] * (-588.023) (-587.088) [-587.061] (-588.544) -- 0:00:38
364000 -- [-588.430] (-588.862) (-587.712) (-587.816) * (-588.748) [-588.043] (-589.227) (-588.217) -- 0:00:38
364500 -- (-587.433) [-588.804] (-591.315) (-589.194) * (-591.946) [-587.404] (-587.677) (-587.568) -- 0:00:38
365000 -- [-587.578] (-592.331) (-589.470) (-590.787) * (-589.061) (-590.977) [-589.162] (-588.158) -- 0:00:38
Average standard deviation of split frequencies: 0.010384
365500 -- (-587.013) (-593.156) [-588.485] (-587.044) * (-588.238) (-591.011) (-590.107) [-588.054] -- 0:00:38
366000 -- [-591.545] (-587.227) (-588.970) (-587.620) * [-587.175] (-592.753) (-587.508) (-589.833) -- 0:00:38
366500 -- [-586.805] (-587.427) (-591.463) (-590.355) * (-589.747) [-586.227] (-590.154) (-587.993) -- 0:00:38
367000 -- [-586.650] (-593.700) (-588.015) (-588.573) * [-589.661] (-587.653) (-587.593) (-587.994) -- 0:00:37
367500 -- (-587.934) (-588.804) (-586.997) [-588.608] * (-587.534) (-590.087) (-589.042) [-587.685] -- 0:00:37
368000 -- (-589.828) (-589.875) (-590.078) [-587.679] * (-588.477) (-591.161) [-588.441] (-589.740) -- 0:00:37
368500 -- (-589.793) (-588.024) [-593.343] (-588.916) * (-587.251) [-586.362] (-587.842) (-587.475) -- 0:00:37
369000 -- (-589.752) [-588.176] (-588.525) (-591.143) * (-587.711) (-588.014) (-587.562) [-589.687] -- 0:00:37
369500 -- (-588.041) (-586.925) [-587.820] (-586.858) * (-586.942) (-589.200) [-588.994] (-587.789) -- 0:00:37
370000 -- (-587.883) (-586.402) [-587.932] (-587.838) * (-587.649) (-589.209) (-589.385) [-591.643] -- 0:00:37
Average standard deviation of split frequencies: 0.010731
370500 -- (-588.408) (-589.710) (-586.840) [-587.687] * (-587.384) (-588.004) [-587.076] (-589.263) -- 0:00:37
371000 -- [-589.376] (-589.902) (-588.140) (-587.810) * (-588.098) (-589.124) (-586.909) [-589.145] -- 0:00:37
371500 -- [-589.560] (-586.703) (-589.119) (-589.508) * [-590.254] (-595.566) (-591.941) (-588.465) -- 0:00:37
372000 -- (-589.058) [-588.470] (-587.519) (-592.269) * (-588.075) [-588.377] (-587.931) (-588.063) -- 0:00:38
372500 -- [-586.510] (-588.519) (-587.368) (-591.341) * (-587.475) (-592.016) [-586.151] (-588.709) -- 0:00:38
373000 -- [-587.200] (-587.438) (-587.324) (-588.576) * (-587.324) [-588.145] (-586.796) (-589.356) -- 0:00:38
373500 -- (-588.522) (-590.597) [-587.846] (-592.727) * (-587.608) (-587.945) [-586.204] (-588.537) -- 0:00:38
374000 -- [-590.459] (-587.629) (-589.355) (-593.648) * (-588.458) (-588.426) [-586.902] (-587.735) -- 0:00:38
374500 -- [-589.261] (-588.499) (-588.480) (-587.773) * [-586.667] (-587.550) (-587.954) (-586.901) -- 0:00:38
375000 -- (-587.711) (-589.139) (-588.151) [-588.219] * [-586.395] (-586.995) (-588.612) (-589.045) -- 0:00:38
Average standard deviation of split frequencies: 0.010422
375500 -- (-587.176) (-589.378) (-587.556) [-593.089] * [-595.338] (-588.375) (-587.802) (-588.730) -- 0:00:38
376000 -- [-587.944] (-588.960) (-591.901) (-589.297) * (-587.617) (-587.615) (-586.550) [-587.143] -- 0:00:38
376500 -- (-589.223) (-588.768) [-591.170] (-586.589) * (-587.547) [-589.296] (-588.021) (-588.134) -- 0:00:38
377000 -- (-591.032) (-588.395) (-591.486) [-586.125] * (-589.616) (-586.827) (-587.049) [-592.042] -- 0:00:38
377500 -- (-588.868) (-592.519) (-587.320) [-588.128] * (-594.304) [-587.327] (-590.044) (-593.792) -- 0:00:37
378000 -- (-586.833) (-592.001) (-590.972) [-586.756] * (-589.594) (-586.727) [-590.742] (-586.462) -- 0:00:37
378500 -- (-589.508) (-591.940) (-590.102) [-589.154] * (-591.473) [-588.516] (-590.179) (-588.068) -- 0:00:37
379000 -- [-590.111] (-591.189) (-588.754) (-589.176) * (-601.493) [-590.351] (-588.551) (-591.364) -- 0:00:37
379500 -- (-591.469) [-588.401] (-588.979) (-590.003) * [-592.133] (-590.994) (-590.612) (-590.415) -- 0:00:37
380000 -- (-590.456) [-588.531] (-588.024) (-591.579) * [-587.677] (-589.981) (-589.921) (-591.563) -- 0:00:37
Average standard deviation of split frequencies: 0.009675
380500 -- (-590.186) (-593.402) [-588.618] (-590.176) * (-589.666) (-595.537) [-591.284] (-589.612) -- 0:00:37
381000 -- (-592.182) [-587.544] (-588.114) (-587.226) * (-589.996) (-598.649) (-589.421) [-591.195] -- 0:00:37
381500 -- (-589.943) (-586.882) (-586.968) [-587.535] * (-589.446) (-588.613) (-591.479) [-588.077] -- 0:00:37
382000 -- (-587.673) [-586.291] (-593.323) (-587.371) * (-589.288) (-588.193) (-586.211) [-589.990] -- 0:00:37
382500 -- (-592.296) (-586.603) (-588.647) [-587.109] * (-588.514) [-589.766] (-586.241) (-590.786) -- 0:00:37
383000 -- (-591.169) (-589.169) (-588.645) [-586.868] * [-586.623] (-587.502) (-589.989) (-594.255) -- 0:00:37
383500 -- (-587.747) (-588.343) (-586.951) [-587.808] * [-588.988] (-588.156) (-587.971) (-587.710) -- 0:00:36
384000 -- (-588.958) (-587.484) [-588.576] (-589.022) * (-587.860) (-589.384) [-588.428] (-589.128) -- 0:00:36
384500 -- (-588.713) (-586.654) (-590.256) [-591.563] * (-589.970) (-588.860) [-587.310] (-586.518) -- 0:00:36
385000 -- [-589.683] (-589.655) (-587.027) (-588.352) * (-589.799) (-589.748) [-590.668] (-586.079) -- 0:00:36
Average standard deviation of split frequencies: 0.009617
385500 -- (-588.179) [-587.979] (-588.467) (-588.074) * (-588.629) (-589.807) (-596.341) [-588.715] -- 0:00:36
386000 -- (-589.161) (-586.561) (-590.755) [-587.793] * [-589.448] (-587.583) (-587.741) (-589.588) -- 0:00:36
386500 -- (-591.183) (-589.081) [-588.424] (-587.900) * (-587.221) (-587.955) [-588.513] (-587.111) -- 0:00:36
387000 -- (-588.802) (-587.862) [-588.043] (-586.780) * (-588.507) (-589.042) [-589.223] (-588.666) -- 0:00:36
387500 -- (-590.763) [-588.809] (-587.408) (-588.437) * (-587.808) (-592.504) (-591.220) [-588.723] -- 0:00:36
388000 -- (-590.728) [-588.712] (-588.878) (-588.980) * (-588.070) [-586.714] (-590.848) (-587.598) -- 0:00:36
388500 -- (-590.420) (-587.307) [-592.440] (-589.318) * (-588.530) (-591.282) (-589.886) [-588.702] -- 0:00:37
389000 -- (-587.426) (-588.218) (-588.023) [-591.627] * (-589.803) (-588.152) (-589.634) [-588.148] -- 0:00:37
389500 -- (-590.006) (-588.241) (-590.994) [-587.937] * (-589.524) [-587.541] (-591.309) (-587.586) -- 0:00:37
390000 -- (-587.486) (-588.991) [-586.919] (-589.429) * (-587.619) [-588.293] (-589.811) (-593.310) -- 0:00:37
Average standard deviation of split frequencies: 0.010785
390500 -- (-589.178) (-588.900) (-587.091) [-589.278] * (-587.711) (-588.895) [-587.562] (-588.297) -- 0:00:37
391000 -- (-587.274) [-589.111] (-588.670) (-588.749) * (-586.838) (-593.757) [-591.073] (-588.720) -- 0:00:37
391500 -- (-587.009) [-591.765] (-589.265) (-589.292) * (-589.001) [-590.758] (-593.407) (-586.431) -- 0:00:37
392000 -- [-587.729] (-588.462) (-589.774) (-588.867) * [-587.032] (-587.752) (-588.552) (-586.487) -- 0:00:37
392500 -- (-587.901) (-588.830) (-590.042) [-586.855] * (-587.111) (-592.281) (-589.315) [-586.248] -- 0:00:37
393000 -- (-587.264) [-587.056] (-594.283) (-588.633) * (-587.216) (-589.057) [-588.984] (-589.102) -- 0:00:37
393500 -- [-587.802] (-587.807) (-591.424) (-586.531) * (-592.134) (-590.785) [-589.884] (-586.878) -- 0:00:36
394000 -- (-586.756) (-587.137) (-587.759) [-587.178] * (-589.801) [-588.775] (-591.376) (-586.466) -- 0:00:36
394500 -- [-590.367] (-588.966) (-589.571) (-587.226) * (-591.105) (-589.409) [-589.849] (-589.227) -- 0:00:36
395000 -- (-588.258) (-587.823) (-587.745) [-587.455] * (-586.973) (-588.029) (-589.005) [-587.476] -- 0:00:36
Average standard deviation of split frequencies: 0.009523
395500 -- [-587.722] (-587.251) (-587.429) (-587.207) * [-595.967] (-588.303) (-587.173) (-587.641) -- 0:00:36
396000 -- (-591.267) (-591.314) (-589.773) [-586.134] * (-591.815) (-586.789) (-586.190) [-586.816] -- 0:00:36
396500 -- (-586.837) (-593.874) (-588.897) [-588.985] * (-586.501) (-592.664) (-593.283) [-587.706] -- 0:00:36
397000 -- (-588.450) (-592.123) (-589.011) [-589.336] * [-586.546] (-595.414) (-589.698) (-587.365) -- 0:00:36
397500 -- (-587.128) (-593.823) [-588.651] (-588.676) * (-591.763) (-586.996) (-587.768) [-588.428] -- 0:00:36
398000 -- (-590.390) (-592.260) (-590.072) [-590.220] * (-587.855) (-587.909) [-587.871] (-589.350) -- 0:00:36
398500 -- (-587.394) (-587.610) [-589.622] (-593.346) * (-587.611) (-589.955) [-587.926] (-591.213) -- 0:00:36
399000 -- (-588.798) (-591.921) [-590.883] (-590.394) * (-589.053) [-588.051] (-588.003) (-587.790) -- 0:00:36
399500 -- (-587.713) (-587.491) (-590.319) [-587.413] * (-589.053) [-588.328] (-590.400) (-589.586) -- 0:00:36
400000 -- [-587.066] (-590.249) (-588.706) (-587.846) * (-586.633) [-588.849] (-590.171) (-590.227) -- 0:00:36
Average standard deviation of split frequencies: 0.009633
400500 -- [-587.821] (-587.657) (-587.725) (-586.993) * (-588.023) [-588.342] (-589.191) (-586.487) -- 0:00:35
401000 -- (-589.648) (-587.945) [-587.204] (-588.213) * (-588.722) (-588.110) [-587.682] (-587.453) -- 0:00:35
401500 -- (-590.868) (-593.086) (-589.110) [-589.709] * [-587.716] (-590.568) (-588.535) (-589.067) -- 0:00:35
402000 -- (-591.384) [-587.699] (-586.457) (-590.334) * (-586.242) (-590.638) [-588.184] (-587.805) -- 0:00:35
402500 -- (-588.784) (-587.048) [-588.056] (-587.104) * (-590.746) (-591.159) [-590.366] (-589.142) -- 0:00:35
403000 -- (-587.991) (-588.093) [-587.816] (-588.543) * (-590.016) (-587.642) [-589.237] (-588.842) -- 0:00:35
403500 -- (-587.445) [-588.554] (-592.447) (-588.784) * [-589.506] (-591.164) (-591.222) (-588.165) -- 0:00:35
404000 -- (-587.118) (-586.891) [-586.824] (-588.719) * (-589.389) [-587.747] (-589.899) (-587.457) -- 0:00:35
404500 -- (-590.666) (-591.567) (-589.738) [-586.754] * [-591.726] (-590.217) (-590.309) (-588.239) -- 0:00:35
405000 -- (-588.910) (-587.071) [-588.569] (-588.030) * (-586.863) [-590.499] (-587.222) (-590.502) -- 0:00:35
Average standard deviation of split frequencies: 0.009652
405500 -- (-589.626) (-593.428) (-587.756) [-587.063] * (-591.046) (-589.098) (-588.399) [-588.557] -- 0:00:36
406000 -- (-587.374) (-590.612) [-586.995] (-588.155) * (-588.524) (-588.666) [-588.411] (-588.423) -- 0:00:36
406500 -- (-587.354) (-588.263) [-588.253] (-587.408) * (-589.981) (-587.862) (-590.006) [-586.748] -- 0:00:36
407000 -- (-588.115) (-590.243) (-588.027) [-587.333] * (-593.640) (-587.340) [-590.781] (-588.396) -- 0:00:36
407500 -- [-587.426] (-592.102) (-591.448) (-588.234) * (-588.471) (-588.776) (-588.355) [-588.098] -- 0:00:36
408000 -- (-590.013) (-590.727) [-587.171] (-587.838) * [-586.412] (-588.865) (-587.961) (-588.413) -- 0:00:36
408500 -- (-589.456) (-588.121) [-588.150] (-587.795) * (-586.356) [-587.463] (-588.115) (-587.871) -- 0:00:36
409000 -- [-590.858] (-587.489) (-589.941) (-589.421) * [-586.986] (-588.768) (-586.533) (-589.461) -- 0:00:36
409500 -- (-587.947) [-589.468] (-587.261) (-591.453) * [-589.847] (-588.061) (-589.536) (-586.606) -- 0:00:36
410000 -- (-587.671) (-592.587) [-586.674] (-588.866) * (-589.227) (-587.868) (-586.442) [-588.023] -- 0:00:35
Average standard deviation of split frequencies: 0.009111
410500 -- (-590.880) (-588.453) [-587.578] (-589.668) * (-589.401) (-590.399) [-587.983] (-587.285) -- 0:00:35
411000 -- (-589.646) (-595.525) [-587.626] (-590.304) * (-587.924) (-589.852) [-587.531] (-591.219) -- 0:00:35
411500 -- (-591.090) (-589.331) (-587.401) [-586.934] * [-587.980] (-590.200) (-588.493) (-588.457) -- 0:00:35
412000 -- (-591.087) (-587.307) (-587.401) [-590.464] * (-589.572) (-588.651) [-587.742] (-589.910) -- 0:00:35
412500 -- [-586.499] (-590.516) (-588.306) (-588.707) * (-589.952) [-590.733] (-588.095) (-587.285) -- 0:00:35
413000 -- [-587.448] (-587.420) (-590.954) (-587.399) * [-590.567] (-587.236) (-589.200) (-590.505) -- 0:00:35
413500 -- (-587.834) (-589.115) (-588.594) [-587.912] * (-589.925) (-587.610) [-588.793] (-589.492) -- 0:00:35
414000 -- (-588.688) (-586.801) (-587.787) [-587.946] * (-596.139) [-592.910] (-588.259) (-590.442) -- 0:00:35
414500 -- [-586.729] (-586.448) (-594.543) (-587.692) * (-589.722) (-592.135) (-589.003) [-589.900] -- 0:00:35
415000 -- (-586.225) (-588.325) [-592.513] (-588.188) * [-587.850] (-588.584) (-589.041) (-591.022) -- 0:00:35
Average standard deviation of split frequencies: 0.007932
415500 -- (-589.509) [-588.816] (-591.255) (-590.501) * (-588.003) [-586.996] (-588.768) (-592.498) -- 0:00:35
416000 -- (-587.348) (-591.813) [-588.730] (-592.673) * (-587.908) (-586.929) (-587.713) [-590.554] -- 0:00:35
416500 -- [-587.999] (-589.414) (-586.444) (-590.087) * (-587.577) [-590.367] (-590.038) (-589.968) -- 0:00:35
417000 -- (-587.785) [-588.258] (-586.662) (-589.128) * (-587.978) (-594.645) [-590.682] (-591.594) -- 0:00:34
417500 -- (-588.825) [-587.772] (-588.150) (-588.927) * [-586.846] (-594.997) (-590.218) (-589.450) -- 0:00:34
418000 -- [-588.567] (-587.828) (-590.940) (-595.051) * (-586.591) (-593.281) (-590.292) [-588.813] -- 0:00:34
418500 -- (-587.271) (-591.115) (-589.839) [-587.519] * (-597.493) [-589.435] (-588.620) (-589.155) -- 0:00:34
419000 -- [-586.816] (-588.876) (-589.758) (-586.896) * (-589.636) [-588.544] (-593.132) (-587.854) -- 0:00:34
419500 -- [-587.226] (-587.210) (-590.918) (-591.070) * (-588.686) (-590.034) (-589.182) [-590.203] -- 0:00:34
420000 -- [-587.213] (-589.670) (-586.816) (-588.907) * (-588.683) (-593.451) [-587.160] (-589.851) -- 0:00:35
Average standard deviation of split frequencies: 0.007004
420500 -- (-587.257) [-588.284] (-591.231) (-589.716) * (-589.411) (-588.262) [-586.703] (-587.394) -- 0:00:35
421000 -- (-588.945) (-587.284) [-586.107] (-591.825) * (-588.949) (-589.374) (-593.829) [-589.491] -- 0:00:35
421500 -- (-587.847) [-590.266] (-586.384) (-589.172) * (-588.165) [-588.589] (-588.144) (-590.038) -- 0:00:35
422000 -- (-590.186) [-587.656] (-588.417) (-587.888) * (-588.118) [-590.124] (-590.209) (-589.857) -- 0:00:35
422500 -- (-587.850) (-589.329) [-587.370] (-590.050) * (-586.615) (-596.813) [-587.430] (-595.980) -- 0:00:35
423000 -- (-589.283) [-587.700] (-590.638) (-588.231) * (-587.314) [-592.807] (-586.982) (-594.624) -- 0:00:35
423500 -- (-588.468) (-588.286) [-590.878] (-587.253) * (-586.789) (-589.694) (-587.572) [-591.812] -- 0:00:35
424000 -- [-588.980] (-592.379) (-588.331) (-588.105) * [-586.386] (-589.829) (-588.521) (-589.277) -- 0:00:35
424500 -- (-586.595) (-588.428) [-588.216] (-593.247) * (-587.478) (-590.759) [-587.958] (-586.761) -- 0:00:35
425000 -- (-587.619) [-587.590] (-588.075) (-587.208) * [-587.753] (-591.634) (-589.065) (-588.092) -- 0:00:35
Average standard deviation of split frequencies: 0.007469
425500 -- (-590.777) (-588.772) [-588.697] (-589.240) * (-587.487) [-587.600] (-587.573) (-592.455) -- 0:00:35
426000 -- (-592.529) [-587.185] (-588.251) (-591.887) * (-588.914) (-586.878) (-586.464) [-588.064] -- 0:00:35
426500 -- (-587.177) (-592.148) (-591.620) [-588.265] * (-588.663) (-587.658) (-588.585) [-586.883] -- 0:00:34
427000 -- [-586.672] (-589.343) (-587.025) (-588.300) * (-588.187) (-587.086) [-591.100] (-588.446) -- 0:00:34
427500 -- (-586.429) (-590.696) (-589.404) [-590.573] * (-588.519) [-588.908] (-587.088) (-587.331) -- 0:00:34
428000 -- (-587.116) (-588.594) [-588.315] (-591.500) * (-587.212) (-588.524) (-591.724) [-588.076] -- 0:00:34
428500 -- (-587.234) (-587.981) (-587.012) [-588.228] * (-587.089) (-588.417) [-590.465] (-587.147) -- 0:00:34
429000 -- (-589.721) (-589.549) [-587.105] (-586.789) * (-586.660) (-589.821) (-588.015) [-590.964] -- 0:00:34
429500 -- (-589.062) (-587.451) (-593.942) [-586.650] * [-586.272] (-589.576) (-590.982) (-591.319) -- 0:00:34
430000 -- [-589.302] (-588.680) (-590.678) (-586.260) * (-586.414) (-587.547) (-589.458) [-588.905] -- 0:00:34
Average standard deviation of split frequencies: 0.007183
430500 -- (-586.235) (-587.670) [-593.908] (-587.788) * [-588.079] (-587.597) (-586.551) (-586.901) -- 0:00:34
431000 -- (-587.865) (-589.310) [-589.674] (-586.659) * (-587.712) [-588.971] (-587.372) (-587.497) -- 0:00:34
431500 -- (-591.321) [-588.429] (-593.081) (-586.983) * [-586.942] (-588.846) (-593.094) (-588.768) -- 0:00:34
432000 -- (-592.372) (-587.391) (-590.474) [-587.928] * (-586.658) (-590.554) (-589.923) [-589.877] -- 0:00:34
432500 -- (-591.900) (-588.602) [-589.629] (-587.907) * [-586.798] (-586.679) (-589.135) (-589.663) -- 0:00:34
433000 -- (-587.307) (-588.918) (-589.198) [-593.320] * [-586.472] (-587.182) (-591.094) (-587.955) -- 0:00:34
433500 -- (-590.764) [-592.268] (-587.448) (-587.726) * [-587.600] (-588.428) (-589.830) (-591.971) -- 0:00:33
434000 -- [-588.386] (-588.221) (-590.898) (-589.373) * (-588.240) [-587.114] (-587.479) (-589.428) -- 0:00:33
434500 -- (-586.992) (-587.234) (-587.339) [-587.495] * (-587.726) (-587.415) [-588.549] (-588.457) -- 0:00:33
435000 -- [-587.020] (-587.763) (-586.976) (-591.746) * [-587.715] (-587.879) (-590.594) (-587.206) -- 0:00:33
Average standard deviation of split frequencies: 0.008041
435500 -- (-588.339) (-591.508) (-587.048) [-592.728] * (-587.177) (-588.415) [-587.571] (-588.489) -- 0:00:33
436000 -- (-593.613) (-592.424) [-589.001] (-590.293) * (-589.893) (-587.311) (-589.686) [-587.549] -- 0:00:33
436500 -- [-587.065] (-587.674) (-589.395) (-590.309) * (-588.078) (-589.704) (-590.321) [-586.411] -- 0:00:34
437000 -- [-588.247] (-588.745) (-591.064) (-592.126) * (-589.976) [-587.339] (-589.257) (-592.915) -- 0:00:34
437500 -- (-588.284) (-588.445) (-591.374) [-587.824] * (-587.648) (-590.880) (-586.978) [-587.799] -- 0:00:34
438000 -- [-586.273] (-589.415) (-588.671) (-588.274) * (-586.599) (-590.277) [-588.305] (-589.105) -- 0:00:34
438500 -- (-588.341) (-589.551) [-588.626] (-587.789) * (-587.037) (-586.873) (-591.464) [-587.213] -- 0:00:34
439000 -- (-591.493) [-587.665] (-590.927) (-586.954) * (-587.831) (-588.290) [-588.350] (-588.087) -- 0:00:34
439500 -- (-587.827) (-591.147) (-588.924) [-589.875] * (-591.239) [-589.429] (-590.525) (-587.850) -- 0:00:34
440000 -- [-591.892] (-587.532) (-590.386) (-587.284) * (-586.659) (-591.888) [-588.445] (-587.472) -- 0:00:34
Average standard deviation of split frequencies: 0.008625
440500 -- (-587.326) [-587.898] (-586.955) (-587.657) * (-586.212) (-591.907) (-588.511) [-587.860] -- 0:00:34
441000 -- (-588.613) (-588.650) (-587.303) [-589.694] * (-588.422) (-590.029) [-589.559] (-587.306) -- 0:00:34
441500 -- (-590.576) [-587.200] (-586.692) (-588.698) * [-587.532] (-589.856) (-590.588) (-595.259) -- 0:00:34
442000 -- [-587.035] (-587.432) (-586.970) (-589.600) * (-586.942) [-587.706] (-586.548) (-587.066) -- 0:00:34
442500 -- (-587.602) (-588.288) (-587.246) [-589.544] * (-588.671) (-589.408) (-590.501) [-588.289] -- 0:00:34
443000 -- (-590.918) [-588.083] (-587.110) (-590.340) * (-587.075) (-589.799) (-595.636) [-586.266] -- 0:00:33
443500 -- (-587.936) (-589.120) [-589.167] (-587.769) * (-586.311) [-589.127] (-588.713) (-588.145) -- 0:00:33
444000 -- (-588.168) [-587.555] (-587.761) (-588.013) * [-590.362] (-589.150) (-589.489) (-587.501) -- 0:00:33
444500 -- [-588.465] (-587.712) (-587.944) (-590.312) * (-588.427) (-590.647) [-587.669] (-587.004) -- 0:00:33
445000 -- (-586.900) (-587.785) (-589.091) [-591.278] * [-589.209] (-590.112) (-588.377) (-588.500) -- 0:00:33
Average standard deviation of split frequencies: 0.008949
445500 -- [-586.395] (-590.979) (-589.487) (-589.922) * (-587.483) (-588.343) (-587.691) [-587.112] -- 0:00:33
446000 -- (-596.780) (-587.569) [-587.837] (-590.123) * [-587.577] (-588.749) (-588.087) (-588.827) -- 0:00:33
446500 -- (-588.911) (-587.375) (-589.956) [-587.387] * (-589.571) (-591.768) (-587.126) [-587.102] -- 0:00:33
447000 -- [-587.470] (-589.080) (-587.350) (-590.575) * (-589.060) [-587.962] (-587.903) (-588.594) -- 0:00:33
447500 -- [-590.350] (-592.498) (-588.564) (-588.166) * (-589.272) (-589.376) [-587.408] (-588.534) -- 0:00:33
448000 -- (-588.053) (-588.301) [-586.546] (-591.710) * [-589.272] (-592.599) (-588.509) (-587.894) -- 0:00:33
448500 -- (-587.265) (-586.945) (-587.384) [-588.071] * (-588.587) (-586.673) [-589.108] (-588.508) -- 0:00:33
449000 -- (-588.005) [-586.680] (-586.559) (-589.253) * (-589.189) (-588.574) [-587.757] (-588.623) -- 0:00:33
449500 -- [-587.295] (-587.247) (-587.622) (-586.819) * (-587.887) [-588.043] (-586.875) (-588.869) -- 0:00:33
450000 -- (-587.259) [-589.567] (-586.380) (-590.052) * (-587.925) [-590.022] (-590.225) (-589.817) -- 0:00:33
Average standard deviation of split frequencies: 0.010181
450500 -- (-589.322) [-587.678] (-586.321) (-588.130) * (-589.256) (-587.547) (-591.876) [-587.146] -- 0:00:32
451000 -- [-587.945] (-589.212) (-587.705) (-587.695) * (-587.895) [-588.173] (-587.844) (-590.401) -- 0:00:32
451500 -- (-587.603) (-590.975) [-586.621] (-587.936) * (-588.624) [-588.042] (-588.399) (-590.242) -- 0:00:32
452000 -- (-591.024) (-587.950) [-589.747] (-587.321) * [-589.897] (-590.829) (-588.639) (-590.169) -- 0:00:32
452500 -- [-588.234] (-594.260) (-590.474) (-588.824) * (-588.378) (-589.051) (-587.208) [-589.673] -- 0:00:32
453000 -- [-591.300] (-592.173) (-590.541) (-587.481) * (-590.529) [-586.775] (-587.818) (-591.364) -- 0:00:32
453500 -- (-589.243) (-586.396) (-590.374) [-586.945] * (-586.887) [-586.726] (-590.934) (-591.611) -- 0:00:33
454000 -- [-589.449] (-588.824) (-586.275) (-588.970) * [-588.105] (-587.759) (-587.255) (-589.616) -- 0:00:33
454500 -- (-590.386) (-592.651) [-586.414] (-587.231) * [-591.698] (-587.680) (-587.499) (-587.073) -- 0:00:33
455000 -- (-588.907) [-588.577] (-586.390) (-586.549) * (-587.773) [-587.993] (-589.401) (-588.014) -- 0:00:33
Average standard deviation of split frequencies: 0.009718
455500 -- [-586.981] (-588.077) (-588.840) (-586.487) * (-587.221) (-587.645) [-587.394] (-588.161) -- 0:00:33
456000 -- [-589.240] (-588.416) (-587.631) (-590.295) * (-587.962) [-588.992] (-588.912) (-588.176) -- 0:00:33
456500 -- (-586.659) [-589.902] (-587.702) (-590.379) * (-591.489) (-588.099) [-587.586] (-588.046) -- 0:00:33
457000 -- (-588.069) [-587.736] (-587.989) (-589.477) * (-588.385) (-588.355) (-588.746) [-586.836] -- 0:00:33
457500 -- (-587.365) (-588.387) (-589.603) [-587.143] * [-591.039] (-586.261) (-589.236) (-589.832) -- 0:00:33
458000 -- [-586.971] (-586.850) (-588.445) (-587.543) * [-587.591] (-589.164) (-587.199) (-587.068) -- 0:00:33
458500 -- [-586.403] (-586.981) (-587.483) (-588.932) * (-587.323) [-588.018] (-593.263) (-586.350) -- 0:00:33
459000 -- [-586.361] (-591.049) (-589.471) (-588.770) * (-588.572) [-586.797] (-587.642) (-587.132) -- 0:00:33
459500 -- (-588.106) (-587.822) [-590.842] (-589.292) * (-589.750) (-595.055) (-589.795) [-587.540] -- 0:00:32
460000 -- (-589.965) (-591.297) (-591.083) [-586.833] * (-590.086) (-588.085) (-587.839) [-590.146] -- 0:00:32
Average standard deviation of split frequencies: 0.009892
460500 -- [-588.297] (-592.727) (-587.710) (-589.071) * [-590.953] (-590.816) (-588.831) (-588.483) -- 0:00:32
461000 -- (-589.439) (-590.513) [-588.578] (-587.008) * (-588.113) [-589.954] (-590.100) (-588.249) -- 0:00:32
461500 -- [-592.361] (-586.554) (-588.389) (-592.734) * (-587.631) (-589.920) (-590.275) [-588.866] -- 0:00:32
462000 -- (-588.848) [-588.917] (-588.218) (-586.371) * [-588.603] (-588.014) (-589.261) (-586.242) -- 0:00:32
462500 -- (-586.658) [-586.931] (-587.760) (-587.675) * (-589.087) [-590.484] (-587.614) (-588.307) -- 0:00:32
463000 -- [-586.806] (-590.044) (-588.227) (-588.997) * (-589.054) (-587.223) (-589.507) [-587.248] -- 0:00:32
463500 -- [-588.961] (-586.884) (-588.226) (-588.257) * (-587.257) (-588.205) [-588.485] (-588.413) -- 0:00:32
464000 -- (-589.841) (-588.090) (-588.400) [-587.892] * (-590.479) (-590.277) [-587.166] (-589.727) -- 0:00:32
464500 -- (-592.135) (-588.092) (-590.408) [-587.333] * (-591.376) (-592.066) (-589.031) [-589.324] -- 0:00:32
465000 -- [-588.764] (-587.234) (-587.761) (-587.148) * [-587.833] (-587.621) (-591.135) (-587.285) -- 0:00:32
Average standard deviation of split frequencies: 0.009644
465500 -- (-586.429) (-587.279) (-587.510) [-589.114] * (-587.329) (-587.281) [-589.046] (-589.570) -- 0:00:32
466000 -- (-587.886) (-590.917) (-588.740) [-591.474] * (-587.082) (-587.603) [-590.324] (-591.788) -- 0:00:32
466500 -- (-587.945) [-589.902] (-588.067) (-587.393) * (-587.492) (-586.815) [-587.673] (-587.986) -- 0:00:32
467000 -- (-589.649) [-591.158] (-589.327) (-587.745) * [-591.195] (-587.881) (-588.853) (-592.150) -- 0:00:31
467500 -- (-587.960) (-588.195) (-586.653) [-587.576] * (-590.401) [-591.168] (-586.925) (-592.576) -- 0:00:31
468000 -- (-587.614) (-591.181) (-587.089) [-588.377] * (-588.982) [-588.620] (-588.013) (-589.499) -- 0:00:31
468500 -- (-591.130) (-588.074) [-586.388] (-587.478) * (-589.684) (-590.868) (-587.927) [-587.698] -- 0:00:31
469000 -- (-590.120) [-587.069] (-590.384) (-589.726) * [-591.624] (-591.157) (-590.824) (-594.632) -- 0:00:31
469500 -- (-591.487) (-587.548) (-587.478) [-588.205] * (-588.862) (-586.511) (-587.544) [-590.215] -- 0:00:31
470000 -- (-588.693) (-586.379) (-589.726) [-589.030] * [-588.196] (-589.665) (-589.678) (-588.194) -- 0:00:31
Average standard deviation of split frequencies: 0.010149
470500 -- [-591.479] (-586.531) (-592.583) (-589.243) * (-590.547) [-588.498] (-587.421) (-590.028) -- 0:00:32
471000 -- (-593.911) [-586.611] (-589.204) (-587.498) * (-590.613) [-589.170] (-589.260) (-588.995) -- 0:00:32
471500 -- [-589.987] (-589.288) (-588.421) (-589.491) * (-588.677) (-590.270) (-586.568) [-589.585] -- 0:00:32
472000 -- (-590.086) (-588.829) [-587.455] (-586.221) * (-587.931) (-587.566) (-590.349) [-591.548] -- 0:00:32
472500 -- [-587.377] (-590.231) (-587.803) (-590.702) * (-586.940) [-592.084] (-591.322) (-587.824) -- 0:00:32
473000 -- (-587.301) [-587.385] (-588.048) (-595.179) * (-586.968) [-589.056] (-589.551) (-588.445) -- 0:00:32
473500 -- (-587.223) (-587.490) (-587.476) [-588.760] * (-588.634) [-587.565] (-591.833) (-587.533) -- 0:00:32
474000 -- (-588.599) (-587.118) [-586.506] (-587.534) * (-589.176) [-588.670] (-589.462) (-588.313) -- 0:00:32
474500 -- (-588.029) (-588.500) (-589.691) [-587.756] * [-591.020] (-588.784) (-592.294) (-587.613) -- 0:00:32
475000 -- (-590.952) (-593.101) (-588.849) [-586.146] * [-587.373] (-589.664) (-589.972) (-589.493) -- 0:00:32
Average standard deviation of split frequencies: 0.010432
475500 -- (-587.762) (-589.506) [-588.341] (-587.506) * (-589.444) (-589.228) (-589.021) [-590.901] -- 0:00:31
476000 -- (-587.181) (-588.226) [-586.712] (-588.710) * (-588.165) [-590.497] (-588.489) (-587.782) -- 0:00:31
476500 -- (-594.451) [-588.319] (-586.911) (-587.539) * (-586.652) (-589.149) [-589.110] (-590.629) -- 0:00:31
477000 -- (-589.811) [-588.077] (-586.480) (-588.587) * [-586.620] (-587.200) (-587.970) (-587.218) -- 0:00:31
477500 -- (-588.595) (-588.963) (-587.484) [-589.705] * (-586.829) (-587.311) (-588.392) [-587.107] -- 0:00:31
478000 -- (-588.156) (-590.220) (-587.406) [-587.961] * (-587.149) (-586.842) [-586.287] (-587.661) -- 0:00:31
478500 -- [-586.685] (-586.927) (-591.919) (-588.445) * (-589.354) [-588.700] (-589.765) (-587.182) -- 0:00:31
479000 -- (-586.686) [-587.093] (-588.686) (-587.091) * (-589.985) (-587.596) (-590.490) [-588.058] -- 0:00:31
479500 -- [-586.739] (-587.816) (-588.809) (-588.889) * (-586.830) (-587.536) [-589.623] (-587.640) -- 0:00:31
480000 -- (-589.165) (-587.865) (-588.625) [-591.995] * (-586.375) [-589.252] (-587.254) (-588.250) -- 0:00:31
Average standard deviation of split frequencies: 0.009284
480500 -- (-586.726) (-587.564) [-586.567] (-589.326) * (-586.934) (-588.097) [-587.930] (-589.385) -- 0:00:31
481000 -- (-586.903) [-588.250] (-588.417) (-587.793) * [-590.571] (-588.517) (-590.237) (-589.677) -- 0:00:31
481500 -- (-591.274) (-588.835) (-588.050) [-587.770] * (-587.527) (-587.611) (-587.335) [-588.410] -- 0:00:31
482000 -- (-587.819) (-587.989) [-587.375] (-591.646) * (-589.589) (-586.612) (-587.690) [-587.583] -- 0:00:31
482500 -- [-588.906] (-587.847) (-589.092) (-587.664) * (-588.426) (-588.440) [-589.778] (-590.577) -- 0:00:31
483000 -- [-587.599] (-592.013) (-589.510) (-589.408) * [-587.697] (-588.373) (-590.184) (-593.791) -- 0:00:31
483500 -- (-589.183) (-587.114) [-587.387] (-588.144) * (-587.767) [-586.626] (-590.237) (-588.519) -- 0:00:30
484000 -- (-586.566) (-586.980) (-587.592) [-589.741] * (-591.150) [-588.873] (-587.864) (-588.445) -- 0:00:30
484500 -- (-588.221) [-586.595] (-587.134) (-588.495) * (-587.238) (-589.112) (-589.197) [-587.070] -- 0:00:30
485000 -- [-586.903] (-587.741) (-593.015) (-587.997) * (-587.975) [-587.776] (-588.527) (-586.962) -- 0:00:30
Average standard deviation of split frequencies: 0.009635
485500 -- (-586.349) (-587.298) [-587.748] (-591.268) * (-592.453) [-589.149] (-589.286) (-587.785) -- 0:00:30
486000 -- (-590.230) (-588.540) (-587.694) [-588.816] * [-589.594] (-591.817) (-590.281) (-588.456) -- 0:00:30
486500 -- [-588.037] (-589.386) (-590.037) (-587.807) * (-587.773) (-589.099) [-588.491] (-591.039) -- 0:00:30
487000 -- (-588.209) [-587.098] (-588.555) (-589.309) * (-588.051) [-587.544] (-589.703) (-587.312) -- 0:00:31
487500 -- (-587.267) (-588.015) [-586.226] (-591.879) * [-588.995] (-589.788) (-588.256) (-589.831) -- 0:00:31
488000 -- (-591.917) (-590.225) (-587.634) [-588.747] * (-587.544) (-589.655) (-591.339) [-587.944] -- 0:00:31
488500 -- [-588.212] (-587.974) (-588.094) (-591.981) * (-589.644) [-588.222] (-591.183) (-587.824) -- 0:00:31
489000 -- (-587.321) (-589.193) (-590.308) [-592.745] * (-588.659) [-586.817] (-593.368) (-591.810) -- 0:00:31
489500 -- (-586.595) [-589.868] (-587.956) (-587.711) * [-586.645] (-588.057) (-588.367) (-588.142) -- 0:00:31
490000 -- [-587.169] (-588.290) (-590.148) (-587.195) * (-592.894) (-587.434) (-589.938) [-588.102] -- 0:00:31
Average standard deviation of split frequencies: 0.009928
490500 -- (-586.763) (-587.607) (-588.544) [-586.893] * (-593.810) (-588.645) [-587.836] (-588.931) -- 0:00:31
491000 -- [-586.676] (-587.536) (-587.369) (-590.847) * (-590.508) [-588.888] (-586.920) (-587.647) -- 0:00:31
491500 -- (-598.881) (-587.509) (-587.410) [-588.094] * (-592.197) [-587.298] (-587.901) (-592.466) -- 0:00:31
492000 -- (-587.512) [-587.187] (-588.658) (-589.055) * (-587.777) (-589.338) (-589.640) [-587.074] -- 0:00:30
492500 -- (-589.567) (-587.864) [-588.324] (-587.687) * (-590.516) (-588.820) [-589.038] (-590.691) -- 0:00:30
493000 -- (-589.929) [-588.511] (-586.688) (-590.681) * (-592.115) [-589.177] (-591.676) (-588.293) -- 0:00:30
493500 -- (-589.344) (-586.575) (-588.850) [-588.896] * [-587.729] (-588.098) (-590.950) (-587.715) -- 0:00:30
494000 -- (-588.177) (-586.908) [-587.508] (-590.702) * (-595.281) (-588.396) [-592.120] (-588.368) -- 0:00:30
494500 -- (-588.240) (-587.146) (-587.436) [-587.362] * (-589.225) (-588.013) (-592.294) [-589.884] -- 0:00:30
495000 -- (-586.605) [-586.986] (-587.757) (-587.889) * (-588.475) [-586.609] (-586.896) (-592.793) -- 0:00:30
Average standard deviation of split frequencies: 0.010201
495500 -- (-591.512) [-588.491] (-588.295) (-586.982) * (-587.765) [-586.545] (-589.258) (-592.387) -- 0:00:30
496000 -- (-588.843) [-587.391] (-589.771) (-586.674) * [-586.919] (-588.081) (-587.842) (-588.573) -- 0:00:30
496500 -- (-591.856) [-586.468] (-592.969) (-592.115) * (-587.694) [-590.196] (-590.291) (-588.269) -- 0:00:30
497000 -- (-587.970) (-586.665) (-588.932) [-587.826] * (-588.926) (-589.358) (-590.687) [-589.721] -- 0:00:30
497500 -- (-587.014) (-586.555) [-587.420] (-592.151) * (-589.716) (-589.299) [-587.288] (-594.817) -- 0:00:30
498000 -- (-589.334) (-589.029) (-587.535) [-590.332] * (-591.663) [-588.469] (-586.089) (-591.658) -- 0:00:30
498500 -- (-586.850) [-589.173] (-588.844) (-596.537) * [-588.546] (-587.489) (-590.867) (-588.686) -- 0:00:30
499000 -- (-588.230) [-587.594] (-590.370) (-595.105) * (-591.299) (-586.441) [-588.371] (-587.553) -- 0:00:30
499500 -- (-589.077) (-589.124) [-593.776] (-587.653) * (-598.454) (-586.433) (-588.884) [-588.576] -- 0:00:30
500000 -- (-589.429) [-589.306] (-587.024) (-587.602) * (-586.540) (-590.205) (-588.471) [-588.645] -- 0:00:30
Average standard deviation of split frequencies: 0.010734
500500 -- (-587.413) (-589.155) (-589.651) [-588.750] * (-587.963) [-589.045] (-588.419) (-590.117) -- 0:00:29
501000 -- (-586.980) [-591.776] (-590.985) (-589.092) * [-587.960] (-588.825) (-587.363) (-588.275) -- 0:00:29
501500 -- (-589.488) [-589.170] (-590.261) (-588.481) * (-587.610) (-588.109) (-589.181) [-588.843] -- 0:00:29
502000 -- (-588.989) [-589.271] (-590.071) (-587.839) * [-593.275] (-588.667) (-589.577) (-587.738) -- 0:00:29
502500 -- (-587.295) [-588.992] (-587.656) (-586.868) * (-594.669) (-590.820) (-590.891) [-587.208] -- 0:00:29
503000 -- (-588.542) [-587.297] (-592.476) (-587.167) * (-591.181) (-592.574) (-587.786) [-586.563] -- 0:00:29
503500 -- [-588.466] (-589.474) (-594.934) (-587.008) * (-588.149) [-588.593] (-588.630) (-591.009) -- 0:00:30
504000 -- (-589.778) [-588.622] (-589.662) (-588.409) * (-589.288) (-588.344) (-588.252) [-592.229] -- 0:00:30
504500 -- (-587.251) [-589.111] (-589.286) (-587.486) * (-586.757) (-587.358) (-588.052) [-586.472] -- 0:00:30
505000 -- (-588.720) [-590.781] (-588.512) (-588.674) * (-588.745) (-587.011) (-588.666) [-586.906] -- 0:00:30
Average standard deviation of split frequencies: 0.011428
505500 -- (-590.913) (-586.719) [-588.018] (-586.955) * (-587.582) [-588.755] (-589.036) (-586.599) -- 0:00:30
506000 -- (-588.231) [-589.289] (-588.202) (-587.679) * (-588.502) (-592.116) (-588.014) [-589.359] -- 0:00:30
506500 -- [-589.352] (-590.232) (-587.966) (-588.500) * (-588.585) (-586.695) (-588.044) [-587.799] -- 0:00:30
507000 -- (-589.694) (-589.984) (-587.328) [-586.779] * (-587.789) (-586.279) [-588.674] (-589.165) -- 0:00:30
507500 -- [-588.800] (-589.295) (-590.516) (-589.861) * (-586.617) (-590.748) [-588.693] (-590.851) -- 0:00:30
508000 -- (-589.925) [-588.655] (-587.373) (-592.789) * [-589.651] (-589.648) (-587.622) (-588.997) -- 0:00:30
508500 -- (-588.511) [-588.028] (-586.870) (-588.400) * (-590.198) (-591.073) (-592.468) [-589.756] -- 0:00:29
509000 -- [-588.642] (-589.644) (-586.268) (-589.763) * (-586.990) [-587.332] (-589.745) (-588.299) -- 0:00:29
509500 -- (-586.469) (-591.846) (-588.191) [-592.534] * (-587.499) (-586.518) (-587.468) [-592.530] -- 0:00:29
510000 -- (-586.864) (-589.872) [-586.630] (-591.816) * (-587.333) (-587.879) [-589.915] (-587.479) -- 0:00:29
Average standard deviation of split frequencies: 0.011200
510500 -- [-587.400] (-590.056) (-587.005) (-593.233) * (-587.007) (-587.228) [-589.437] (-588.112) -- 0:00:29
511000 -- (-587.198) [-592.749] (-588.838) (-591.758) * (-596.804) [-590.077] (-591.280) (-590.584) -- 0:00:29
511500 -- (-587.372) [-589.406] (-591.436) (-597.072) * [-588.651] (-588.786) (-586.684) (-588.785) -- 0:00:29
512000 -- (-587.967) (-590.785) (-590.053) [-590.526] * (-587.495) (-591.053) [-588.012] (-590.404) -- 0:00:29
512500 -- (-588.605) (-590.677) [-590.868] (-588.190) * [-587.752] (-594.990) (-590.483) (-589.038) -- 0:00:29
513000 -- [-588.312] (-588.376) (-589.317) (-588.387) * (-587.507) (-587.706) [-590.898] (-587.756) -- 0:00:29
513500 -- (-589.026) [-587.646] (-592.534) (-588.580) * (-587.849) [-589.666] (-587.028) (-587.413) -- 0:00:29
514000 -- (-587.849) (-587.741) [-589.221] (-586.555) * [-586.942] (-591.283) (-590.423) (-594.783) -- 0:00:29
514500 -- (-587.564) (-588.492) [-592.104] (-588.580) * [-588.721] (-587.416) (-590.377) (-588.545) -- 0:00:29
515000 -- [-589.728] (-589.008) (-587.511) (-587.058) * [-588.055] (-586.947) (-591.126) (-587.087) -- 0:00:29
Average standard deviation of split frequencies: 0.010780
515500 -- (-592.164) [-590.429] (-589.315) (-588.004) * (-590.058) (-587.454) (-589.091) [-591.670] -- 0:00:29
516000 -- (-589.644) [-589.536] (-588.901) (-587.010) * (-587.555) (-588.568) (-587.554) [-588.739] -- 0:00:29
516500 -- (-587.243) (-586.104) (-587.888) [-590.546] * (-586.953) [-586.642] (-587.462) (-589.305) -- 0:00:29
517000 -- [-586.370] (-590.699) (-591.535) (-590.020) * (-587.585) [-586.597] (-586.343) (-587.559) -- 0:00:28
517500 -- [-587.393] (-587.566) (-587.752) (-591.192) * (-589.574) [-586.838] (-586.706) (-586.292) -- 0:00:28
518000 -- [-589.277] (-587.947) (-592.017) (-588.103) * (-590.085) (-591.069) [-586.529] (-587.231) -- 0:00:28
518500 -- (-586.749) (-587.610) (-588.011) [-588.312] * (-589.853) (-590.163) (-586.418) [-590.049] -- 0:00:28
519000 -- (-587.382) [-586.647] (-587.174) (-587.470) * (-595.098) (-594.156) (-589.548) [-589.973] -- 0:00:28
519500 -- (-587.453) [-588.396] (-590.807) (-591.630) * (-590.896) (-590.206) (-587.951) [-587.669] -- 0:00:28
520000 -- (-589.281) (-587.932) [-587.502] (-588.884) * (-588.044) (-590.388) (-587.510) [-589.097] -- 0:00:28
Average standard deviation of split frequencies: 0.010804
520500 -- (-588.446) [-587.320] (-587.048) (-589.303) * (-587.826) (-587.631) [-587.972] (-589.437) -- 0:00:29
521000 -- (-586.750) (-587.449) [-588.957] (-589.248) * (-587.224) (-594.449) [-588.547] (-586.685) -- 0:00:29
521500 -- (-589.392) [-588.211] (-589.707) (-592.723) * (-587.715) (-589.049) [-589.960] (-586.543) -- 0:00:29
522000 -- (-588.449) (-588.481) [-588.292] (-590.249) * (-593.436) [-586.797] (-588.761) (-586.629) -- 0:00:29
522500 -- (-588.630) [-587.181] (-586.480) (-587.878) * (-588.144) (-587.899) (-588.082) [-586.196] -- 0:00:29
523000 -- [-587.757] (-588.022) (-586.740) (-587.627) * [-588.311] (-594.312) (-589.450) (-587.557) -- 0:00:29
523500 -- [-587.687] (-587.769) (-588.273) (-591.892) * (-588.268) (-587.998) [-590.668] (-587.015) -- 0:00:29
524000 -- (-588.003) (-586.965) [-587.058] (-586.919) * (-586.628) [-586.268] (-588.343) (-586.992) -- 0:00:29
524500 -- [-587.086] (-586.351) (-587.350) (-588.863) * (-588.311) (-589.196) [-587.809] (-591.736) -- 0:00:29
525000 -- [-587.719] (-586.714) (-586.612) (-590.456) * (-589.250) [-588.998] (-589.685) (-591.496) -- 0:00:28
Average standard deviation of split frequencies: 0.010993
525500 -- (-587.604) (-588.299) (-589.201) [-586.738] * [-590.283] (-591.863) (-590.407) (-590.296) -- 0:00:28
526000 -- [-588.181] (-590.903) (-587.279) (-589.513) * (-588.585) [-591.728] (-586.896) (-588.766) -- 0:00:28
526500 -- (-588.398) [-587.406] (-590.127) (-589.471) * (-588.492) [-586.374] (-588.174) (-588.995) -- 0:00:28
527000 -- (-586.941) (-592.658) (-588.615) [-589.111] * (-589.363) (-588.144) [-587.880] (-586.890) -- 0:00:28
527500 -- (-586.793) [-588.982] (-587.738) (-591.155) * (-589.598) (-588.518) [-587.921] (-587.126) -- 0:00:28
528000 -- (-587.162) (-586.155) (-588.115) [-590.432] * [-590.095] (-587.337) (-588.039) (-588.456) -- 0:00:28
528500 -- (-590.436) (-587.569) [-589.481] (-587.905) * (-590.436) (-589.143) (-588.883) [-588.531] -- 0:00:28
529000 -- (-587.907) (-590.091) [-590.785] (-591.727) * (-591.283) (-589.719) (-589.908) [-590.109] -- 0:00:28
529500 -- [-587.372] (-587.082) (-589.476) (-590.536) * [-594.624] (-589.347) (-591.158) (-592.242) -- 0:00:28
530000 -- (-587.158) (-588.603) [-587.453] (-587.117) * (-587.735) [-587.589] (-587.148) (-588.531) -- 0:00:28
Average standard deviation of split frequencies: 0.010423
530500 -- (-589.491) [-588.869] (-591.022) (-587.118) * (-588.473) (-588.233) [-587.591] (-588.843) -- 0:00:28
531000 -- (-591.945) [-588.443] (-586.993) (-587.154) * (-592.540) [-586.975] (-586.635) (-589.955) -- 0:00:28
531500 -- (-587.745) [-588.245] (-587.891) (-598.318) * (-590.430) (-587.007) (-588.796) [-589.074] -- 0:00:28
532000 -- (-590.494) (-589.788) [-586.430] (-589.032) * (-587.748) (-589.936) (-591.607) [-588.365] -- 0:00:28
532500 -- (-587.963) [-588.463] (-586.435) (-587.191) * (-589.143) (-593.018) [-589.205] (-588.680) -- 0:00:28
533000 -- (-589.063) (-587.977) [-586.320] (-587.402) * (-588.704) (-589.182) [-589.633] (-589.230) -- 0:00:28
533500 -- (-589.161) [-588.354] (-589.112) (-587.699) * (-587.592) (-589.696) (-588.104) [-587.717] -- 0:00:27
534000 -- (-587.112) [-588.979] (-588.859) (-590.626) * (-586.719) [-588.455] (-589.283) (-587.995) -- 0:00:27
534500 -- (-590.850) (-587.918) (-588.308) [-586.481] * (-588.472) (-589.008) (-588.575) [-587.295] -- 0:00:27
535000 -- (-588.139) (-587.461) (-591.625) [-586.990] * (-588.532) (-588.802) (-593.572) [-586.215] -- 0:00:27
Average standard deviation of split frequencies: 0.010730
535500 -- [-590.510] (-587.432) (-587.033) (-590.638) * (-588.513) (-587.689) [-587.057] (-587.663) -- 0:00:27
536000 -- [-586.720] (-586.960) (-587.814) (-588.723) * [-591.298] (-590.208) (-589.610) (-587.555) -- 0:00:27
536500 -- (-588.989) [-587.809] (-587.077) (-589.210) * [-587.108] (-587.602) (-586.576) (-590.092) -- 0:00:27
537000 -- [-589.711] (-590.844) (-588.089) (-592.613) * [-587.330] (-586.985) (-586.771) (-589.311) -- 0:00:28
537500 -- (-588.497) (-589.597) (-587.353) [-588.207] * (-590.705) [-588.294] (-591.566) (-589.432) -- 0:00:28
538000 -- [-586.977] (-589.037) (-588.068) (-586.502) * (-589.185) (-587.782) (-586.719) [-590.382] -- 0:00:28
538500 -- [-586.861] (-590.720) (-588.512) (-587.948) * (-589.630) [-588.375] (-589.944) (-588.408) -- 0:00:28
539000 -- [-587.994] (-591.796) (-588.301) (-592.116) * (-589.273) (-587.375) [-589.395] (-587.709) -- 0:00:28
539500 -- (-589.022) (-589.262) (-588.170) [-590.228] * (-588.944) [-588.098] (-590.593) (-586.288) -- 0:00:28
540000 -- [-592.452] (-589.590) (-586.571) (-587.194) * (-590.929) [-586.539] (-591.509) (-586.261) -- 0:00:28
Average standard deviation of split frequencies: 0.010637
540500 -- (-588.348) (-587.312) [-589.584] (-590.036) * [-586.344] (-587.185) (-592.699) (-586.842) -- 0:00:28
541000 -- [-587.592] (-587.119) (-595.198) (-587.582) * (-588.995) (-587.979) (-598.849) [-592.488] -- 0:00:27
541500 -- (-589.565) (-588.021) (-595.611) [-586.674] * (-589.053) [-589.049] (-595.616) (-589.889) -- 0:00:27
542000 -- [-587.442] (-589.111) (-591.476) (-588.077) * (-589.873) [-587.924] (-593.093) (-587.850) -- 0:00:27
542500 -- (-587.822) [-587.635] (-593.555) (-587.387) * (-586.245) [-590.037] (-586.760) (-587.529) -- 0:00:27
543000 -- (-587.849) (-588.041) (-588.637) [-586.313] * (-588.131) (-588.248) (-586.911) [-587.191] -- 0:00:27
543500 -- [-586.582] (-587.695) (-589.952) (-589.024) * (-590.806) (-587.892) (-587.847) [-589.709] -- 0:00:27
544000 -- (-591.035) [-588.931] (-588.381) (-587.502) * (-587.905) (-588.113) [-587.917] (-589.781) -- 0:00:27
544500 -- (-590.437) (-590.559) (-587.598) [-587.676] * (-586.917) (-588.271) (-590.943) [-588.304] -- 0:00:27
545000 -- (-590.921) (-591.231) [-589.290] (-589.969) * (-591.044) [-589.471] (-589.832) (-590.575) -- 0:00:27
Average standard deviation of split frequencies: 0.010015
545500 -- (-587.201) (-589.036) [-588.904] (-588.516) * (-593.572) [-590.204] (-589.998) (-591.395) -- 0:00:27
546000 -- (-593.451) (-590.416) (-587.869) [-587.366] * (-589.236) (-589.076) [-586.776] (-589.098) -- 0:00:27
546500 -- (-590.736) (-588.375) (-587.750) [-588.871] * (-589.339) (-592.659) [-588.678] (-589.557) -- 0:00:27
547000 -- [-588.075] (-587.065) (-587.837) (-588.597) * (-593.505) (-588.483) [-587.086] (-588.455) -- 0:00:27
547500 -- (-587.228) (-587.665) (-589.085) [-587.632] * (-592.320) (-588.446) [-587.567] (-589.146) -- 0:00:27
548000 -- (-588.289) (-589.746) [-587.347] (-588.850) * [-588.563] (-590.036) (-587.074) (-587.356) -- 0:00:27
548500 -- [-586.902] (-587.924) (-587.408) (-592.515) * (-587.313) (-586.602) [-586.853] (-587.514) -- 0:00:27
549000 -- (-588.834) (-589.650) (-588.166) [-588.307] * (-594.796) (-588.492) (-587.654) [-587.347] -- 0:00:27
549500 -- [-589.240] (-589.568) (-589.914) (-588.621) * [-588.693] (-591.781) (-593.022) (-587.847) -- 0:00:27
550000 -- [-591.533] (-589.102) (-590.214) (-587.097) * (-591.603) (-588.278) [-588.074] (-590.586) -- 0:00:27
Average standard deviation of split frequencies: 0.010501
550500 -- (-588.637) [-588.137] (-587.452) (-589.172) * [-592.489] (-588.396) (-588.607) (-590.560) -- 0:00:26
551000 -- (-588.578) (-590.664) [-586.842] (-594.242) * (-588.971) [-587.488] (-588.590) (-590.584) -- 0:00:26
551500 -- [-590.032] (-588.470) (-587.061) (-587.150) * (-587.647) (-589.733) (-588.061) [-589.456] -- 0:00:26
552000 -- (-587.091) [-588.875] (-588.265) (-590.018) * [-586.508] (-586.341) (-589.815) (-593.071) -- 0:00:26
552500 -- [-588.325] (-589.256) (-587.408) (-591.734) * [-588.790] (-589.779) (-589.452) (-588.665) -- 0:00:26
553000 -- [-593.265] (-587.812) (-590.089) (-586.444) * (-587.613) (-589.938) [-588.158] (-588.314) -- 0:00:26
553500 -- (-592.139) [-588.102] (-587.712) (-586.852) * (-588.383) [-587.637] (-587.765) (-588.357) -- 0:00:26
554000 -- (-589.242) (-586.622) [-587.834] (-591.682) * (-590.304) (-587.477) [-586.507] (-591.816) -- 0:00:27
554500 -- [-592.509] (-593.236) (-587.912) (-589.845) * (-588.126) [-586.975] (-588.789) (-587.927) -- 0:00:27
555000 -- (-589.124) (-588.960) (-589.475) [-587.941] * (-588.242) (-590.487) [-587.340] (-587.177) -- 0:00:27
Average standard deviation of split frequencies: 0.010400
555500 -- (-591.946) (-587.354) [-587.075] (-588.338) * (-591.125) [-590.150] (-586.469) (-587.615) -- 0:00:27
556000 -- [-587.719] (-589.154) (-586.595) (-588.523) * (-591.029) [-587.118] (-588.001) (-587.106) -- 0:00:27
556500 -- (-589.632) (-587.547) (-589.653) [-589.953] * (-590.705) (-590.950) (-587.976) [-587.044] -- 0:00:27
557000 -- [-592.767] (-586.956) (-588.007) (-586.828) * (-593.015) (-591.166) (-591.636) [-588.058] -- 0:00:27
557500 -- (-587.952) (-589.732) [-588.544] (-586.905) * (-587.532) (-587.887) (-586.771) [-590.521] -- 0:00:26
558000 -- [-588.617] (-587.456) (-588.431) (-589.796) * (-589.153) (-590.570) (-588.729) [-587.566] -- 0:00:26
558500 -- (-587.505) (-587.067) [-587.258] (-594.751) * (-587.129) [-590.739] (-589.085) (-587.894) -- 0:00:26
559000 -- (-589.918) (-587.664) [-587.594] (-603.939) * (-586.919) (-588.709) (-588.920) [-588.276] -- 0:00:26
559500 -- (-587.485) [-588.617] (-592.428) (-597.869) * [-588.921] (-592.090) (-587.754) (-588.187) -- 0:00:26
560000 -- [-593.835] (-588.582) (-589.333) (-586.842) * (-588.657) (-587.134) (-587.770) [-593.190] -- 0:00:26
Average standard deviation of split frequencies: 0.010538
560500 -- (-591.500) (-587.825) [-588.735] (-589.033) * [-587.163] (-586.772) (-591.609) (-589.755) -- 0:00:26
561000 -- (-588.678) (-588.525) [-588.015] (-589.919) * (-591.405) (-588.179) [-587.804] (-588.000) -- 0:00:26
561500 -- [-587.814] (-588.188) (-587.447) (-586.547) * (-592.293) (-587.290) (-587.336) [-588.423] -- 0:00:26
562000 -- [-589.703] (-588.186) (-588.454) (-587.674) * [-591.205] (-590.984) (-589.210) (-586.342) -- 0:00:26
562500 -- (-590.582) [-587.028] (-589.221) (-590.017) * (-590.883) [-588.729] (-592.178) (-586.296) -- 0:00:26
563000 -- (-589.945) (-587.734) (-586.946) [-587.236] * [-587.786] (-594.123) (-586.843) (-591.201) -- 0:00:26
563500 -- [-588.490] (-586.881) (-588.399) (-589.789) * [-586.675] (-601.168) (-588.304) (-594.372) -- 0:00:26
564000 -- (-589.018) [-588.610] (-590.038) (-591.619) * [-590.025] (-592.504) (-587.585) (-596.108) -- 0:00:26
564500 -- [-586.989] (-586.832) (-588.036) (-588.809) * (-589.646) (-594.703) (-590.812) [-588.461] -- 0:00:26
565000 -- (-587.203) [-586.605] (-586.593) (-590.481) * [-588.325] (-593.675) (-591.084) (-590.365) -- 0:00:26
Average standard deviation of split frequencies: 0.010994
565500 -- (-587.973) [-589.125] (-586.653) (-589.080) * (-587.307) (-589.549) (-589.788) [-587.758] -- 0:00:26
566000 -- [-586.148] (-587.741) (-591.367) (-587.463) * (-588.843) [-588.516] (-591.922) (-589.093) -- 0:00:26
566500 -- [-587.108] (-588.033) (-587.022) (-587.470) * (-588.591) (-586.564) (-589.370) [-588.291] -- 0:00:26
567000 -- (-592.102) (-593.471) (-587.361) [-587.051] * (-588.418) [-587.457] (-592.339) (-587.941) -- 0:00:25
567500 -- (-589.250) (-589.913) (-589.556) [-587.840] * (-587.415) (-587.578) (-590.543) [-586.964] -- 0:00:25
568000 -- [-590.373] (-588.541) (-591.157) (-590.827) * (-588.518) (-587.031) [-588.663] (-588.975) -- 0:00:25
568500 -- (-587.299) (-589.487) (-587.890) [-589.340] * (-587.880) [-586.144] (-588.655) (-586.534) -- 0:00:25
569000 -- (-589.371) [-588.183] (-588.171) (-590.528) * (-588.755) [-587.049] (-589.343) (-590.176) -- 0:00:25
569500 -- (-591.350) [-589.399] (-588.039) (-589.336) * [-589.038] (-587.859) (-588.760) (-587.918) -- 0:00:25
570000 -- [-586.999] (-587.793) (-587.461) (-589.389) * (-591.310) [-590.347] (-589.691) (-586.835) -- 0:00:25
Average standard deviation of split frequencies: 0.010904
570500 -- (-587.490) [-587.547] (-586.770) (-589.532) * (-586.787) (-593.182) [-586.663] (-587.497) -- 0:00:25
571000 -- [-586.782] (-594.756) (-589.830) (-587.243) * (-588.469) [-591.302] (-587.386) (-587.060) -- 0:00:26
571500 -- [-586.791] (-592.034) (-590.214) (-586.724) * [-591.297] (-587.037) (-587.242) (-589.583) -- 0:00:26
572000 -- (-587.142) [-588.232] (-588.498) (-586.654) * (-590.561) [-586.575] (-590.663) (-589.457) -- 0:00:26
572500 -- (-588.659) [-587.463] (-587.277) (-590.994) * (-589.897) [-587.103] (-588.606) (-587.040) -- 0:00:26
573000 -- (-589.663) [-586.927] (-587.886) (-587.971) * (-589.797) (-586.472) (-593.981) [-590.227] -- 0:00:26
573500 -- (-586.827) (-589.058) (-592.830) [-586.902] * (-586.498) (-587.019) (-587.233) [-592.613] -- 0:00:26
574000 -- [-589.563] (-588.314) (-590.502) (-586.424) * (-587.488) (-589.441) [-587.267] (-587.772) -- 0:00:25
574500 -- (-590.451) (-586.979) (-589.034) [-586.862] * (-586.641) [-593.951] (-589.742) (-589.380) -- 0:00:25
575000 -- (-592.615) [-587.204] (-587.009) (-587.565) * (-587.197) (-588.606) (-589.651) [-592.340] -- 0:00:25
Average standard deviation of split frequencies: 0.011294
575500 -- (-586.945) (-587.634) (-588.956) [-586.403] * (-586.281) (-589.905) [-587.563] (-591.069) -- 0:00:25
576000 -- (-588.799) [-587.208] (-587.283) (-589.095) * (-588.809) [-588.991] (-587.693) (-587.151) -- 0:00:25
576500 -- (-589.721) [-588.866] (-587.661) (-587.785) * (-588.725) (-587.058) [-590.726] (-588.946) -- 0:00:25
577000 -- (-589.143) (-590.900) [-586.558] (-586.552) * (-587.631) (-588.254) [-588.716] (-587.060) -- 0:00:25
577500 -- (-586.702) [-588.807] (-588.544) (-587.420) * [-588.622] (-588.483) (-587.654) (-588.022) -- 0:00:25
578000 -- (-588.299) (-589.512) (-588.120) [-588.506] * [-586.842] (-588.058) (-589.051) (-591.798) -- 0:00:25
578500 -- (-588.231) (-588.714) (-592.281) [-589.016] * (-590.189) (-587.437) (-586.558) [-589.507] -- 0:00:25
579000 -- (-594.717) [-586.923] (-587.913) (-586.282) * (-590.112) (-590.222) [-587.275] (-589.019) -- 0:00:25
579500 -- (-587.348) (-586.866) [-587.302] (-587.643) * (-589.460) (-588.390) (-590.017) [-586.611] -- 0:00:25
580000 -- (-587.942) [-589.431] (-592.064) (-587.341) * [-588.230] (-588.757) (-588.058) (-586.420) -- 0:00:25
Average standard deviation of split frequencies: 0.010987
580500 -- (-589.340) (-587.591) (-588.993) [-587.438] * (-586.594) (-590.110) [-587.336] (-592.050) -- 0:00:25
581000 -- (-587.808) [-591.792] (-588.385) (-590.012) * (-587.647) [-588.853] (-588.661) (-586.839) -- 0:00:25
581500 -- [-588.839] (-593.147) (-587.838) (-596.226) * (-587.381) (-590.484) (-587.554) [-588.770] -- 0:00:25
582000 -- (-587.089) (-587.015) [-590.936] (-590.156) * (-588.131) (-586.856) [-586.615] (-589.157) -- 0:00:25
582500 -- [-587.437] (-589.184) (-589.726) (-589.522) * (-588.293) (-588.019) [-586.879] (-587.852) -- 0:00:25
583000 -- [-589.549] (-588.360) (-589.796) (-588.797) * (-588.860) (-586.339) [-587.024] (-591.512) -- 0:00:25
583500 -- (-589.855) [-588.119] (-587.398) (-586.154) * (-587.697) (-586.710) (-586.244) [-590.151] -- 0:00:24
584000 -- [-591.159] (-587.859) (-587.509) (-588.389) * [-587.293] (-586.842) (-587.538) (-587.132) -- 0:00:24
584500 -- (-588.794) (-586.819) [-587.642] (-587.438) * [-587.104] (-587.478) (-586.583) (-586.598) -- 0:00:24
585000 -- (-588.222) [-589.439] (-589.258) (-587.247) * (-587.899) (-586.744) (-588.865) [-587.332] -- 0:00:24
Average standard deviation of split frequencies: 0.011316
585500 -- (-589.209) (-587.002) (-589.320) [-587.512] * (-587.863) (-590.628) [-586.881] (-588.274) -- 0:00:24
586000 -- (-587.568) (-587.338) [-590.175] (-587.044) * (-588.930) (-590.157) [-586.458] (-589.031) -- 0:00:24
586500 -- (-589.399) [-587.820] (-590.181) (-588.817) * (-588.198) (-587.505) [-586.871] (-588.755) -- 0:00:24
587000 -- [-589.425] (-586.879) (-592.917) (-588.414) * (-589.121) [-586.910] (-588.376) (-590.287) -- 0:00:24
587500 -- (-588.356) (-590.118) (-589.240) [-587.379] * (-589.404) (-587.928) [-588.282] (-586.839) -- 0:00:25
588000 -- (-588.071) (-590.818) (-588.914) [-588.509] * [-589.885] (-590.016) (-589.292) (-587.871) -- 0:00:25
588500 -- (-589.686) (-590.677) [-588.557] (-587.478) * (-597.887) (-589.476) (-587.722) [-588.031] -- 0:00:25
589000 -- (-590.057) (-590.415) (-590.402) [-587.580] * [-590.613] (-588.518) (-587.731) (-586.880) -- 0:00:25
589500 -- [-588.917] (-588.092) (-591.534) (-588.785) * (-589.519) (-592.630) (-588.470) [-588.199] -- 0:00:25
590000 -- (-587.346) [-586.328] (-590.384) (-587.798) * (-586.646) (-588.328) (-593.237) [-588.587] -- 0:00:25
Average standard deviation of split frequencies: 0.011652
590500 -- (-586.615) [-588.550] (-588.780) (-587.961) * (-587.592) [-586.607] (-586.992) (-588.245) -- 0:00:24
591000 -- [-587.292] (-589.397) (-588.236) (-589.205) * [-588.373] (-587.155) (-587.534) (-589.079) -- 0:00:24
591500 -- (-587.494) [-587.104] (-593.767) (-590.447) * (-590.301) (-588.091) (-590.147) [-587.452] -- 0:00:24
592000 -- [-588.467] (-591.326) (-590.121) (-590.138) * (-589.007) (-588.247) [-586.090] (-588.054) -- 0:00:24
592500 -- (-589.220) [-588.276] (-588.700) (-588.061) * (-589.040) (-587.786) (-586.145) [-587.533] -- 0:00:24
593000 -- [-587.100] (-590.179) (-588.828) (-587.972) * (-589.198) (-589.707) (-590.553) [-587.842] -- 0:00:24
593500 -- (-588.717) [-587.718] (-592.084) (-587.474) * (-588.983) (-589.614) (-586.679) [-587.911] -- 0:00:24
594000 -- (-588.669) (-589.120) [-587.459] (-589.083) * (-592.422) [-588.170] (-586.864) (-589.390) -- 0:00:24
594500 -- (-586.511) (-589.847) (-589.205) [-587.030] * (-588.985) (-589.473) [-587.661] (-588.180) -- 0:00:24
595000 -- (-587.559) (-588.735) (-591.815) [-586.392] * [-587.841] (-587.749) (-587.546) (-590.031) -- 0:00:24
Average standard deviation of split frequencies: 0.011284
595500 -- [-586.588] (-588.238) (-588.062) (-588.518) * (-590.146) (-587.645) (-588.253) [-589.349] -- 0:00:24
596000 -- (-587.046) [-589.157] (-588.357) (-588.675) * (-589.371) [-587.436] (-587.245) (-590.479) -- 0:00:24
596500 -- (-588.372) (-589.064) [-587.635] (-592.186) * (-588.497) [-586.317] (-594.499) (-592.062) -- 0:00:24
597000 -- (-590.026) (-586.860) (-592.271) [-587.819] * (-586.878) [-588.964] (-596.659) (-591.604) -- 0:00:24
597500 -- (-588.357) (-591.090) (-589.664) [-588.383] * (-589.313) [-587.080] (-586.443) (-588.188) -- 0:00:24
598000 -- (-589.324) (-592.022) [-588.978] (-591.076) * (-586.782) (-587.467) [-587.455] (-588.026) -- 0:00:24
598500 -- (-591.341) [-589.455] (-589.551) (-593.547) * (-590.761) (-587.811) [-587.858] (-590.020) -- 0:00:24
599000 -- [-588.162] (-589.986) (-588.453) (-591.342) * (-587.461) (-588.945) (-591.281) [-588.808] -- 0:00:24
599500 -- (-590.346) (-588.744) (-588.293) [-590.604] * [-588.009] (-587.100) (-589.228) (-587.601) -- 0:00:24
600000 -- [-588.528] (-587.987) (-591.128) (-588.522) * (-587.650) (-588.752) (-589.249) [-588.918] -- 0:00:24
Average standard deviation of split frequencies: 0.011510
600500 -- [-587.076] (-590.337) (-586.843) (-592.757) * (-589.208) [-589.197] (-586.846) (-587.188) -- 0:00:23
601000 -- [-586.919] (-589.157) (-586.745) (-592.089) * (-587.806) (-588.997) (-586.467) [-591.429] -- 0:00:23
601500 -- (-587.218) [-591.417] (-589.399) (-587.342) * (-588.758) (-588.442) [-587.035] (-591.528) -- 0:00:23
602000 -- (-588.140) (-588.809) (-591.063) [-591.310] * (-588.740) (-586.669) [-588.413] (-589.992) -- 0:00:23
602500 -- (-587.549) (-591.552) (-588.372) [-588.621] * (-588.676) (-588.190) [-589.755] (-590.678) -- 0:00:23
603000 -- (-587.439) (-588.201) [-591.829] (-591.407) * (-589.441) (-590.272) [-587.799] (-587.329) -- 0:00:23
603500 -- [-590.605] (-593.498) (-586.641) (-588.216) * (-589.904) (-587.368) [-586.262] (-589.699) -- 0:00:24
604000 -- (-587.035) [-588.886] (-588.986) (-587.920) * (-590.840) [-588.119] (-589.371) (-591.303) -- 0:00:24
604500 -- (-589.901) [-587.351] (-589.041) (-588.634) * (-587.499) (-587.997) (-588.066) [-590.906] -- 0:00:24
605000 -- (-588.887) (-587.190) [-588.491] (-590.603) * (-587.490) (-589.877) (-587.698) [-591.130] -- 0:00:24
Average standard deviation of split frequencies: 0.011305
605500 -- [-587.183] (-589.657) (-590.727) (-590.777) * [-586.269] (-589.085) (-589.420) (-587.847) -- 0:00:24
606000 -- (-587.096) [-590.021] (-591.196) (-588.320) * (-586.411) (-587.921) (-586.856) [-589.263] -- 0:00:24
606500 -- (-589.602) (-588.364) (-588.255) [-586.500] * (-594.026) (-589.069) [-589.681] (-589.522) -- 0:00:24
607000 -- (-586.935) (-589.928) (-589.454) [-587.411] * [-586.733] (-588.892) (-591.305) (-586.997) -- 0:00:23
607500 -- [-588.928] (-589.230) (-596.720) (-588.272) * [-589.367] (-589.360) (-589.359) (-589.017) -- 0:00:23
608000 -- (-594.331) [-589.800] (-593.152) (-594.295) * (-587.177) [-587.409] (-593.851) (-591.285) -- 0:00:23
608500 -- [-591.298] (-587.355) (-589.636) (-590.208) * (-587.069) (-588.074) [-589.022] (-588.876) -- 0:00:23
609000 -- (-591.111) (-587.924) [-589.031] (-588.344) * (-588.256) (-588.402) (-590.138) [-587.002] -- 0:00:23
609500 -- (-588.949) [-587.246] (-591.320) (-591.037) * (-588.042) (-589.402) (-588.855) [-588.030] -- 0:00:23
610000 -- (-589.080) (-588.239) [-589.964] (-591.169) * (-590.497) (-589.150) [-590.422] (-590.257) -- 0:00:23
Average standard deviation of split frequencies: 0.010859
610500 -- [-588.366] (-588.435) (-588.000) (-588.071) * (-589.220) (-588.850) (-590.175) [-589.883] -- 0:00:23
611000 -- [-589.257] (-587.672) (-587.494) (-587.634) * (-588.887) [-587.365] (-589.591) (-590.930) -- 0:00:23
611500 -- [-589.167] (-589.125) (-591.108) (-591.260) * (-588.828) (-587.903) (-587.736) [-587.790] -- 0:00:23
612000 -- [-587.466] (-589.392) (-586.957) (-591.467) * [-586.874] (-589.626) (-589.463) (-589.658) -- 0:00:23
612500 -- (-589.591) (-588.610) (-588.585) [-588.846] * (-589.756) (-588.386) (-587.171) [-590.535] -- 0:00:23
613000 -- (-592.328) (-590.030) (-587.124) [-588.056] * (-589.211) [-587.226] (-588.987) (-587.342) -- 0:00:23
613500 -- (-588.630) (-587.581) [-588.307] (-588.595) * (-587.431) (-586.379) [-588.139] (-588.004) -- 0:00:23
614000 -- [-587.155] (-588.835) (-587.201) (-591.791) * (-589.079) [-586.299] (-586.710) (-591.664) -- 0:00:23
614500 -- [-587.296] (-593.438) (-588.486) (-588.530) * [-588.715] (-588.260) (-588.700) (-592.152) -- 0:00:23
615000 -- (-587.486) (-589.011) [-592.217] (-590.896) * [-587.528] (-596.119) (-601.671) (-594.294) -- 0:00:23
Average standard deviation of split frequencies: 0.010969
615500 -- (-587.573) [-587.627] (-588.295) (-590.882) * (-586.653) (-594.114) [-590.417] (-588.772) -- 0:00:23
616000 -- [-588.097] (-586.903) (-591.469) (-593.473) * (-589.077) (-592.874) (-587.883) [-589.598] -- 0:00:23
616500 -- [-587.328] (-592.252) (-589.542) (-589.576) * [-589.974] (-589.395) (-588.314) (-592.393) -- 0:00:23
617000 -- [-588.916] (-590.475) (-587.004) (-588.926) * (-587.762) [-589.508] (-587.903) (-588.500) -- 0:00:22
617500 -- (-588.637) [-590.061] (-588.312) (-587.579) * [-588.348] (-589.888) (-587.758) (-587.598) -- 0:00:22
618000 -- (-592.909) [-587.702] (-588.512) (-589.319) * [-587.167] (-590.637) (-586.887) (-593.838) -- 0:00:22
618500 -- [-587.581] (-589.221) (-588.773) (-588.212) * (-588.463) (-590.458) (-587.654) [-592.605] -- 0:00:22
619000 -- (-587.759) (-587.484) [-592.220] (-586.439) * [-589.922] (-587.600) (-590.770) (-594.339) -- 0:00:22
619500 -- [-587.791] (-587.612) (-587.232) (-589.435) * (-589.199) [-587.464] (-590.321) (-594.333) -- 0:00:22
620000 -- [-586.881] (-588.403) (-589.689) (-591.335) * (-586.758) (-588.623) [-589.968] (-592.246) -- 0:00:22
Average standard deviation of split frequencies: 0.010380
620500 -- (-587.372) [-587.856] (-587.163) (-589.454) * (-587.678) [-588.576] (-588.504) (-589.907) -- 0:00:23
621000 -- (-587.699) (-587.802) (-589.302) [-587.470] * (-586.507) (-589.203) (-586.602) [-588.120] -- 0:00:23
621500 -- (-593.048) (-591.656) [-587.141] (-587.505) * (-587.395) [-588.836] (-587.742) (-589.657) -- 0:00:23
622000 -- (-592.807) (-588.307) (-586.901) [-589.662] * [-588.461] (-590.177) (-588.710) (-586.890) -- 0:00:23
622500 -- (-586.761) [-586.917] (-588.719) (-588.209) * (-586.830) (-586.729) [-589.565] (-590.503) -- 0:00:23
623000 -- (-586.738) (-588.964) (-588.714) [-586.427] * [-586.634] (-588.716) (-590.167) (-589.375) -- 0:00:22
623500 -- [-589.305] (-586.965) (-592.242) (-587.218) * [-587.634] (-586.683) (-589.151) (-587.184) -- 0:00:22
624000 -- (-587.921) [-588.596] (-588.604) (-586.520) * (-592.697) (-586.461) (-586.863) [-587.532] -- 0:00:22
624500 -- (-587.075) (-588.212) [-590.647] (-586.147) * (-587.447) [-589.336] (-587.559) (-588.449) -- 0:00:22
625000 -- (-589.483) [-587.326] (-588.856) (-590.950) * [-587.966] (-591.502) (-587.249) (-591.616) -- 0:00:22
Average standard deviation of split frequencies: 0.010041
625500 -- (-590.240) (-587.156) [-588.522] (-588.809) * [-587.523] (-588.841) (-587.257) (-587.572) -- 0:00:22
626000 -- (-586.810) [-588.164] (-587.104) (-592.407) * [-588.919] (-591.160) (-588.016) (-590.104) -- 0:00:22
626500 -- (-586.923) [-587.684] (-586.877) (-591.449) * (-591.661) (-587.208) [-586.913] (-590.476) -- 0:00:22
627000 -- (-586.847) (-590.840) (-586.668) [-587.027] * (-587.180) [-587.521] (-589.099) (-589.020) -- 0:00:22
627500 -- (-590.347) (-590.109) [-589.081] (-588.068) * (-590.095) [-587.332] (-589.539) (-589.019) -- 0:00:22
628000 -- [-589.188] (-587.610) (-589.696) (-592.534) * [-589.068] (-587.526) (-587.025) (-591.131) -- 0:00:22
628500 -- (-586.922) (-588.058) [-588.016] (-590.909) * (-589.417) [-587.066] (-587.934) (-593.302) -- 0:00:22
629000 -- (-589.604) [-587.809] (-587.578) (-587.936) * [-587.546] (-587.958) (-586.968) (-587.860) -- 0:00:22
629500 -- (-587.700) [-586.664] (-589.850) (-590.365) * (-588.693) [-587.819] (-592.647) (-586.242) -- 0:00:22
630000 -- (-588.007) (-588.810) [-587.839] (-588.383) * (-587.564) (-588.241) (-589.343) [-589.376] -- 0:00:22
Average standard deviation of split frequencies: 0.010016
630500 -- (-588.381) (-588.973) [-589.049] (-590.585) * [-589.439] (-588.360) (-586.759) (-592.201) -- 0:00:22
631000 -- (-588.279) (-587.865) (-586.596) [-588.114] * (-589.206) (-586.956) (-587.608) [-588.785] -- 0:00:22
631500 -- (-588.229) (-587.157) [-590.077] (-589.662) * (-588.014) [-587.196] (-589.521) (-593.650) -- 0:00:22
632000 -- (-589.752) (-588.095) [-590.001] (-588.855) * (-586.838) (-588.736) [-586.320] (-588.483) -- 0:00:22
632500 -- (-589.565) (-586.793) (-588.465) [-587.594] * [-586.726] (-587.862) (-588.600) (-588.695) -- 0:00:22
633000 -- (-589.395) [-586.965] (-586.911) (-590.490) * (-588.890) (-587.979) (-590.626) [-586.916] -- 0:00:22
633500 -- (-593.446) (-587.667) (-591.013) [-587.850] * (-595.362) [-590.496] (-590.495) (-591.147) -- 0:00:21
634000 -- (-588.459) (-587.098) [-586.311] (-592.359) * [-589.821] (-589.718) (-587.114) (-591.240) -- 0:00:21
634500 -- (-588.515) [-587.061] (-586.379) (-590.275) * (-589.062) (-588.741) [-589.342] (-588.150) -- 0:00:21
635000 -- (-588.853) (-588.624) (-586.356) [-590.411] * (-591.046) (-589.765) (-590.112) [-591.587] -- 0:00:21
Average standard deviation of split frequencies: 0.010229
635500 -- (-590.028) (-599.955) [-588.574] (-588.771) * (-590.239) (-588.635) [-588.908] (-588.249) -- 0:00:21
636000 -- (-587.989) [-589.681] (-592.623) (-591.785) * [-588.906] (-590.148) (-590.985) (-589.514) -- 0:00:21
636500 -- (-588.877) [-588.537] (-592.088) (-588.263) * (-588.674) (-587.256) (-591.209) [-587.959] -- 0:00:22
637000 -- (-588.785) [-590.094] (-590.827) (-588.553) * (-586.932) (-586.542) [-586.903] (-587.899) -- 0:00:22
637500 -- (-589.806) [-588.207] (-587.534) (-588.488) * (-587.812) (-590.471) [-587.984] (-590.278) -- 0:00:22
638000 -- (-587.193) [-586.799] (-587.554) (-587.926) * (-588.459) [-590.969] (-588.726) (-589.457) -- 0:00:22
638500 -- (-589.883) [-586.420] (-588.596) (-589.437) * (-587.550) (-597.231) (-587.662) [-588.115] -- 0:00:22
639000 -- (-588.681) [-587.823] (-586.901) (-589.211) * (-589.806) [-592.223] (-587.357) (-588.089) -- 0:00:22
639500 -- (-588.330) (-588.996) [-586.902] (-587.764) * (-587.332) [-587.342] (-587.220) (-589.741) -- 0:00:21
640000 -- [-586.919] (-586.685) (-588.966) (-589.085) * [-588.133] (-586.620) (-589.993) (-590.575) -- 0:00:21
Average standard deviation of split frequencies: 0.009860
640500 -- (-587.396) [-586.727] (-591.475) (-587.239) * [-588.174] (-586.788) (-589.940) (-587.288) -- 0:00:21
641000 -- [-586.736] (-588.490) (-590.018) (-589.363) * [-587.631] (-586.788) (-589.028) (-590.318) -- 0:00:21
641500 -- (-590.749) (-592.613) [-588.039] (-589.774) * (-587.338) (-586.605) [-586.555] (-590.641) -- 0:00:21
642000 -- (-591.573) (-594.866) [-586.890] (-589.905) * (-591.404) (-592.283) [-587.836] (-587.085) -- 0:00:21
642500 -- [-588.685] (-590.537) (-588.618) (-591.079) * (-587.705) (-587.765) [-586.800] (-588.128) -- 0:00:21
643000 -- (-588.549) [-587.600] (-589.216) (-586.909) * (-588.160) [-590.075] (-588.504) (-588.758) -- 0:00:21
643500 -- (-589.843) [-586.951] (-587.527) (-588.435) * (-588.609) [-588.239] (-588.064) (-586.763) -- 0:00:21
644000 -- (-588.210) (-586.824) [-591.036] (-592.321) * (-587.186) (-588.371) (-586.858) [-586.755] -- 0:00:21
644500 -- (-587.742) (-588.251) (-588.758) [-587.901] * (-586.655) [-588.891] (-588.285) (-587.394) -- 0:00:21
645000 -- (-587.554) (-586.884) (-590.240) [-587.842] * (-588.653) (-593.034) (-588.199) [-587.933] -- 0:00:21
Average standard deviation of split frequencies: 0.010557
645500 -- (-587.711) (-591.847) (-590.037) [-587.491] * (-586.498) (-590.324) (-594.166) [-587.435] -- 0:00:21
646000 -- (-588.418) (-590.388) (-587.717) [-587.780] * [-589.219] (-593.059) (-590.154) (-587.020) -- 0:00:21
646500 -- (-591.704) (-594.022) (-587.905) [-587.642] * [-589.853] (-591.678) (-590.155) (-588.534) -- 0:00:21
647000 -- (-591.493) (-588.218) (-586.922) [-591.963] * (-587.332) (-589.722) (-590.789) [-588.560] -- 0:00:21
647500 -- (-591.724) (-589.138) [-586.439] (-586.156) * (-589.453) (-592.843) (-591.277) [-586.414] -- 0:00:21
648000 -- (-590.997) [-592.071] (-586.546) (-588.025) * (-593.228) (-590.947) (-588.961) [-586.805] -- 0:00:21
648500 -- (-586.887) [-592.066] (-589.473) (-587.795) * (-588.620) [-588.860] (-588.175) (-586.923) -- 0:00:21
649000 -- [-591.082] (-588.732) (-587.934) (-589.080) * [-586.566] (-588.551) (-588.659) (-587.850) -- 0:00:21
649500 -- [-587.853] (-586.821) (-586.846) (-587.925) * (-589.331) (-587.706) (-590.508) [-586.613] -- 0:00:21
650000 -- [-588.038] (-588.603) (-587.949) (-587.297) * [-586.599] (-588.706) (-593.929) (-588.910) -- 0:00:21
Average standard deviation of split frequencies: 0.010481
650500 -- (-590.327) [-586.682] (-590.271) (-589.391) * (-587.308) [-590.129] (-588.653) (-591.236) -- 0:00:20
651000 -- (-589.707) [-587.134] (-586.694) (-586.748) * (-592.594) (-591.102) [-589.916] (-589.245) -- 0:00:20
651500 -- (-587.935) [-586.800] (-586.565) (-586.209) * (-587.767) (-589.738) (-589.137) [-589.012] -- 0:00:20
652000 -- (-587.465) [-587.936] (-591.773) (-591.745) * [-588.822] (-588.311) (-587.270) (-591.463) -- 0:00:20
652500 -- (-588.339) (-587.746) [-587.723] (-591.041) * (-590.534) [-588.202] (-587.146) (-589.464) -- 0:00:20
653000 -- (-588.528) (-588.353) [-588.334] (-588.618) * (-589.997) (-588.139) [-591.060] (-586.984) -- 0:00:20
653500 -- [-591.342] (-588.104) (-590.390) (-593.281) * (-591.442) (-594.579) (-589.847) [-587.070] -- 0:00:21
654000 -- [-587.019] (-588.665) (-590.083) (-589.599) * (-591.816) (-588.987) (-590.335) [-593.652] -- 0:00:21
654500 -- (-589.387) (-587.009) (-591.040) [-591.378] * [-589.694] (-590.744) (-587.955) (-592.142) -- 0:00:21
655000 -- (-590.702) (-594.980) [-587.335] (-587.984) * [-586.823] (-587.768) (-589.618) (-587.951) -- 0:00:21
Average standard deviation of split frequencies: 0.010300
655500 -- [-588.405] (-588.175) (-591.679) (-588.017) * [-587.327] (-587.021) (-588.364) (-586.358) -- 0:00:21
656000 -- (-587.639) (-588.695) [-590.535] (-589.165) * (-588.616) [-588.029] (-588.142) (-590.149) -- 0:00:20
656500 -- [-587.690] (-588.172) (-587.240) (-588.354) * [-586.363] (-588.037) (-590.532) (-587.986) -- 0:00:20
657000 -- [-587.082] (-586.614) (-587.535) (-591.888) * [-588.875] (-589.047) (-588.393) (-590.449) -- 0:00:20
657500 -- [-588.472] (-587.770) (-590.829) (-590.742) * [-588.390] (-588.098) (-588.611) (-590.444) -- 0:00:20
658000 -- [-587.199] (-588.014) (-591.674) (-587.251) * (-594.944) (-586.645) [-587.066] (-589.479) -- 0:00:20
658500 -- (-587.574) [-588.057] (-588.897) (-587.324) * (-589.766) (-587.001) [-587.362] (-586.984) -- 0:00:20
659000 -- (-589.116) (-587.862) [-590.414] (-587.905) * [-590.804] (-595.144) (-587.557) (-592.186) -- 0:00:20
659500 -- (-592.921) (-588.434) [-589.183] (-591.137) * (-588.988) (-589.210) (-588.184) [-587.438] -- 0:00:20
660000 -- (-587.220) (-586.901) (-591.362) [-591.569] * (-586.896) [-588.818] (-587.159) (-587.971) -- 0:00:20
Average standard deviation of split frequencies: 0.010418
660500 -- (-589.565) (-588.602) [-586.822] (-593.287) * (-591.119) (-586.674) [-588.530] (-589.564) -- 0:00:20
661000 -- (-588.571) (-594.206) [-587.867] (-590.271) * (-592.013) [-587.229] (-589.051) (-588.713) -- 0:00:20
661500 -- (-589.005) (-591.854) [-589.589] (-587.043) * (-587.339) [-588.723] (-589.849) (-587.863) -- 0:00:20
662000 -- (-589.868) [-588.197] (-591.499) (-589.188) * (-587.742) (-590.536) (-589.379) [-587.456] -- 0:00:20
662500 -- (-588.675) (-589.407) (-587.086) [-588.367] * (-586.784) [-588.386] (-591.726) (-592.607) -- 0:00:20
663000 -- (-594.382) [-586.871] (-587.706) (-588.312) * (-589.382) [-590.067] (-588.975) (-590.376) -- 0:00:20
663500 -- (-586.473) (-588.820) [-587.855] (-587.649) * (-587.369) [-592.033] (-587.902) (-586.973) -- 0:00:20
664000 -- (-586.331) (-592.864) (-588.256) [-587.149] * (-590.210) (-588.843) [-587.004] (-588.152) -- 0:00:20
664500 -- (-589.184) (-587.901) [-588.775] (-587.739) * (-586.807) [-588.141] (-590.830) (-591.879) -- 0:00:20
665000 -- [-587.911] (-587.413) (-590.365) (-589.150) * (-590.759) (-589.325) [-589.153] (-591.125) -- 0:00:20
Average standard deviation of split frequencies: 0.010806
665500 -- (-590.742) (-592.992) [-590.077] (-587.639) * (-588.424) (-588.755) (-588.931) [-587.089] -- 0:00:20
666000 -- (-589.609) (-588.338) [-588.397] (-587.716) * (-590.716) (-588.910) (-589.661) [-588.060] -- 0:00:20
666500 -- (-589.383) (-591.219) [-589.304] (-589.694) * [-588.324] (-588.210) (-590.198) (-589.661) -- 0:00:20
667000 -- (-588.298) (-590.549) (-592.117) [-589.892] * (-591.100) (-588.348) (-587.441) [-587.557] -- 0:00:19
667500 -- (-590.153) (-593.443) [-589.675] (-587.750) * (-590.411) (-590.350) (-586.838) [-587.100] -- 0:00:19
668000 -- (-590.683) (-588.590) (-588.501) [-586.848] * [-588.497] (-594.370) (-592.574) (-588.011) -- 0:00:19
668500 -- (-588.941) (-590.521) [-587.314] (-588.843) * (-586.916) [-586.575] (-589.184) (-588.526) -- 0:00:19
669000 -- [-588.777] (-589.623) (-589.027) (-586.986) * (-589.172) (-591.630) (-588.585) [-588.208] -- 0:00:19
669500 -- (-588.210) (-588.354) [-588.346] (-587.960) * (-590.699) (-592.522) (-588.511) [-588.975] -- 0:00:19
670000 -- (-590.012) (-586.766) [-588.081] (-587.730) * [-586.580] (-589.159) (-588.719) (-591.052) -- 0:00:19
Average standard deviation of split frequencies: 0.010450
670500 -- (-587.575) (-587.264) [-588.249] (-588.664) * (-587.473) (-587.115) (-591.013) [-588.564] -- 0:00:20
671000 -- (-589.840) (-587.905) (-588.695) [-589.201] * [-588.687] (-589.488) (-589.568) (-588.206) -- 0:00:20
671500 -- (-588.155) (-586.589) [-586.896] (-590.646) * [-590.393] (-586.430) (-589.422) (-589.511) -- 0:00:20
672000 -- (-588.452) (-586.235) [-589.304] (-589.682) * (-598.177) [-587.317] (-587.060) (-587.287) -- 0:00:20
672500 -- (-588.802) (-589.152) (-587.614) [-586.732] * (-588.853) [-587.315] (-588.527) (-587.972) -- 0:00:19
673000 -- (-587.405) [-586.952] (-589.377) (-587.262) * (-589.235) (-587.534) [-587.915] (-586.812) -- 0:00:19
673500 -- (-589.837) (-588.380) [-592.765] (-588.804) * (-593.074) [-590.438] (-590.661) (-586.459) -- 0:00:19
674000 -- (-592.286) (-589.843) (-590.338) [-589.480] * [-590.044] (-596.726) (-589.400) (-590.310) -- 0:00:19
674500 -- (-589.286) (-590.776) [-588.704] (-591.993) * (-586.563) (-587.551) (-590.069) [-589.130] -- 0:00:19
675000 -- [-590.681] (-588.066) (-590.311) (-594.072) * [-587.690] (-587.144) (-589.838) (-589.700) -- 0:00:19
Average standard deviation of split frequencies: 0.010274
675500 -- [-588.459] (-589.581) (-591.251) (-590.558) * [-589.510] (-588.787) (-588.373) (-590.392) -- 0:00:19
676000 -- (-589.113) [-587.307] (-588.138) (-588.219) * (-587.585) (-588.795) (-586.463) [-591.457] -- 0:00:19
676500 -- (-593.133) (-597.665) (-590.141) [-588.484] * [-588.902] (-587.177) (-592.161) (-588.167) -- 0:00:19
677000 -- (-590.050) (-592.716) (-588.026) [-588.091] * (-592.928) (-589.536) [-589.706] (-589.379) -- 0:00:19
677500 -- (-588.828) (-588.310) [-587.760] (-587.532) * (-588.781) (-589.757) [-589.896] (-587.667) -- 0:00:19
678000 -- (-591.434) [-587.202] (-592.508) (-589.354) * (-590.401) [-587.153] (-591.710) (-588.605) -- 0:00:19
678500 -- (-588.213) (-587.538) [-589.207] (-593.508) * (-588.572) [-587.502] (-596.620) (-588.981) -- 0:00:19
679000 -- (-589.078) [-588.245] (-587.315) (-591.855) * (-586.801) (-590.541) [-590.575] (-587.030) -- 0:00:19
679500 -- (-589.597) [-587.771] (-587.355) (-591.708) * (-586.347) [-589.209] (-589.265) (-588.709) -- 0:00:19
680000 -- (-587.539) (-588.212) [-588.415] (-590.454) * (-586.384) (-589.976) [-586.670] (-589.495) -- 0:00:19
Average standard deviation of split frequencies: 0.009742
680500 -- (-587.333) [-588.638] (-589.676) (-587.509) * [-589.230] (-588.066) (-587.955) (-589.653) -- 0:00:19
681000 -- (-586.645) [-590.405] (-588.488) (-587.150) * (-591.173) [-591.248] (-586.953) (-588.633) -- 0:00:19
681500 -- (-587.411) [-586.353] (-588.257) (-590.280) * (-589.599) (-589.288) [-588.901] (-589.994) -- 0:00:19
682000 -- (-586.822) [-588.647] (-589.681) (-588.061) * (-586.911) (-587.085) (-589.389) [-588.119] -- 0:00:19
682500 -- (-586.995) [-588.930] (-587.257) (-586.693) * (-588.058) (-588.413) [-588.902] (-590.542) -- 0:00:19
683000 -- (-590.601) [-592.173] (-586.936) (-587.696) * (-586.872) (-587.733) [-588.399] (-592.207) -- 0:00:19
683500 -- (-592.028) [-589.698] (-591.140) (-587.965) * [-586.770] (-588.416) (-589.718) (-595.066) -- 0:00:18
684000 -- (-588.950) (-588.654) (-590.267) [-586.360] * (-587.193) [-588.162] (-586.888) (-595.029) -- 0:00:18
684500 -- (-586.996) (-587.580) [-590.214] (-588.441) * (-588.210) (-588.609) [-592.566] (-589.873) -- 0:00:18
685000 -- (-587.164) (-596.631) [-588.117] (-588.991) * (-592.318) (-587.025) (-589.944) [-586.730] -- 0:00:18
Average standard deviation of split frequencies: 0.009346
685500 -- [-588.922] (-589.759) (-589.422) (-591.057) * (-589.528) [-592.112] (-588.448) (-589.085) -- 0:00:18
686000 -- (-588.610) (-588.998) [-587.719] (-590.511) * (-590.526) [-589.782] (-590.177) (-593.243) -- 0:00:18
686500 -- (-589.050) (-589.011) [-588.833] (-589.006) * (-590.879) (-587.248) [-588.419] (-588.130) -- 0:00:18
687000 -- (-587.405) (-592.112) [-586.630] (-586.555) * (-589.372) [-587.449] (-587.431) (-587.989) -- 0:00:18
687500 -- (-589.074) [-592.809] (-592.447) (-586.595) * (-587.895) (-587.467) (-589.217) [-587.016] -- 0:00:19
688000 -- (-588.914) (-587.842) [-589.445] (-588.688) * (-590.109) (-592.149) [-590.898] (-586.255) -- 0:00:19
688500 -- (-586.571) [-589.767] (-589.460) (-589.311) * (-588.578) (-589.096) (-590.229) [-586.973] -- 0:00:19
689000 -- (-588.001) [-590.655] (-588.252) (-587.566) * (-588.613) (-589.053) (-588.322) [-587.374] -- 0:00:18
689500 -- [-586.840] (-590.977) (-586.879) (-589.812) * (-587.157) (-587.628) [-589.936] (-588.489) -- 0:00:18
690000 -- (-588.512) (-590.583) [-589.646] (-588.529) * (-586.640) (-588.409) [-586.698] (-586.797) -- 0:00:18
Average standard deviation of split frequencies: 0.009146
690500 -- (-590.766) (-592.002) (-588.564) [-588.825] * (-589.620) (-591.520) (-588.599) [-586.314] -- 0:00:18
691000 -- (-588.834) (-590.324) (-590.897) [-588.178] * (-587.403) (-592.862) (-593.357) [-592.118] -- 0:00:18
691500 -- (-590.814) (-589.838) [-592.407] (-589.558) * [-588.732] (-592.073) (-586.257) (-589.365) -- 0:00:18
692000 -- (-590.123) (-588.582) [-589.031] (-589.393) * (-590.761) [-587.999] (-588.017) (-587.100) -- 0:00:18
692500 -- (-595.414) [-589.185] (-589.824) (-588.204) * (-587.177) (-589.219) [-590.221] (-587.172) -- 0:00:18
693000 -- (-588.746) (-588.889) (-589.823) [-589.787] * (-589.392) (-592.385) (-588.159) [-587.866] -- 0:00:18
693500 -- [-588.737] (-590.998) (-588.056) (-587.388) * (-591.866) (-587.730) (-586.297) [-589.126] -- 0:00:18
694000 -- (-588.759) [-586.260] (-586.383) (-588.689) * (-587.318) [-587.553] (-590.027) (-591.302) -- 0:00:18
694500 -- [-589.208] (-589.207) (-586.947) (-587.761) * [-587.834] (-597.932) (-588.269) (-586.960) -- 0:00:18
695000 -- [-588.450] (-589.466) (-587.762) (-591.647) * (-588.114) (-587.664) (-586.770) [-587.199] -- 0:00:18
Average standard deviation of split frequencies: 0.008670
695500 -- (-588.035) (-591.395) [-587.755] (-587.535) * (-587.020) (-589.219) [-589.064] (-588.182) -- 0:00:18
696000 -- (-588.033) (-588.468) (-588.352) [-587.546] * (-588.648) [-588.114] (-587.238) (-590.289) -- 0:00:18
696500 -- (-587.228) (-589.151) [-588.461] (-587.222) * [-589.998] (-588.471) (-589.118) (-588.638) -- 0:00:18
697000 -- (-587.323) (-588.305) [-590.636] (-587.337) * [-589.413] (-587.025) (-587.975) (-586.926) -- 0:00:18
697500 -- (-590.148) [-588.664] (-592.415) (-586.990) * (-589.843) [-587.246] (-588.087) (-591.205) -- 0:00:18
698000 -- [-593.159] (-587.847) (-589.799) (-587.114) * (-590.834) (-590.808) (-588.015) [-586.468] -- 0:00:18
698500 -- (-588.237) [-587.084] (-590.363) (-593.493) * (-587.794) (-587.802) (-588.185) [-586.724] -- 0:00:18
699000 -- [-588.814] (-586.264) (-587.611) (-586.357) * (-586.709) (-589.469) (-589.643) [-588.839] -- 0:00:18
699500 -- (-591.089) (-587.342) (-589.449) [-588.674] * (-588.261) (-589.265) (-593.563) [-586.945] -- 0:00:18
700000 -- (-591.322) (-588.256) (-587.593) [-588.031] * (-591.941) (-587.658) (-588.903) [-586.627] -- 0:00:18
Average standard deviation of split frequencies: 0.008926
700500 -- [-592.516] (-588.606) (-588.053) (-587.710) * (-589.463) (-590.911) (-587.858) [-588.604] -- 0:00:17
701000 -- (-591.473) (-587.403) [-587.434] (-587.704) * (-589.287) [-588.947] (-587.491) (-588.259) -- 0:00:17
701500 -- (-589.769) (-589.648) [-588.262] (-592.638) * (-590.747) [-587.788] (-590.070) (-590.602) -- 0:00:17
702000 -- (-590.105) (-587.714) (-586.667) [-589.667] * [-588.025] (-586.428) (-587.137) (-587.308) -- 0:00:17
702500 -- [-588.605] (-586.245) (-587.046) (-588.735) * [-587.911] (-589.135) (-587.588) (-588.765) -- 0:00:17
703000 -- (-590.930) (-587.118) (-586.309) [-588.244] * (-588.936) (-591.639) (-587.745) [-588.821] -- 0:00:17
703500 -- (-592.206) (-587.814) [-589.561] (-587.508) * (-593.047) [-587.361] (-587.911) (-586.674) -- 0:00:17
704000 -- (-588.671) (-588.903) (-588.757) [-587.303] * (-589.285) [-589.453] (-587.616) (-588.424) -- 0:00:17
704500 -- (-591.064) [-588.300] (-587.903) (-588.755) * [-589.813] (-588.666) (-591.148) (-588.638) -- 0:00:18
705000 -- (-588.784) (-587.276) (-587.748) [-587.055] * (-592.252) (-586.808) [-586.755] (-590.058) -- 0:00:17
Average standard deviation of split frequencies: 0.008369
705500 -- (-588.804) [-587.538] (-590.028) (-586.864) * [-590.015] (-588.535) (-588.235) (-588.990) -- 0:00:17
706000 -- (-592.932) (-590.573) [-586.693] (-588.329) * (-591.349) [-592.794] (-591.316) (-588.106) -- 0:00:17
706500 -- (-587.887) [-588.550] (-588.813) (-587.018) * (-587.244) [-590.342] (-588.177) (-586.285) -- 0:00:17
707000 -- [-589.027] (-589.969) (-590.992) (-587.164) * [-587.245] (-588.360) (-589.580) (-586.567) -- 0:00:17
707500 -- (-590.424) (-589.350) [-588.575] (-590.387) * [-587.826] (-591.831) (-593.411) (-587.251) -- 0:00:17
708000 -- (-590.041) [-587.263] (-587.979) (-586.921) * [-588.245] (-588.298) (-588.014) (-587.454) -- 0:00:17
708500 -- (-591.503) [-588.594] (-588.432) (-592.379) * (-589.788) (-587.686) (-588.719) [-589.341] -- 0:00:17
709000 -- (-591.403) (-589.447) [-587.297] (-591.358) * (-590.755) (-588.682) (-590.098) [-588.117] -- 0:00:17
709500 -- [-587.309] (-592.595) (-587.746) (-588.056) * [-587.993] (-589.605) (-592.226) (-587.017) -- 0:00:17
710000 -- (-587.119) (-591.017) [-587.603] (-588.401) * (-589.761) [-587.311] (-588.065) (-590.399) -- 0:00:17
Average standard deviation of split frequencies: 0.008933
710500 -- (-588.157) [-588.392] (-587.443) (-594.591) * [-586.892] (-587.279) (-588.617) (-589.117) -- 0:00:17
711000 -- [-586.986] (-589.326) (-588.917) (-586.954) * [-586.918] (-590.624) (-587.336) (-587.434) -- 0:00:17
711500 -- (-586.678) (-590.186) (-586.500) [-587.089] * [-586.962] (-589.079) (-588.538) (-589.235) -- 0:00:17
712000 -- (-591.696) (-592.102) [-586.718] (-587.120) * (-588.278) (-588.655) [-587.212] (-589.600) -- 0:00:17
712500 -- (-587.203) [-587.771] (-591.780) (-588.056) * (-587.642) (-588.513) (-587.117) [-589.523] -- 0:00:17
713000 -- (-586.622) (-587.635) (-589.775) [-586.608] * (-592.416) (-587.865) [-589.225] (-589.338) -- 0:00:17
713500 -- (-588.797) [-587.927] (-596.423) (-587.492) * (-588.817) (-587.334) [-589.063] (-586.746) -- 0:00:17
714000 -- [-587.811] (-587.739) (-586.206) (-588.537) * (-589.405) (-588.526) (-591.663) [-588.764] -- 0:00:17
714500 -- (-589.389) (-587.738) (-588.855) [-588.663] * (-589.350) [-587.838] (-591.211) (-588.768) -- 0:00:17
715000 -- (-586.318) [-588.377] (-588.980) (-588.982) * [-587.216] (-588.322) (-588.206) (-587.612) -- 0:00:17
Average standard deviation of split frequencies: 0.009130
715500 -- [-587.175] (-586.897) (-588.420) (-587.885) * (-589.891) (-587.581) [-589.148] (-593.035) -- 0:00:17
716000 -- [-586.629] (-586.532) (-589.286) (-589.724) * (-591.203) (-587.178) (-587.839) [-590.695] -- 0:00:17
716500 -- (-588.288) (-588.833) (-587.205) [-589.363] * (-586.445) (-586.904) (-588.226) [-587.571] -- 0:00:17
717000 -- (-590.364) [-587.804] (-588.689) (-586.943) * (-586.534) [-587.355] (-593.427) (-587.647) -- 0:00:16
717500 -- [-588.216] (-587.834) (-587.872) (-586.250) * (-587.127) (-587.163) [-590.991] (-589.561) -- 0:00:16
718000 -- (-587.796) [-590.805] (-592.528) (-587.942) * (-589.102) (-589.528) (-591.306) [-587.562] -- 0:00:16
718500 -- (-587.374) (-588.070) (-589.920) [-588.951] * (-588.148) (-589.126) [-590.064] (-588.652) -- 0:00:16
719000 -- (-587.682) (-587.550) [-586.973] (-588.843) * (-589.673) (-587.237) [-587.603] (-594.263) -- 0:00:16
719500 -- [-588.918] (-588.559) (-589.312) (-591.099) * (-591.617) [-588.127] (-592.191) (-587.824) -- 0:00:16
720000 -- (-586.751) (-587.582) (-592.669) [-588.008] * (-594.721) [-587.674] (-587.388) (-586.678) -- 0:00:16
Average standard deviation of split frequencies: 0.009289
720500 -- (-586.759) (-587.125) (-591.616) [-586.543] * (-587.613) (-589.043) (-598.438) [-587.550] -- 0:00:16
721000 -- (-586.299) (-587.364) (-593.384) [-586.643] * (-588.890) (-588.230) (-592.171) [-587.118] -- 0:00:16
721500 -- (-588.874) (-590.884) [-587.819] (-586.281) * (-588.180) [-587.616] (-597.207) (-587.289) -- 0:00:16
722000 -- (-588.915) [-590.666] (-587.963) (-586.608) * (-587.187) [-587.143] (-587.633) (-594.813) -- 0:00:16
722500 -- (-588.910) (-587.458) [-587.064] (-588.436) * (-587.921) (-587.203) (-589.055) [-589.924] -- 0:00:16
723000 -- (-589.226) [-587.209] (-587.085) (-586.836) * (-587.437) (-588.740) [-588.856] (-588.469) -- 0:00:16
723500 -- (-589.304) [-587.190] (-588.504) (-586.902) * (-591.001) [-588.761] (-591.431) (-587.920) -- 0:00:16
724000 -- (-588.025) (-587.513) [-587.241] (-587.291) * (-589.889) (-587.690) [-587.028] (-591.966) -- 0:00:16
724500 -- [-592.680] (-590.378) (-586.669) (-590.536) * [-591.264] (-589.726) (-586.959) (-586.995) -- 0:00:16
725000 -- (-588.066) [-587.551] (-588.307) (-587.666) * (-589.945) [-592.044] (-587.132) (-589.271) -- 0:00:16
Average standard deviation of split frequencies: 0.008874
725500 -- (-587.749) (-587.051) (-588.738) [-587.224] * (-587.043) (-593.067) [-587.171] (-590.534) -- 0:00:16
726000 -- (-588.387) (-587.259) [-588.483] (-586.815) * (-587.563) [-592.299] (-589.625) (-589.960) -- 0:00:16
726500 -- (-590.555) (-590.089) (-587.889) [-589.316] * (-587.885) (-592.951) [-591.802] (-588.200) -- 0:00:16
727000 -- (-591.510) (-589.678) (-588.082) [-586.731] * (-586.412) [-589.377] (-587.326) (-589.544) -- 0:00:16
727500 -- (-589.971) (-587.736) [-587.766] (-588.277) * (-587.060) (-587.702) [-587.543] (-591.439) -- 0:00:16
728000 -- (-590.208) [-586.739] (-590.458) (-589.202) * (-586.518) (-588.180) [-587.907] (-590.970) -- 0:00:16
728500 -- [-590.103] (-586.988) (-587.631) (-590.082) * (-586.439) (-589.800) (-588.113) [-587.432] -- 0:00:16
729000 -- [-587.184] (-586.410) (-586.239) (-591.848) * [-588.399] (-588.982) (-587.347) (-587.219) -- 0:00:16
729500 -- [-590.016] (-588.423) (-587.296) (-594.797) * (-588.289) (-589.566) (-586.305) [-587.996] -- 0:00:16
730000 -- (-596.524) (-590.224) (-589.208) [-586.512] * (-590.125) (-586.894) (-587.053) [-587.584] -- 0:00:16
Average standard deviation of split frequencies: 0.008817
730500 -- [-592.393] (-589.901) (-591.167) (-589.692) * (-588.159) (-588.513) (-588.389) [-587.564] -- 0:00:16
731000 -- (-587.065) (-591.468) [-589.417] (-589.744) * (-587.694) (-590.534) [-588.335] (-587.386) -- 0:00:16
731500 -- (-593.105) [-588.512] (-595.838) (-587.043) * (-587.367) (-588.292) [-588.187] (-587.823) -- 0:00:16
732000 -- (-589.472) (-592.676) (-589.182) [-588.463] * (-589.160) (-595.667) (-591.932) [-587.229] -- 0:00:16
732500 -- (-589.317) (-589.850) [-587.941] (-586.782) * (-588.468) (-588.307) (-590.495) [-589.820] -- 0:00:16
733000 -- (-587.679) (-590.085) [-587.986] (-586.429) * [-587.091] (-587.891) (-590.412) (-587.223) -- 0:00:16
733500 -- (-589.119) [-587.651] (-589.763) (-588.020) * (-587.911) (-592.074) [-588.186] (-590.853) -- 0:00:15
734000 -- (-589.953) (-590.091) (-587.980) [-588.452] * [-590.563] (-592.029) (-591.696) (-587.152) -- 0:00:15
734500 -- (-589.474) (-586.874) [-587.024] (-587.862) * (-589.000) [-587.528] (-588.749) (-587.183) -- 0:00:15
735000 -- (-587.600) [-588.185] (-587.825) (-588.131) * (-588.034) [-589.541] (-588.093) (-586.662) -- 0:00:15
Average standard deviation of split frequencies: 0.008497
735500 -- [-587.494] (-590.907) (-588.691) (-588.000) * (-586.930) (-588.451) [-591.316] (-588.660) -- 0:00:15
736000 -- (-587.615) (-587.551) (-590.778) [-587.054] * [-587.054] (-587.912) (-590.237) (-589.789) -- 0:00:15
736500 -- (-588.892) [-590.286] (-586.800) (-587.913) * (-589.478) [-587.792] (-587.210) (-590.380) -- 0:00:15
737000 -- (-588.781) (-592.748) (-587.075) [-586.493] * (-589.237) [-586.850] (-587.254) (-590.534) -- 0:00:15
737500 -- (-587.535) (-587.548) (-586.718) [-592.444] * (-588.903) (-587.055) [-590.114] (-590.016) -- 0:00:15
738000 -- (-587.965) [-586.411] (-586.313) (-588.471) * (-587.982) (-587.813) (-589.591) [-588.289] -- 0:00:15
738500 -- (-588.674) (-587.237) [-586.987] (-591.406) * (-588.705) [-588.021] (-590.637) (-588.677) -- 0:00:15
739000 -- (-590.501) (-589.656) [-588.588] (-589.169) * (-590.823) [-591.528] (-590.836) (-588.120) -- 0:00:15
739500 -- [-589.622] (-591.425) (-588.478) (-589.555) * (-591.720) [-587.519] (-587.505) (-588.100) -- 0:00:15
740000 -- (-587.583) (-594.034) [-592.191] (-591.056) * (-590.792) [-589.007] (-590.014) (-587.309) -- 0:00:15
Average standard deviation of split frequencies: 0.008316
740500 -- (-588.236) [-589.273] (-591.284) (-586.751) * [-588.090] (-587.540) (-588.222) (-589.984) -- 0:00:15
741000 -- [-587.816] (-588.368) (-587.349) (-588.098) * [-587.677] (-587.799) (-590.233) (-586.533) -- 0:00:15
741500 -- (-586.445) [-589.147] (-590.256) (-591.025) * (-590.261) [-586.549] (-589.623) (-587.388) -- 0:00:15
742000 -- (-587.596) (-587.767) (-598.581) [-588.176] * [-587.345] (-588.768) (-590.051) (-586.662) -- 0:00:15
742500 -- [-587.744] (-589.278) (-587.769) (-590.901) * (-588.831) [-587.038] (-588.025) (-590.447) -- 0:00:15
743000 -- (-588.393) (-595.726) [-587.749] (-590.386) * (-587.150) (-589.014) (-587.989) [-590.515] -- 0:00:15
743500 -- [-587.494] (-591.097) (-586.937) (-588.824) * [-589.791] (-589.754) (-588.977) (-590.632) -- 0:00:15
744000 -- [-587.212] (-590.075) (-589.022) (-590.023) * (-592.418) (-591.242) (-590.694) [-587.102] -- 0:00:15
744500 -- (-589.717) (-590.682) (-588.159) [-593.306] * (-595.273) (-591.694) [-587.779] (-591.660) -- 0:00:15
745000 -- [-588.076] (-588.769) (-589.627) (-591.318) * (-588.405) (-595.527) (-594.015) [-589.400] -- 0:00:15
Average standard deviation of split frequencies: 0.008594
745500 -- (-586.601) (-588.652) [-590.723] (-586.455) * (-588.821) [-587.979] (-587.138) (-592.211) -- 0:00:15
746000 -- [-586.354] (-589.523) (-587.118) (-586.831) * (-598.390) [-587.223] (-588.000) (-589.650) -- 0:00:15
746500 -- [-586.437] (-590.090) (-589.268) (-588.517) * (-589.000) [-587.959] (-587.661) (-589.257) -- 0:00:15
747000 -- (-586.976) (-589.835) (-586.626) [-587.023] * (-592.739) (-590.655) [-588.595] (-589.527) -- 0:00:15
747500 -- (-586.643) (-591.295) (-587.381) [-590.440] * [-589.199] (-587.198) (-587.691) (-590.979) -- 0:00:15
748000 -- [-586.493] (-590.318) (-591.730) (-592.405) * (-589.326) [-590.444] (-587.953) (-589.480) -- 0:00:15
748500 -- [-586.393] (-586.510) (-587.603) (-592.446) * (-587.183) [-587.447] (-587.239) (-590.948) -- 0:00:15
749000 -- (-588.705) [-589.683] (-587.369) (-587.339) * (-588.222) [-587.722] (-586.594) (-586.543) -- 0:00:15
749500 -- (-591.036) (-589.001) [-590.985] (-589.915) * (-587.914) (-587.105) [-586.664] (-586.584) -- 0:00:15
750000 -- (-593.927) (-588.896) (-589.904) [-587.550] * (-586.575) (-588.065) [-586.664] (-587.131) -- 0:00:15
Average standard deviation of split frequencies: 0.008164
750500 -- (-590.197) (-590.084) (-589.693) [-589.081] * [-587.619] (-588.394) (-593.999) (-588.661) -- 0:00:14
751000 -- (-591.002) [-588.886] (-591.136) (-589.353) * [-588.530] (-589.610) (-593.841) (-586.960) -- 0:00:14
751500 -- [-589.200] (-590.375) (-595.363) (-588.406) * (-587.740) (-590.940) [-590.673] (-592.416) -- 0:00:14
752000 -- (-587.757) (-588.311) (-592.361) [-587.564] * (-588.242) [-588.698] (-588.782) (-590.253) -- 0:00:14
752500 -- [-588.526] (-588.236) (-587.818) (-591.814) * (-588.827) [-588.789] (-590.302) (-587.894) -- 0:00:14
753000 -- (-590.221) (-593.968) [-587.168] (-589.923) * (-590.259) (-591.464) [-588.554] (-592.718) -- 0:00:14
753500 -- (-590.910) [-589.099] (-587.534) (-589.110) * (-588.336) [-587.764] (-587.707) (-587.622) -- 0:00:14
754000 -- (-588.979) [-588.144] (-588.493) (-589.670) * [-589.371] (-588.850) (-588.339) (-586.768) -- 0:00:14
754500 -- (-592.634) [-588.687] (-588.408) (-588.954) * (-588.664) [-588.746] (-589.216) (-586.389) -- 0:00:14
755000 -- (-588.936) (-588.282) [-589.419] (-592.385) * (-590.382) [-588.199] (-588.680) (-587.813) -- 0:00:14
Average standard deviation of split frequencies: 0.007857
755500 -- (-587.878) [-586.144] (-591.865) (-590.124) * [-590.277] (-587.052) (-587.030) (-588.230) -- 0:00:14
756000 -- (-588.561) (-589.312) (-588.675) [-588.143] * (-588.378) [-588.742] (-588.238) (-590.294) -- 0:00:14
756500 -- (-587.358) (-587.572) [-588.841] (-588.674) * (-587.915) [-587.558] (-589.424) (-587.930) -- 0:00:14
757000 -- (-591.938) (-590.851) [-587.582] (-592.780) * [-588.477] (-587.986) (-588.926) (-587.867) -- 0:00:14
757500 -- [-587.390] (-590.740) (-589.943) (-589.216) * (-591.495) [-591.434] (-589.987) (-588.408) -- 0:00:14
758000 -- [-586.724] (-586.977) (-586.847) (-586.859) * (-587.505) (-587.290) (-590.933) [-589.139] -- 0:00:14
758500 -- (-591.677) [-587.736] (-589.433) (-590.453) * [-588.184] (-588.917) (-587.481) (-597.974) -- 0:00:14
759000 -- (-590.710) (-591.467) (-587.084) [-590.101] * [-587.733] (-587.342) (-586.609) (-588.613) -- 0:00:14
759500 -- (-590.947) (-588.207) [-588.635] (-589.687) * (-588.449) (-593.666) (-587.548) [-587.008] -- 0:00:14
760000 -- (-587.117) (-588.350) (-592.526) [-589.383] * (-588.345) [-589.554] (-587.102) (-590.408) -- 0:00:14
Average standard deviation of split frequencies: 0.008346
760500 -- [-586.953] (-592.923) (-587.889) (-591.715) * (-588.470) [-590.076] (-592.321) (-592.824) -- 0:00:14
761000 -- [-588.627] (-592.036) (-587.579) (-587.795) * (-587.780) (-589.430) (-591.610) [-588.204] -- 0:00:14
761500 -- [-590.344] (-590.068) (-587.403) (-592.380) * [-589.718] (-592.653) (-589.111) (-587.565) -- 0:00:14
762000 -- (-587.008) (-587.349) [-588.585] (-592.016) * [-590.377] (-587.598) (-588.063) (-588.028) -- 0:00:14
762500 -- (-586.644) (-587.823) [-590.861] (-590.420) * (-590.174) (-589.337) [-588.466] (-587.896) -- 0:00:14
763000 -- (-588.910) [-588.581] (-586.978) (-589.559) * (-587.338) (-590.188) [-592.161] (-588.718) -- 0:00:14
763500 -- (-588.277) (-587.919) [-588.576] (-587.830) * (-587.952) (-589.452) (-588.549) [-590.941] -- 0:00:14
764000 -- [-586.622] (-587.059) (-588.597) (-588.168) * (-588.033) [-590.016] (-587.853) (-589.603) -- 0:00:14
764500 -- (-587.189) (-588.397) (-590.872) [-587.975] * (-587.119) (-588.925) [-586.533] (-593.179) -- 0:00:14
765000 -- (-586.756) [-586.407] (-591.715) (-588.123) * (-588.695) [-588.336] (-592.072) (-587.788) -- 0:00:14
Average standard deviation of split frequencies: 0.008493
765500 -- (-589.712) [-587.300] (-587.681) (-589.918) * (-591.029) (-590.129) (-591.673) [-587.745] -- 0:00:14
766000 -- (-591.416) (-587.003) (-588.193) [-588.364] * (-587.660) [-593.414] (-590.956) (-586.663) -- 0:00:14
766500 -- (-589.768) (-586.296) [-590.185] (-589.989) * (-591.320) [-588.560] (-587.721) (-588.135) -- 0:00:14
767000 -- (-594.185) [-586.503] (-592.680) (-586.628) * (-589.697) [-588.747] (-588.227) (-590.016) -- 0:00:13
767500 -- [-588.932] (-591.226) (-587.443) (-591.029) * (-587.679) (-592.196) [-586.897] (-586.508) -- 0:00:13
768000 -- (-587.200) (-587.436) [-587.018] (-588.250) * (-588.183) (-589.821) (-586.966) [-592.065] -- 0:00:13
768500 -- (-586.645) (-589.093) (-586.711) [-588.845] * (-588.566) (-591.225) (-588.185) [-588.038] -- 0:00:13
769000 -- (-588.971) (-588.564) (-587.662) [-589.035] * (-588.082) (-587.622) [-587.904] (-588.507) -- 0:00:13
769500 -- [-588.952] (-588.372) (-589.014) (-590.957) * (-589.010) (-588.259) [-589.818] (-587.838) -- 0:00:13
770000 -- (-588.773) (-586.256) (-586.935) [-587.265] * [-591.036] (-589.685) (-591.555) (-588.944) -- 0:00:13
Average standard deviation of split frequencies: 0.008523
770500 -- [-589.174] (-586.497) (-588.255) (-589.806) * (-588.052) [-589.744] (-590.207) (-590.329) -- 0:00:13
771000 -- (-586.719) (-587.770) (-587.595) [-588.002] * (-587.402) (-588.622) [-591.467] (-590.181) -- 0:00:13
771500 -- [-587.739] (-588.036) (-586.862) (-589.257) * (-593.806) [-589.517] (-587.564) (-589.055) -- 0:00:13
772000 -- [-588.741] (-588.871) (-588.735) (-591.469) * [-587.815] (-587.872) (-587.228) (-587.005) -- 0:00:13
772500 -- (-588.008) (-587.383) [-588.326] (-589.878) * [-587.701] (-594.084) (-587.396) (-587.666) -- 0:00:13
773000 -- (-587.922) (-589.783) (-589.257) [-588.505] * [-588.912] (-588.211) (-587.250) (-589.059) -- 0:00:13
773500 -- [-589.606] (-588.187) (-587.207) (-588.623) * (-593.445) (-590.876) [-591.463] (-588.926) -- 0:00:13
774000 -- (-587.373) [-586.852] (-588.430) (-590.155) * (-592.860) (-595.341) [-586.998] (-588.248) -- 0:00:13
774500 -- (-587.177) (-586.819) (-589.094) [-586.652] * (-588.151) (-592.003) (-587.223) [-589.233] -- 0:00:13
775000 -- [-588.238] (-589.108) (-590.602) (-588.101) * (-588.216) [-587.331] (-595.759) (-588.219) -- 0:00:13
Average standard deviation of split frequencies: 0.008302
775500 -- (-587.537) (-586.589) (-588.204) [-590.432] * (-589.584) (-589.469) (-588.774) [-588.327] -- 0:00:13
776000 -- (-586.958) [-588.161] (-587.074) (-586.504) * (-596.502) [-587.911] (-587.367) (-591.075) -- 0:00:13
776500 -- (-587.068) (-587.353) (-589.887) [-588.036] * (-588.368) [-587.675] (-588.776) (-589.381) -- 0:00:13
777000 -- (-587.083) [-587.973] (-586.850) (-587.126) * [-590.483] (-588.016) (-599.625) (-590.096) -- 0:00:13
777500 -- (-589.123) (-587.270) [-587.141] (-587.368) * [-586.715] (-587.783) (-593.151) (-593.228) -- 0:00:13
778000 -- (-590.600) [-587.228] (-589.223) (-589.940) * (-587.062) (-587.780) (-590.101) [-588.112] -- 0:00:13
778500 -- (-588.230) (-588.064) (-590.384) [-587.706] * [-587.419] (-588.860) (-592.524) (-589.492) -- 0:00:13
779000 -- (-587.522) [-587.424] (-589.429) (-590.698) * (-587.060) (-586.837) [-591.205] (-587.816) -- 0:00:13
779500 -- (-587.279) [-586.496] (-591.998) (-588.625) * (-587.340) [-589.420] (-588.649) (-592.166) -- 0:00:13
780000 -- (-590.602) (-588.748) [-588.645] (-590.261) * [-587.691] (-586.374) (-589.046) (-586.975) -- 0:00:13
Average standard deviation of split frequencies: 0.008575
780500 -- (-591.511) [-588.742] (-588.092) (-589.225) * (-587.332) [-589.840] (-588.497) (-587.337) -- 0:00:13
781000 -- (-587.723) [-590.803] (-588.422) (-588.955) * (-589.939) [-587.983] (-590.230) (-587.290) -- 0:00:13
781500 -- [-590.007] (-589.599) (-590.731) (-589.793) * (-587.324) [-587.313] (-591.658) (-589.345) -- 0:00:13
782000 -- (-587.699) [-589.549] (-587.818) (-587.586) * (-587.292) (-589.348) (-587.972) [-590.238] -- 0:00:13
782500 -- (-588.547) [-588.480] (-588.565) (-586.405) * (-589.969) [-586.638] (-586.849) (-589.706) -- 0:00:13
783000 -- (-588.142) (-586.822) [-587.468] (-587.920) * (-586.546) [-588.223] (-588.096) (-587.804) -- 0:00:13
783500 -- (-590.259) (-588.697) (-587.458) [-587.883] * (-587.685) (-586.785) [-588.268] (-587.180) -- 0:00:12
784000 -- (-594.432) (-590.367) (-588.580) [-587.331] * (-587.591) (-587.005) (-588.185) [-588.480] -- 0:00:12
784500 -- (-593.597) (-589.398) (-587.368) [-589.269] * (-590.430) (-588.338) (-589.876) [-589.900] -- 0:00:12
785000 -- (-590.144) (-589.987) (-590.307) [-589.079] * (-591.738) (-588.075) [-587.547] (-588.627) -- 0:00:12
Average standard deviation of split frequencies: 0.008716
785500 -- (-588.327) [-589.265] (-588.959) (-590.841) * (-590.574) [-587.650] (-587.018) (-588.795) -- 0:00:12
786000 -- (-586.798) (-588.230) [-591.517] (-591.186) * (-593.936) [-588.105] (-587.258) (-591.251) -- 0:00:12
786500 -- (-586.246) (-590.471) [-590.158] (-588.931) * (-592.777) (-587.805) (-589.869) [-587.774] -- 0:00:12
787000 -- [-588.290] (-587.275) (-590.097) (-591.463) * (-588.049) (-586.709) (-589.801) [-587.861] -- 0:00:12
787500 -- (-586.994) (-590.798) [-589.604] (-589.085) * (-589.719) (-589.345) (-589.937) [-587.987] -- 0:00:12
788000 -- [-588.324] (-587.506) (-589.599) (-587.700) * (-588.224) (-588.652) [-588.768] (-590.818) -- 0:00:12
788500 -- [-588.792] (-587.676) (-590.114) (-589.893) * (-586.519) (-589.289) (-586.505) [-588.066] -- 0:00:12
789000 -- (-589.494) [-591.761] (-587.812) (-588.355) * [-587.652] (-589.970) (-589.681) (-588.792) -- 0:00:12
789500 -- [-590.981] (-590.176) (-588.864) (-587.486) * (-589.647) (-588.500) [-588.982] (-587.001) -- 0:00:12
790000 -- (-590.995) [-589.081] (-587.753) (-587.058) * (-590.271) [-588.068] (-591.300) (-588.970) -- 0:00:12
Average standard deviation of split frequencies: 0.008585
790500 -- (-587.254) (-589.651) (-588.127) [-587.937] * (-591.774) (-587.017) [-588.352] (-590.343) -- 0:00:12
791000 -- (-587.737) (-589.607) (-589.376) [-586.935] * (-589.075) (-586.660) [-589.161] (-590.855) -- 0:00:12
791500 -- (-588.279) [-588.518] (-589.367) (-586.827) * (-587.177) [-589.800] (-587.951) (-591.259) -- 0:00:12
792000 -- (-589.334) [-589.779] (-588.834) (-586.196) * (-589.100) (-591.190) [-589.798] (-588.042) -- 0:00:12
792500 -- (-589.616) [-590.571] (-589.414) (-591.946) * (-588.472) (-592.693) [-588.823] (-587.026) -- 0:00:12
793000 -- (-593.520) (-590.428) [-588.614] (-586.811) * (-588.105) (-586.707) [-591.078] (-587.796) -- 0:00:12
793500 -- (-589.441) (-588.364) (-588.796) [-591.242] * (-587.684) (-590.237) [-587.825] (-591.050) -- 0:00:12
794000 -- (-590.411) (-589.728) (-588.421) [-591.710] * [-587.565] (-589.298) (-590.216) (-594.825) -- 0:00:12
794500 -- (-588.792) [-586.702] (-587.496) (-587.694) * (-586.549) [-587.071] (-589.731) (-591.674) -- 0:00:12
795000 -- [-588.742] (-588.075) (-588.702) (-589.916) * (-588.962) (-586.816) [-590.848] (-590.972) -- 0:00:12
Average standard deviation of split frequencies: 0.008212
795500 -- (-588.716) (-586.775) [-586.890] (-587.296) * (-590.464) (-592.954) (-590.302) [-588.033] -- 0:00:12
796000 -- (-591.089) (-587.587) [-590.072] (-587.149) * (-589.624) [-590.875] (-589.307) (-586.486) -- 0:00:12
796500 -- (-589.949) (-587.191) [-592.618] (-589.272) * (-590.289) (-587.540) (-589.612) [-587.761] -- 0:00:12
797000 -- (-586.706) (-588.847) [-589.193] (-590.101) * (-592.600) (-588.119) (-586.247) [-588.086] -- 0:00:12
797500 -- [-587.112] (-589.655) (-591.423) (-587.491) * (-592.587) (-591.529) [-589.113] (-586.149) -- 0:00:12
798000 -- (-591.932) (-587.433) [-586.711] (-590.830) * (-589.789) (-591.755) (-590.174) [-587.647] -- 0:00:12
798500 -- (-589.742) (-588.706) (-587.512) [-589.902] * (-589.702) (-589.977) [-589.440] (-588.438) -- 0:00:12
799000 -- (-588.665) [-589.486] (-588.639) (-592.003) * (-589.467) (-587.285) [-591.562] (-588.228) -- 0:00:12
799500 -- (-587.488) [-588.937] (-591.331) (-588.063) * (-586.980) (-588.939) [-589.088] (-588.638) -- 0:00:12
800000 -- [-589.512] (-590.121) (-590.904) (-586.847) * (-588.371) (-586.958) [-588.997] (-587.575) -- 0:00:12
Average standard deviation of split frequencies: 0.007732
800500 -- (-590.660) (-587.719) (-587.379) [-586.550] * (-589.773) [-587.290] (-591.634) (-586.484) -- 0:00:11
801000 -- (-591.210) (-588.790) (-587.910) [-588.180] * (-588.036) [-587.350] (-587.290) (-588.363) -- 0:00:11
801500 -- (-588.242) (-588.918) (-588.155) [-588.412] * (-590.648) [-587.357] (-589.692) (-589.388) -- 0:00:11
802000 -- (-589.805) (-587.286) (-587.858) [-587.796] * (-595.040) (-586.553) (-590.782) [-587.021] -- 0:00:11
802500 -- [-589.529] (-589.155) (-587.975) (-587.866) * (-593.195) [-587.914] (-587.189) (-592.743) -- 0:00:11
803000 -- [-587.354] (-592.911) (-591.273) (-587.586) * (-590.661) (-586.496) (-590.139) [-587.952] -- 0:00:11
803500 -- (-589.778) [-588.991] (-592.312) (-588.415) * [-589.329] (-587.617) (-588.403) (-588.634) -- 0:00:11
804000 -- (-588.284) [-589.470] (-586.681) (-586.656) * (-589.131) (-587.514) [-588.116] (-590.081) -- 0:00:11
804500 -- (-589.685) [-590.624] (-589.393) (-587.149) * (-587.304) (-597.329) [-587.566] (-590.778) -- 0:00:11
805000 -- (-587.016) (-586.863) [-593.691] (-588.043) * (-589.589) (-594.872) (-587.688) [-591.267] -- 0:00:11
Average standard deviation of split frequencies: 0.007408
805500 -- (-587.448) [-590.385] (-590.946) (-589.741) * (-587.802) (-588.018) [-589.206] (-591.047) -- 0:00:11
806000 -- (-586.994) (-588.347) (-593.033) [-587.441] * [-587.741] (-590.730) (-592.940) (-591.758) -- 0:00:11
806500 -- (-588.477) [-586.345] (-590.069) (-588.531) * (-588.761) (-587.546) (-588.017) [-589.033] -- 0:00:11
807000 -- (-586.641) (-589.403) (-587.572) [-592.125] * (-589.394) (-587.377) [-586.596] (-590.344) -- 0:00:11
807500 -- [-587.953] (-589.387) (-589.422) (-587.078) * [-589.693] (-587.788) (-587.526) (-592.672) -- 0:00:11
808000 -- [-586.736] (-587.762) (-588.320) (-590.187) * (-588.133) [-588.223] (-590.585) (-589.000) -- 0:00:11
808500 -- (-588.093) (-589.360) [-588.541] (-588.314) * [-587.650] (-587.110) (-591.586) (-589.364) -- 0:00:11
809000 -- (-586.957) (-589.798) (-587.415) [-587.287] * (-592.417) (-589.890) [-590.273] (-588.608) -- 0:00:11
809500 -- [-587.573] (-590.441) (-587.996) (-588.091) * (-592.272) [-590.132] (-589.648) (-588.899) -- 0:00:11
810000 -- (-591.046) (-591.171) [-587.438] (-589.083) * (-593.163) (-589.124) (-587.398) [-587.318] -- 0:00:11
Average standard deviation of split frequencies: 0.007094
810500 -- (-589.580) (-591.103) (-588.091) [-588.158] * [-590.265] (-588.399) (-587.329) (-587.318) -- 0:00:11
811000 -- (-588.861) (-590.144) [-588.652] (-589.422) * [-588.198] (-586.917) (-587.058) (-591.418) -- 0:00:11
811500 -- (-588.218) [-587.924] (-598.135) (-589.808) * (-587.243) [-587.952] (-587.159) (-596.262) -- 0:00:11
812000 -- (-590.355) (-590.958) [-587.222] (-587.279) * (-591.613) [-587.273] (-587.314) (-591.158) -- 0:00:11
812500 -- (-588.127) [-588.958] (-590.083) (-587.563) * [-588.595] (-589.938) (-589.247) (-587.325) -- 0:00:11
813000 -- (-589.661) [-589.036] (-589.002) (-590.450) * (-586.410) [-589.603] (-589.162) (-592.899) -- 0:00:11
813500 -- (-588.648) (-588.968) (-589.013) [-594.003] * (-586.404) (-591.974) (-594.178) [-588.443] -- 0:00:11
814000 -- (-587.938) (-588.923) [-590.076] (-590.474) * [-586.264] (-591.786) (-588.394) (-588.427) -- 0:00:11
814500 -- (-589.469) [-589.628] (-593.232) (-589.693) * (-587.533) [-587.340] (-592.010) (-586.253) -- 0:00:11
815000 -- (-591.352) [-588.903] (-589.427) (-592.382) * (-589.547) (-588.686) [-589.600] (-591.728) -- 0:00:11
Average standard deviation of split frequencies: 0.007472
815500 -- (-589.149) (-588.719) (-589.619) [-587.425] * (-587.068) [-590.629] (-588.130) (-589.343) -- 0:00:11
816000 -- (-588.503) [-587.859] (-586.746) (-587.571) * [-588.307] (-588.632) (-589.420) (-587.582) -- 0:00:11
816500 -- (-590.631) [-587.404] (-588.170) (-587.828) * (-588.553) (-587.138) [-588.952] (-591.240) -- 0:00:11
817000 -- (-586.343) (-588.167) (-588.205) [-586.603] * (-590.738) (-592.076) [-586.427] (-588.557) -- 0:00:10
817500 -- (-588.883) (-588.357) [-588.433] (-588.850) * (-590.204) (-590.894) (-587.794) [-587.928] -- 0:00:10
818000 -- (-590.081) (-587.188) [-588.082] (-586.993) * (-589.473) [-588.197] (-589.332) (-588.821) -- 0:00:10
818500 -- (-589.519) (-587.577) (-587.013) [-587.817] * [-591.454] (-588.054) (-587.328) (-587.412) -- 0:00:10
819000 -- (-590.515) (-586.745) (-587.157) [-587.782] * [-589.064] (-592.585) (-587.209) (-589.369) -- 0:00:10
819500 -- (-588.099) (-588.098) [-587.833] (-587.702) * (-588.553) (-587.422) [-587.619] (-587.276) -- 0:00:10
820000 -- (-588.921) (-589.033) (-593.501) [-588.420] * (-587.696) [-588.896] (-591.838) (-587.861) -- 0:00:10
Average standard deviation of split frequencies: 0.007659
820500 -- (-588.686) (-586.814) [-591.507] (-587.522) * (-589.367) (-587.845) [-592.878] (-588.771) -- 0:00:10
821000 -- (-589.377) (-586.286) (-589.487) [-586.715] * (-590.494) [-589.112] (-586.939) (-589.736) -- 0:00:10
821500 -- [-587.730] (-587.765) (-586.792) (-588.977) * (-589.418) (-587.543) (-589.694) [-588.841] -- 0:00:10
822000 -- (-587.286) [-589.665] (-587.674) (-591.948) * (-591.296) (-587.801) [-588.033] (-589.557) -- 0:00:10
822500 -- (-587.547) (-590.029) (-587.006) [-586.814] * (-589.411) (-586.650) [-587.213] (-589.371) -- 0:00:10
823000 -- [-587.334] (-591.907) (-586.595) (-592.441) * (-587.185) (-588.200) [-587.220] (-589.285) -- 0:00:10
823500 -- (-587.687) [-586.693] (-586.487) (-593.657) * [-587.485] (-587.650) (-591.364) (-588.980) -- 0:00:10
824000 -- (-589.753) [-588.355] (-587.226) (-587.295) * (-588.653) (-589.258) (-588.560) [-588.338] -- 0:00:10
824500 -- (-589.756) [-590.860] (-587.940) (-586.607) * (-586.564) (-590.878) [-588.264] (-590.607) -- 0:00:10
825000 -- (-587.849) (-586.678) (-590.363) [-586.628] * (-587.250) (-587.927) [-588.721] (-587.991) -- 0:00:10
Average standard deviation of split frequencies: 0.007762
825500 -- (-589.084) [-587.183] (-588.360) (-587.360) * [-588.715] (-587.708) (-588.724) (-590.985) -- 0:00:10
826000 -- (-589.807) [-588.169] (-591.181) (-589.389) * (-590.028) (-586.754) [-589.118] (-587.293) -- 0:00:10
826500 -- (-588.563) [-587.272] (-593.081) (-587.085) * (-594.884) (-588.216) (-588.877) [-590.130] -- 0:00:10
827000 -- (-588.062) (-590.008) (-589.885) [-588.728] * (-588.256) [-587.056] (-590.168) (-590.597) -- 0:00:10
827500 -- [-588.053] (-587.234) (-589.626) (-588.715) * [-586.225] (-591.496) (-590.255) (-588.615) -- 0:00:10
828000 -- (-587.213) [-586.624] (-589.806) (-587.566) * (-588.482) [-590.772] (-589.863) (-586.706) -- 0:00:10
828500 -- [-589.972] (-586.227) (-589.257) (-587.899) * (-587.606) (-588.657) (-588.643) [-588.891] -- 0:00:10
829000 -- [-588.050] (-586.558) (-589.450) (-589.306) * (-586.972) (-591.348) (-586.974) [-586.147] -- 0:00:10
829500 -- [-587.346] (-588.636) (-589.820) (-593.478) * [-588.129] (-592.235) (-589.445) (-589.028) -- 0:00:10
830000 -- [-588.721] (-589.698) (-588.428) (-588.080) * [-586.410] (-589.386) (-590.711) (-591.287) -- 0:00:10
Average standard deviation of split frequencies: 0.007983
830500 -- (-589.735) [-590.360] (-594.437) (-591.152) * (-586.686) [-589.605] (-587.316) (-587.307) -- 0:00:10
831000 -- (-588.204) (-591.363) [-587.872] (-589.028) * [-590.394] (-592.111) (-587.352) (-590.940) -- 0:00:10
831500 -- (-588.819) (-593.308) (-589.069) [-589.910] * (-591.579) (-586.765) (-588.697) [-587.075] -- 0:00:10
832000 -- [-588.756] (-587.622) (-589.265) (-591.451) * (-592.086) (-591.253) (-590.635) [-587.190] -- 0:00:10
832500 -- (-588.108) (-587.996) [-589.190] (-589.715) * (-590.236) (-591.703) (-589.519) [-589.264] -- 0:00:10
833000 -- (-586.724) [-588.198] (-590.583) (-587.329) * (-588.936) (-588.939) [-586.496] (-587.710) -- 0:00:10
833500 -- [-588.985] (-589.916) (-591.433) (-590.436) * (-587.874) [-587.085] (-589.325) (-586.968) -- 0:00:09
834000 -- (-588.337) (-588.248) (-588.161) [-587.604] * (-590.387) [-588.665] (-591.670) (-591.195) -- 0:00:09
834500 -- (-588.526) (-591.055) (-586.959) [-589.300] * (-593.107) (-588.268) (-586.847) [-588.231] -- 0:00:09
835000 -- (-588.138) [-587.475] (-589.672) (-591.003) * (-589.003) (-588.849) [-587.326] (-587.244) -- 0:00:09
Average standard deviation of split frequencies: 0.007819
835500 -- (-589.229) [-588.408] (-586.737) (-592.141) * (-588.044) (-589.196) (-586.527) [-587.830] -- 0:00:09
836000 -- (-588.527) (-589.597) (-589.491) [-590.920] * (-587.932) (-590.161) [-587.662] (-590.899) -- 0:00:09
836500 -- (-586.235) (-587.999) (-594.306) [-590.060] * (-590.663) (-589.283) (-589.198) [-590.184] -- 0:00:09
837000 -- [-588.703] (-587.183) (-588.262) (-589.361) * [-587.978] (-587.776) (-587.266) (-588.605) -- 0:00:09
837500 -- (-586.725) (-591.311) (-589.213) [-588.679] * (-586.855) (-586.635) (-588.573) [-590.140] -- 0:00:09
838000 -- (-586.136) (-590.487) [-588.373] (-588.167) * (-587.993) (-587.245) (-590.344) [-590.733] -- 0:00:09
838500 -- [-587.782] (-590.293) (-591.142) (-589.476) * (-591.447) (-587.648) (-588.937) [-589.853] -- 0:00:09
839000 -- (-588.378) [-591.801] (-589.913) (-590.474) * (-587.422) (-587.123) [-591.247] (-588.458) -- 0:00:09
839500 -- (-588.962) (-586.268) [-588.186] (-587.917) * (-588.999) (-588.577) (-587.951) [-586.491] -- 0:00:09
840000 -- (-587.360) (-586.785) (-587.921) [-589.341] * (-589.933) [-586.617] (-588.035) (-588.430) -- 0:00:09
Average standard deviation of split frequencies: 0.008000
840500 -- [-589.220] (-587.066) (-588.445) (-588.948) * (-587.472) (-588.807) [-587.148] (-587.429) -- 0:00:09
841000 -- (-587.888) (-588.753) (-591.905) [-589.976] * (-590.580) (-588.431) (-590.892) [-587.988] -- 0:00:09
841500 -- (-590.428) (-587.666) (-587.477) [-588.504] * (-591.380) (-586.996) (-595.072) [-588.246] -- 0:00:09
842000 -- (-590.634) (-589.769) (-587.551) [-590.436] * (-587.566) (-587.576) (-589.122) [-587.963] -- 0:00:09
842500 -- [-590.115] (-589.543) (-587.985) (-586.011) * (-588.277) [-588.177] (-587.887) (-588.438) -- 0:00:09
843000 -- (-589.880) (-590.426) [-587.635] (-586.318) * (-592.666) (-588.356) (-589.840) [-586.827] -- 0:00:09
843500 -- [-587.451] (-588.942) (-588.224) (-590.122) * (-588.400) (-588.574) (-587.083) [-588.612] -- 0:00:09
844000 -- [-587.805] (-589.929) (-586.781) (-587.196) * [-586.965] (-589.388) (-587.337) (-592.230) -- 0:00:09
844500 -- (-587.473) (-590.671) [-587.343] (-589.635) * [-588.801] (-589.450) (-588.144) (-590.707) -- 0:00:09
845000 -- (-588.988) (-587.776) (-586.862) [-586.334] * [-588.780] (-591.280) (-593.789) (-588.566) -- 0:00:09
Average standard deviation of split frequencies: 0.008135
845500 -- [-586.955] (-587.598) (-592.101) (-587.134) * (-588.216) (-590.275) [-588.410] (-589.785) -- 0:00:09
846000 -- [-588.782] (-590.485) (-586.486) (-589.421) * (-589.515) (-586.815) [-588.384] (-588.971) -- 0:00:09
846500 -- (-589.763) (-587.136) (-589.077) [-588.000] * (-587.847) [-586.721] (-592.195) (-593.648) -- 0:00:09
847000 -- [-587.563] (-591.153) (-589.135) (-587.612) * (-588.177) [-590.171] (-593.437) (-589.065) -- 0:00:09
847500 -- [-591.401] (-592.345) (-590.570) (-592.188) * (-588.128) (-587.577) (-593.626) [-590.805] -- 0:00:09
848000 -- (-589.842) (-588.830) (-593.706) [-586.562] * (-586.935) (-591.043) [-587.281] (-589.280) -- 0:00:09
848500 -- (-587.400) [-587.027] (-589.498) (-588.221) * (-592.148) (-588.960) (-587.663) [-587.258] -- 0:00:09
849000 -- (-592.528) [-590.602] (-592.026) (-587.942) * [-587.389] (-591.033) (-587.436) (-586.891) -- 0:00:09
849500 -- [-591.477] (-587.544) (-599.045) (-588.945) * [-588.700] (-587.657) (-587.620) (-587.724) -- 0:00:09
850000 -- (-588.870) (-589.315) (-589.880) [-586.710] * (-587.942) (-586.961) (-587.059) [-587.588] -- 0:00:09
Average standard deviation of split frequencies: 0.007869
850500 -- (-589.622) [-588.889] (-588.231) (-588.413) * (-588.516) (-587.142) [-586.660] (-586.525) -- 0:00:08
851000 -- (-588.513) (-586.952) (-587.120) [-587.501] * (-588.413) [-589.259] (-586.522) (-586.750) -- 0:00:08
851500 -- [-587.103] (-589.394) (-591.325) (-589.188) * (-587.947) (-588.962) (-587.774) [-589.359] -- 0:00:08
852000 -- (-588.307) (-591.432) (-587.003) [-591.667] * (-588.696) (-588.279) [-587.935] (-588.180) -- 0:00:08
852500 -- [-591.137] (-592.789) (-588.401) (-587.331) * (-590.640) [-587.879] (-592.238) (-588.115) -- 0:00:08
853000 -- [-586.359] (-587.922) (-586.156) (-590.185) * [-587.353] (-587.582) (-586.935) (-593.814) -- 0:00:08
853500 -- (-586.774) (-591.781) (-593.182) [-586.473] * (-590.782) (-589.715) (-592.243) [-588.385] -- 0:00:08
854000 -- (-590.376) (-589.337) [-589.053] (-586.346) * (-588.488) (-592.344) (-590.177) [-588.781] -- 0:00:08
854500 -- (-589.689) (-592.371) [-589.429] (-587.010) * [-590.217] (-586.820) (-588.916) (-588.927) -- 0:00:08
855000 -- [-588.726] (-591.464) (-590.570) (-590.386) * [-588.058] (-592.416) (-589.279) (-589.013) -- 0:00:08
Average standard deviation of split frequencies: 0.007636
855500 -- (-588.926) (-593.638) [-589.565] (-588.753) * (-588.049) (-588.803) [-587.841] (-589.047) -- 0:00:08
856000 -- (-592.613) (-588.498) (-592.456) [-588.536] * (-586.875) [-588.155] (-593.287) (-588.429) -- 0:00:08
856500 -- (-588.536) (-589.000) (-591.352) [-590.334] * (-589.595) (-588.843) (-588.288) [-586.283] -- 0:00:08
857000 -- (-589.013) [-587.151] (-587.356) (-589.810) * [-591.590] (-589.438) (-590.592) (-588.066) -- 0:00:08
857500 -- [-588.151] (-587.756) (-589.224) (-589.111) * (-591.959) [-586.892] (-591.406) (-587.970) -- 0:00:08
858000 -- (-588.322) [-587.440] (-591.110) (-586.813) * [-595.179] (-586.564) (-593.095) (-587.557) -- 0:00:08
858500 -- (-587.463) (-588.336) (-590.825) [-589.892] * (-591.957) [-587.863] (-590.831) (-588.383) -- 0:00:08
859000 -- (-591.306) [-587.876] (-590.955) (-589.739) * (-590.992) [-588.233] (-587.374) (-590.021) -- 0:00:08
859500 -- (-587.497) (-589.434) [-589.516] (-587.337) * [-588.055] (-590.394) (-587.791) (-589.945) -- 0:00:08
860000 -- (-589.708) (-589.594) (-588.085) [-587.764] * (-586.357) (-588.118) (-586.733) [-587.354] -- 0:00:08
Average standard deviation of split frequencies: 0.007771
860500 -- [-587.971] (-587.246) (-589.392) (-586.564) * (-587.263) (-591.384) (-588.090) [-587.846] -- 0:00:08
861000 -- (-590.139) (-587.954) (-589.134) [-586.607] * (-587.856) (-589.061) (-587.250) [-592.058] -- 0:00:08
861500 -- [-587.041] (-589.400) (-589.658) (-587.358) * [-589.185] (-590.734) (-587.689) (-597.594) -- 0:00:08
862000 -- (-587.789) [-591.605] (-587.663) (-587.160) * [-587.883] (-586.926) (-588.157) (-595.286) -- 0:00:08
862500 -- (-589.726) (-586.692) (-587.921) [-589.432] * [-588.910] (-589.332) (-590.239) (-588.807) -- 0:00:08
863000 -- (-590.567) (-588.636) (-595.045) [-587.417] * (-589.953) [-587.932] (-590.980) (-589.493) -- 0:00:08
863500 -- [-588.209] (-588.511) (-588.606) (-592.045) * (-590.812) (-591.322) [-591.934] (-589.579) -- 0:00:08
864000 -- (-591.641) [-589.122] (-587.431) (-591.710) * [-587.182] (-588.529) (-589.997) (-586.974) -- 0:00:08
864500 -- (-587.306) [-587.843] (-588.673) (-588.732) * (-589.990) (-591.786) (-592.478) [-587.529] -- 0:00:08
865000 -- (-589.898) (-590.442) (-588.455) [-587.039] * [-590.817] (-587.313) (-590.060) (-586.939) -- 0:00:08
Average standard deviation of split frequencies: 0.007995
865500 -- [-590.444] (-587.661) (-586.998) (-587.423) * (-588.807) [-588.169] (-586.387) (-588.177) -- 0:00:08
866000 -- (-586.819) (-591.853) (-588.428) [-590.346] * (-587.357) (-596.063) (-587.543) [-587.496] -- 0:00:08
866500 -- (-586.599) (-589.207) (-590.717) [-589.874] * [-588.139] (-589.858) (-587.075) (-586.658) -- 0:00:08
867000 -- (-591.113) (-589.519) [-587.079] (-587.049) * (-591.901) (-586.532) (-588.870) [-588.433] -- 0:00:07
867500 -- (-598.584) [-586.582] (-586.631) (-586.432) * [-591.619] (-590.692) (-588.806) (-589.617) -- 0:00:07
868000 -- [-591.076] (-587.786) (-589.020) (-586.842) * (-586.890) (-590.727) (-587.355) [-592.850] -- 0:00:07
868500 -- [-587.969] (-588.322) (-592.612) (-589.380) * (-586.552) (-589.486) (-590.843) [-587.336] -- 0:00:07
869000 -- (-589.193) (-589.410) (-588.722) [-587.828] * (-587.966) [-586.799] (-589.577) (-589.446) -- 0:00:07
869500 -- (-589.602) [-588.067] (-587.043) (-589.565) * (-590.483) (-587.400) (-588.924) [-589.152] -- 0:00:07
870000 -- (-587.457) (-589.295) [-590.344] (-589.705) * (-588.004) (-587.079) [-590.513] (-593.644) -- 0:00:07
Average standard deviation of split frequencies: 0.007377
870500 -- [-586.830] (-588.636) (-589.332) (-590.636) * (-588.450) [-590.021] (-590.951) (-591.314) -- 0:00:07
871000 -- [-587.815] (-589.437) (-588.282) (-587.075) * [-588.305] (-589.551) (-591.675) (-592.180) -- 0:00:07
871500 -- (-589.324) (-588.446) (-589.365) [-589.288] * (-587.415) [-589.550] (-588.500) (-588.359) -- 0:00:07
872000 -- [-588.674] (-586.884) (-590.860) (-588.639) * [-588.947] (-588.933) (-586.508) (-588.750) -- 0:00:07
872500 -- (-586.589) (-588.613) (-588.227) [-586.911] * (-587.394) (-588.075) (-587.616) [-590.154] -- 0:00:07
873000 -- [-587.432] (-587.150) (-588.244) (-589.112) * (-587.371) [-587.435] (-588.236) (-587.992) -- 0:00:07
873500 -- (-588.049) [-588.277] (-588.134) (-589.097) * [-587.378] (-587.118) (-590.208) (-589.223) -- 0:00:07
874000 -- (-587.824) [-587.540] (-587.797) (-589.038) * [-587.211] (-589.768) (-588.619) (-587.459) -- 0:00:07
874500 -- (-588.428) [-589.590] (-589.536) (-589.961) * (-588.735) [-587.252] (-591.878) (-586.652) -- 0:00:07
875000 -- (-587.714) (-587.804) [-588.947] (-588.985) * [-591.421] (-588.360) (-588.073) (-590.692) -- 0:00:07
Average standard deviation of split frequencies: 0.007426
875500 -- (-587.961) (-589.478) (-588.760) [-587.226] * (-588.255) [-588.265] (-586.585) (-589.025) -- 0:00:07
876000 -- (-589.000) [-590.935] (-590.444) (-588.627) * (-589.286) (-587.638) [-587.520] (-591.357) -- 0:00:07
876500 -- (-587.201) (-589.002) (-588.378) [-587.653] * (-591.755) (-587.270) [-588.844] (-587.759) -- 0:00:07
877000 -- [-587.265] (-589.611) (-588.534) (-588.131) * (-587.661) (-588.937) (-588.841) [-589.190] -- 0:00:07
877500 -- (-591.335) (-588.278) (-590.471) [-586.600] * (-587.841) [-587.968] (-590.906) (-588.775) -- 0:00:07
878000 -- (-589.674) (-593.546) [-589.770] (-587.015) * (-586.655) (-588.155) [-591.637] (-588.747) -- 0:00:07
878500 -- (-590.754) (-588.396) (-594.185) [-588.870] * [-587.755] (-591.489) (-594.667) (-589.835) -- 0:00:07
879000 -- (-588.615) (-586.708) (-589.239) [-588.392] * (-588.587) [-588.162] (-593.475) (-589.582) -- 0:00:07
879500 -- (-587.303) [-586.742] (-590.053) (-587.123) * (-589.669) (-587.275) (-590.850) [-589.581] -- 0:00:07
880000 -- (-587.395) [-587.413] (-589.610) (-588.160) * (-587.003) [-589.380] (-588.285) (-595.225) -- 0:00:07
Average standard deviation of split frequencies: 0.007672
880500 -- (-589.616) (-588.813) (-588.025) [-588.328] * (-587.285) (-592.614) (-587.227) [-588.500] -- 0:00:07
881000 -- (-591.690) (-587.575) (-589.103) [-591.324] * [-586.647] (-592.611) (-588.914) (-587.505) -- 0:00:07
881500 -- [-593.044] (-586.975) (-588.705) (-588.185) * (-588.687) (-587.366) (-588.661) [-587.175] -- 0:00:07
882000 -- (-588.885) (-587.336) [-587.461] (-588.074) * (-591.794) (-588.995) [-587.756] (-588.907) -- 0:00:07
882500 -- (-586.559) (-588.692) [-587.675] (-587.184) * (-588.393) (-589.073) [-586.825] (-590.383) -- 0:00:07
883000 -- (-592.600) (-590.561) [-589.125] (-587.497) * (-591.924) (-590.629) (-588.601) [-589.107] -- 0:00:07
883500 -- (-589.460) [-590.060] (-589.764) (-589.049) * [-592.808] (-588.530) (-587.420) (-587.959) -- 0:00:06
884000 -- (-590.219) [-588.230] (-592.240) (-590.700) * [-588.904] (-589.094) (-588.394) (-588.467) -- 0:00:06
884500 -- (-588.892) [-587.928] (-592.831) (-588.372) * [-588.382] (-589.706) (-588.664) (-587.170) -- 0:00:06
885000 -- [-591.675] (-589.039) (-589.370) (-588.790) * (-587.501) (-587.741) (-590.953) [-587.397] -- 0:00:06
Average standard deviation of split frequencies: 0.007307
885500 -- (-588.076) (-588.631) (-587.149) [-587.176] * (-586.594) [-588.949] (-597.418) (-588.151) -- 0:00:06
886000 -- (-589.153) (-586.998) (-587.490) [-587.550] * (-588.309) [-587.249] (-589.937) (-587.083) -- 0:00:06
886500 -- (-589.285) (-586.299) [-589.480] (-588.886) * (-587.043) [-588.154] (-591.510) (-587.783) -- 0:00:06
887000 -- (-587.756) (-587.793) [-588.495] (-587.052) * (-592.077) [-587.913] (-594.354) (-592.971) -- 0:00:06
887500 -- [-588.904] (-591.908) (-588.248) (-589.884) * (-586.624) (-586.965) [-589.863] (-590.597) -- 0:00:06
888000 -- (-587.323) (-589.734) (-588.504) [-589.820] * (-588.035) (-588.073) [-587.342] (-589.896) -- 0:00:06
888500 -- (-589.067) (-587.925) [-590.469] (-586.925) * (-588.620) [-587.728] (-587.803) (-586.339) -- 0:00:06
889000 -- (-591.612) [-589.329] (-588.578) (-587.736) * (-589.250) (-587.494) [-588.448] (-588.489) -- 0:00:06
889500 -- (-589.087) (-589.881) [-589.238] (-588.353) * [-587.100] (-593.238) (-586.848) (-589.189) -- 0:00:06
890000 -- [-590.913] (-589.105) (-589.580) (-587.598) * [-589.788] (-590.647) (-587.544) (-588.259) -- 0:00:06
Average standard deviation of split frequencies: 0.007692
890500 -- (-588.586) (-588.665) [-592.286] (-589.512) * (-590.534) (-589.623) [-587.495] (-587.780) -- 0:00:06
891000 -- (-587.804) (-589.558) (-587.386) [-587.632] * [-592.553] (-587.039) (-587.179) (-588.391) -- 0:00:06
891500 -- (-588.737) (-588.092) [-588.141] (-588.864) * (-597.528) (-588.283) (-588.629) [-587.609] -- 0:00:06
892000 -- (-586.942) (-592.612) [-589.405] (-588.788) * (-592.559) (-586.350) (-588.550) [-587.055] -- 0:00:06
892500 -- [-586.784] (-592.519) (-588.880) (-588.429) * [-596.577] (-588.687) (-591.328) (-591.934) -- 0:00:06
893000 -- (-588.200) (-589.574) (-590.483) [-586.406] * (-591.701) (-589.652) [-586.694] (-586.431) -- 0:00:06
893500 -- (-587.841) (-589.426) [-588.369] (-588.927) * (-587.477) [-586.472] (-587.955) (-590.017) -- 0:00:06
894000 -- (-590.404) (-590.492) [-590.984] (-587.414) * [-590.075] (-587.134) (-588.274) (-600.427) -- 0:00:06
894500 -- (-591.511) (-590.603) (-591.623) [-590.493] * (-587.585) [-588.180] (-587.529) (-591.094) -- 0:00:06
895000 -- (-587.643) [-586.886] (-588.246) (-589.180) * (-587.455) (-588.953) [-589.344] (-591.944) -- 0:00:06
Average standard deviation of split frequencies: 0.007401
895500 -- (-590.597) (-590.008) (-587.157) [-589.813] * (-587.699) (-590.046) (-588.518) [-587.879] -- 0:00:06
896000 -- (-594.844) (-590.653) [-587.316] (-590.013) * [-588.629] (-587.855) (-591.004) (-591.029) -- 0:00:06
896500 -- (-588.586) (-589.968) [-589.032] (-588.912) * (-589.452) (-586.115) (-588.255) [-588.619] -- 0:00:06
897000 -- (-586.673) (-587.256) [-588.696] (-587.672) * (-589.443) (-589.017) (-588.088) [-587.940] -- 0:00:06
897500 -- [-590.558] (-586.833) (-587.430) (-588.060) * (-589.895) (-586.947) [-587.976] (-593.700) -- 0:00:06
898000 -- (-588.132) (-587.331) (-587.463) [-591.061] * (-592.453) (-588.163) (-587.704) [-593.422] -- 0:00:06
898500 -- (-591.240) (-589.752) (-589.620) [-587.952] * [-589.334] (-589.573) (-588.156) (-591.797) -- 0:00:06
899000 -- [-588.328] (-590.375) (-588.182) (-589.796) * (-586.910) [-588.736] (-588.434) (-592.484) -- 0:00:06
899500 -- (-588.421) [-589.893] (-587.426) (-587.066) * [-587.984] (-589.192) (-587.530) (-595.691) -- 0:00:06
900000 -- (-586.932) [-586.069] (-587.738) (-588.846) * (-586.220) [-587.663] (-590.130) (-593.887) -- 0:00:06
Average standard deviation of split frequencies: 0.007362
900500 -- (-587.147) (-588.151) (-586.923) [-587.383] * [-586.087] (-587.522) (-590.913) (-590.902) -- 0:00:05
901000 -- [-587.834] (-587.736) (-587.598) (-588.389) * (-586.408) [-588.121] (-590.454) (-587.341) -- 0:00:05
901500 -- [-590.360] (-589.191) (-587.329) (-590.305) * (-586.562) (-588.627) [-588.614] (-586.882) -- 0:00:05
902000 -- [-588.431] (-590.713) (-589.479) (-587.576) * (-587.686) (-589.807) (-590.555) [-587.244] -- 0:00:05
902500 -- (-590.530) [-592.848] (-588.413) (-590.354) * (-588.539) (-588.678) [-587.896] (-586.865) -- 0:00:05
903000 -- [-589.131] (-588.921) (-588.473) (-587.871) * (-588.630) (-588.944) [-587.803] (-588.671) -- 0:00:05
903500 -- (-590.078) [-588.222] (-588.595) (-588.772) * (-587.393) [-590.497] (-587.109) (-589.078) -- 0:00:05
904000 -- [-590.347] (-587.496) (-588.376) (-587.460) * (-588.258) [-589.400] (-587.529) (-589.681) -- 0:00:05
904500 -- (-587.985) [-587.524] (-592.224) (-588.903) * (-589.999) (-590.482) (-586.593) [-588.668] -- 0:00:05
905000 -- (-588.320) [-587.108] (-587.438) (-595.268) * (-586.802) (-590.984) (-587.853) [-587.974] -- 0:00:05
Average standard deviation of split frequencies: 0.007562
905500 -- [-591.047] (-588.753) (-589.002) (-590.022) * [-589.079] (-586.969) (-587.612) (-589.560) -- 0:00:05
906000 -- (-587.480) [-588.890] (-593.427) (-587.503) * (-590.710) (-588.337) [-586.963] (-592.258) -- 0:00:05
906500 -- (-587.591) (-589.546) (-591.164) [-587.792] * (-587.656) (-588.378) [-588.135] (-587.542) -- 0:00:05
907000 -- (-586.850) [-589.060] (-588.921) (-588.019) * (-587.436) [-588.052] (-587.950) (-587.202) -- 0:00:05
907500 -- (-587.792) (-588.497) (-590.254) [-589.071] * [-587.193] (-588.828) (-587.001) (-587.057) -- 0:00:05
908000 -- (-587.777) (-587.334) [-586.791] (-587.074) * (-589.664) (-586.889) (-588.282) [-587.205] -- 0:00:05
908500 -- (-587.567) [-590.966] (-587.083) (-589.374) * (-588.173) (-588.650) [-589.994] (-588.188) -- 0:00:05
909000 -- [-587.753] (-587.423) (-587.800) (-593.290) * (-588.608) (-588.010) (-597.896) [-591.903] -- 0:00:05
909500 -- (-592.396) [-587.638] (-590.848) (-588.907) * (-592.390) (-588.872) [-596.032] (-588.809) -- 0:00:05
910000 -- [-591.956] (-591.035) (-589.328) (-586.987) * (-590.853) [-591.672] (-591.099) (-587.710) -- 0:00:05
Average standard deviation of split frequencies: 0.007730
910500 -- [-587.490] (-587.949) (-588.136) (-587.017) * (-586.657) [-590.637] (-589.521) (-589.020) -- 0:00:05
911000 -- (-589.482) [-589.139] (-587.611) (-588.121) * [-590.611] (-589.509) (-591.008) (-589.992) -- 0:00:05
911500 -- (-586.940) (-587.725) (-587.502) [-587.168] * (-589.281) (-588.769) (-591.284) [-589.202] -- 0:00:05
912000 -- (-586.774) [-588.895] (-588.838) (-587.631) * [-592.877] (-586.993) (-591.931) (-591.408) -- 0:00:05
912500 -- (-590.737) [-589.899] (-588.156) (-589.672) * (-588.399) (-588.643) [-586.825] (-587.981) -- 0:00:05
913000 -- (-586.478) [-587.558] (-587.890) (-587.855) * (-586.390) (-586.782) (-588.592) [-588.291] -- 0:00:05
913500 -- (-590.574) (-589.370) [-589.040] (-586.829) * (-589.766) (-586.279) [-590.533] (-588.538) -- 0:00:05
914000 -- (-588.751) [-588.563] (-590.848) (-586.876) * (-588.896) (-587.796) (-587.322) [-588.088] -- 0:00:05
914500 -- [-589.032] (-587.963) (-588.633) (-587.782) * (-587.275) (-589.712) (-586.840) [-588.831] -- 0:00:05
915000 -- (-588.872) [-587.210] (-589.961) (-588.533) * (-588.962) (-587.465) (-590.108) [-588.169] -- 0:00:05
Average standard deviation of split frequencies: 0.007822
915500 -- [-587.612] (-587.485) (-587.032) (-588.791) * (-589.637) [-589.841] (-589.976) (-588.459) -- 0:00:05
916000 -- (-586.650) (-587.534) [-587.963] (-589.515) * (-587.946) (-591.141) [-587.945] (-587.470) -- 0:00:05
916500 -- (-592.254) (-589.445) (-589.191) [-591.297] * (-588.885) (-590.611) [-591.844] (-588.315) -- 0:00:05
917000 -- (-587.700) (-586.910) (-590.894) [-586.711] * [-587.128] (-588.171) (-586.561) (-589.496) -- 0:00:04
917500 -- (-589.484) (-588.429) (-587.362) [-589.065] * (-586.920) [-589.819] (-589.846) (-588.535) -- 0:00:04
918000 -- (-589.138) [-587.380] (-588.931) (-588.736) * (-588.607) (-588.408) [-588.492] (-586.652) -- 0:00:04
918500 -- [-587.934] (-586.924) (-587.701) (-590.356) * (-594.156) [-590.547] (-590.473) (-587.535) -- 0:00:04
919000 -- [-587.033] (-589.387) (-588.335) (-589.505) * (-590.189) (-587.704) (-588.425) [-587.430] -- 0:00:04
919500 -- (-587.846) [-590.849] (-589.248) (-588.589) * (-588.285) [-588.170] (-591.277) (-588.092) -- 0:00:04
920000 -- (-589.547) (-587.804) (-592.458) [-590.931] * (-587.748) (-589.535) [-590.823] (-592.383) -- 0:00:04
Average standard deviation of split frequencies: 0.007817
920500 -- (-591.260) [-591.439] (-587.926) (-586.676) * (-586.791) (-588.634) (-590.676) [-591.783] -- 0:00:04
921000 -- (-589.479) [-588.902] (-589.270) (-589.220) * (-587.529) (-590.489) [-588.727] (-587.166) -- 0:00:04
921500 -- (-593.446) (-586.956) [-587.085] (-590.013) * [-587.633] (-587.963) (-587.470) (-588.895) -- 0:00:04
922000 -- (-590.024) [-587.230] (-589.326) (-590.373) * (-588.567) (-588.611) (-587.218) [-590.204] -- 0:00:04
922500 -- [-591.834] (-592.758) (-586.667) (-590.764) * [-587.093] (-588.324) (-588.813) (-592.573) -- 0:00:04
923000 -- (-589.705) [-591.067] (-587.608) (-586.834) * [-586.713] (-588.194) (-588.747) (-593.187) -- 0:00:04
923500 -- (-590.807) (-588.327) [-588.236] (-589.227) * (-586.728) [-589.018] (-587.593) (-588.039) -- 0:00:04
924000 -- (-587.798) (-589.337) [-587.540] (-587.722) * [-587.282] (-591.183) (-589.887) (-589.574) -- 0:00:04
924500 -- (-589.597) (-588.926) (-587.277) [-586.558] * [-587.209] (-589.049) (-588.851) (-591.280) -- 0:00:04
925000 -- (-590.366) (-586.395) [-587.359] (-588.058) * (-589.144) [-587.682] (-589.953) (-586.912) -- 0:00:04
Average standard deviation of split frequencies: 0.007732
925500 -- (-590.090) [-587.269] (-587.984) (-589.309) * [-590.012] (-588.336) (-589.086) (-587.806) -- 0:00:04
926000 -- (-592.923) (-589.490) (-589.056) [-591.549] * (-588.757) [-587.689] (-590.273) (-586.334) -- 0:00:04
926500 -- (-589.570) (-587.712) [-592.501] (-590.828) * (-586.356) (-588.018) [-586.528] (-591.309) -- 0:00:04
927000 -- [-588.866] (-588.123) (-588.393) (-587.226) * (-590.374) [-588.985] (-586.451) (-595.111) -- 0:00:04
927500 -- (-590.489) (-587.412) (-589.671) [-587.790] * (-588.596) (-588.552) (-586.424) [-589.026] -- 0:00:04
928000 -- (-586.829) [-590.445] (-588.377) (-593.860) * [-586.675] (-587.732) (-590.413) (-589.647) -- 0:00:04
928500 -- (-586.863) (-589.535) [-586.706] (-592.583) * (-586.757) (-586.386) [-592.546] (-586.950) -- 0:00:04
929000 -- [-586.827] (-588.126) (-587.131) (-588.745) * (-586.627) (-590.217) (-587.990) [-587.470] -- 0:00:04
929500 -- (-586.896) [-587.348] (-599.767) (-587.690) * (-586.907) (-587.493) (-588.616) [-587.392] -- 0:00:04
930000 -- (-586.713) [-587.745] (-587.603) (-588.518) * (-586.239) (-589.342) [-591.212] (-589.881) -- 0:00:04
Average standard deviation of split frequencies: 0.007598
930500 -- (-589.627) (-587.991) (-587.319) [-587.493] * (-586.882) (-589.003) [-590.937] (-589.992) -- 0:00:04
931000 -- (-589.013) (-589.290) (-587.634) [-589.409] * [-589.305] (-587.590) (-590.323) (-587.857) -- 0:00:04
931500 -- (-587.874) (-588.619) [-588.005] (-589.745) * (-590.706) [-588.499] (-593.372) (-587.914) -- 0:00:04
932000 -- (-588.916) [-586.768] (-587.128) (-591.856) * [-586.985] (-588.147) (-589.294) (-588.398) -- 0:00:04
932500 -- (-590.635) (-588.502) (-587.720) [-588.068] * (-592.931) (-592.132) (-593.043) [-586.371] -- 0:00:04
933000 -- (-590.032) (-591.860) [-589.614] (-590.811) * (-588.278) [-590.846] (-590.288) (-587.019) -- 0:00:04
933500 -- (-587.942) (-590.599) [-588.988] (-587.496) * [-586.390] (-586.840) (-589.888) (-590.387) -- 0:00:03
934000 -- (-591.826) [-589.543] (-587.609) (-586.339) * (-590.076) (-586.349) (-589.578) [-591.523] -- 0:00:03
934500 -- (-588.854) (-586.939) (-586.678) [-594.778] * (-590.758) (-586.278) [-588.995] (-587.506) -- 0:00:03
935000 -- [-588.899] (-590.156) (-587.663) (-590.502) * (-589.209) [-587.094] (-587.915) (-587.209) -- 0:00:03
Average standard deviation of split frequencies: 0.007995
935500 -- (-588.743) [-591.120] (-590.928) (-591.568) * (-588.477) [-588.683] (-588.826) (-586.746) -- 0:00:03
936000 -- (-592.868) [-589.499] (-590.363) (-587.440) * (-588.864) (-589.422) (-586.319) [-586.394] -- 0:00:03
936500 -- (-600.565) (-588.091) [-589.316] (-590.107) * (-592.788) (-590.637) (-588.733) [-586.249] -- 0:00:03
937000 -- (-594.629) (-587.953) (-590.319) [-588.041] * (-589.714) (-593.197) (-589.595) [-586.900] -- 0:00:03
937500 -- (-586.637) (-593.776) [-591.692] (-591.361) * (-588.217) (-591.115) [-589.050] (-588.660) -- 0:00:03
938000 -- (-588.006) [-588.401] (-589.305) (-589.812) * (-586.986) (-591.304) [-589.849] (-588.308) -- 0:00:03
938500 -- (-587.534) (-588.080) [-587.529] (-588.003) * (-588.385) (-595.202) (-589.975) [-589.270] -- 0:00:03
939000 -- (-590.123) [-588.235] (-588.318) (-592.746) * (-589.199) [-588.846] (-590.176) (-588.034) -- 0:00:03
939500 -- (-587.656) [-590.529] (-588.183) (-588.287) * (-591.271) [-587.378] (-587.436) (-586.955) -- 0:00:03
940000 -- [-588.259] (-586.935) (-586.971) (-587.637) * [-589.420] (-587.060) (-587.108) (-586.967) -- 0:00:03
Average standard deviation of split frequencies: 0.007862
940500 -- (-587.003) (-589.766) (-587.888) [-589.676] * (-588.664) [-590.188] (-588.364) (-587.629) -- 0:00:03
941000 -- (-586.694) (-589.388) [-587.781] (-590.723) * (-587.356) (-589.421) (-587.802) [-590.289] -- 0:00:03
941500 -- (-586.181) (-587.350) [-589.786] (-596.505) * (-588.139) (-588.762) [-586.339] (-586.752) -- 0:00:03
942000 -- (-587.063) [-589.597] (-587.805) (-587.893) * (-587.686) (-589.396) (-588.798) [-586.915] -- 0:00:03
942500 -- (-587.083) (-588.575) (-587.770) [-587.507] * (-590.695) [-588.134] (-591.353) (-588.349) -- 0:00:03
943000 -- (-589.195) (-587.241) [-587.606] (-588.219) * (-586.430) [-587.350] (-592.482) (-586.983) -- 0:00:03
943500 -- (-587.567) (-589.453) [-587.793] (-588.805) * (-587.946) [-588.399] (-590.233) (-589.366) -- 0:00:03
944000 -- (-591.140) (-587.224) (-589.112) [-589.759] * (-588.722) [-586.857] (-586.880) (-588.192) -- 0:00:03
944500 -- (-590.983) (-591.202) [-589.105] (-587.378) * (-593.324) (-588.212) [-587.046] (-586.947) -- 0:00:03
945000 -- [-589.241] (-589.629) (-587.441) (-587.545) * (-591.901) [-587.490] (-588.374) (-587.701) -- 0:00:03
Average standard deviation of split frequencies: 0.007942
945500 -- (-587.737) [-589.431] (-588.165) (-590.475) * (-588.307) (-587.957) [-588.364] (-589.716) -- 0:00:03
946000 -- (-590.894) (-587.445) [-588.091] (-588.020) * [-587.399] (-588.100) (-587.299) (-588.755) -- 0:00:03
946500 -- (-586.879) (-587.059) [-589.075] (-588.823) * (-588.776) (-588.828) [-586.789] (-589.204) -- 0:00:03
947000 -- (-586.582) [-586.886] (-590.134) (-586.674) * (-589.013) [-588.217] (-587.805) (-587.793) -- 0:00:03
947500 -- (-586.624) (-590.364) (-587.388) [-586.425] * (-587.969) [-589.049] (-587.689) (-589.527) -- 0:00:03
948000 -- (-586.976) (-590.437) (-591.048) [-588.135] * (-587.754) (-589.893) [-587.892] (-589.202) -- 0:00:03
948500 -- (-587.750) [-590.531] (-586.773) (-586.850) * (-587.574) (-595.287) [-589.690] (-592.204) -- 0:00:03
949000 -- (-589.640) [-588.341] (-587.768) (-590.577) * (-589.134) (-589.196) (-587.864) [-589.261] -- 0:00:03
949500 -- (-590.677) (-587.691) [-588.748] (-589.904) * [-588.052] (-592.118) (-587.372) (-587.665) -- 0:00:03
950000 -- (-589.280) (-588.717) [-587.016] (-591.906) * (-588.145) (-588.835) [-586.302] (-587.682) -- 0:00:03
Average standard deviation of split frequencies: 0.008231
950500 -- (-588.983) (-586.783) (-588.030) [-588.300] * (-587.970) (-587.134) (-587.621) [-590.479] -- 0:00:02
951000 -- [-588.970] (-588.738) (-590.602) (-592.585) * (-588.131) [-589.081] (-586.698) (-588.210) -- 0:00:02
951500 -- (-590.120) (-587.684) [-587.389] (-586.384) * (-586.963) (-589.926) [-587.408] (-586.291) -- 0:00:02
952000 -- (-592.454) (-591.151) [-588.881] (-587.212) * (-589.057) (-588.378) (-586.686) [-586.527] -- 0:00:02
952500 -- (-588.438) (-591.235) [-587.122] (-589.456) * [-593.540] (-591.203) (-589.071) (-587.271) -- 0:00:02
953000 -- (-589.518) (-587.997) (-591.634) [-591.480] * (-588.778) [-589.614] (-589.376) (-590.083) -- 0:00:02
953500 -- [-588.920] (-592.209) (-592.595) (-589.174) * (-586.449) [-588.150] (-587.729) (-588.824) -- 0:00:02
954000 -- [-590.908] (-588.979) (-588.820) (-595.955) * [-586.842] (-593.627) (-589.867) (-590.662) -- 0:00:02
954500 -- (-591.032) [-590.224] (-589.959) (-587.730) * [-588.754] (-592.945) (-590.669) (-588.075) -- 0:00:02
955000 -- (-587.540) (-588.611) (-586.881) [-587.722] * (-592.188) (-593.817) (-588.028) [-587.360] -- 0:00:02
Average standard deviation of split frequencies: 0.007922
955500 -- (-586.671) (-591.023) [-588.423] (-586.948) * (-591.821) [-588.240] (-586.749) (-587.519) -- 0:00:02
956000 -- (-593.801) [-587.686] (-590.960) (-587.017) * (-591.575) (-591.985) (-586.290) [-588.534] -- 0:00:02
956500 -- (-589.193) (-589.859) (-589.598) [-588.419] * (-588.847) (-589.370) (-587.712) [-588.609] -- 0:00:02
957000 -- (-589.025) (-589.410) (-588.323) [-588.566] * (-588.587) (-588.592) (-588.033) [-589.469] -- 0:00:02
957500 -- [-588.714] (-593.311) (-589.923) (-589.141) * [-588.141] (-589.843) (-589.984) (-586.362) -- 0:00:02
958000 -- (-591.276) (-587.698) (-588.118) [-589.055] * (-588.471) (-588.899) (-587.731) [-586.870] -- 0:00:02
958500 -- (-588.699) (-588.835) [-590.020] (-589.144) * (-589.127) (-590.140) (-587.647) [-587.215] -- 0:00:02
959000 -- [-588.894] (-592.497) (-589.398) (-589.721) * (-590.547) [-588.305] (-587.872) (-590.893) -- 0:00:02
959500 -- (-588.675) (-587.036) (-588.565) [-590.009] * (-587.782) [-590.412] (-587.585) (-587.155) -- 0:00:02
960000 -- [-589.759] (-586.395) (-592.134) (-590.075) * (-587.446) (-587.058) (-587.088) [-590.403] -- 0:00:02
Average standard deviation of split frequencies: 0.008375
960500 -- (-589.496) (-586.373) [-587.090] (-588.236) * [-587.105] (-591.963) (-587.177) (-587.708) -- 0:00:02
961000 -- (-592.211) (-587.774) [-588.534] (-588.391) * (-594.016) (-590.594) (-589.929) [-588.217] -- 0:00:02
961500 -- (-593.844) [-588.488] (-588.088) (-588.096) * [-590.575] (-595.073) (-586.739) (-589.504) -- 0:00:02
962000 -- (-589.648) (-587.735) [-588.527] (-589.532) * (-591.684) (-589.114) [-587.799] (-588.330) -- 0:00:02
962500 -- (-586.616) (-586.839) (-586.441) [-587.618] * (-589.857) (-586.783) (-587.757) [-589.555] -- 0:00:02
963000 -- [-586.683] (-588.349) (-587.050) (-589.298) * (-588.707) (-587.703) [-590.393] (-590.332) -- 0:00:02
963500 -- (-587.838) (-587.209) [-586.943] (-587.283) * [-588.085] (-590.877) (-592.032) (-588.655) -- 0:00:02
964000 -- (-586.708) [-588.377] (-587.245) (-589.809) * (-587.702) [-588.452] (-588.164) (-587.661) -- 0:00:02
964500 -- (-588.061) (-589.367) (-590.986) [-589.057] * (-586.951) (-593.200) [-589.003] (-586.882) -- 0:00:02
965000 -- (-589.502) (-592.309) [-589.716] (-586.777) * (-587.744) (-587.018) (-589.160) [-586.766] -- 0:00:02
Average standard deviation of split frequencies: 0.008328
965500 -- (-588.249) (-588.153) [-588.079] (-587.899) * [-588.979] (-589.660) (-590.478) (-587.769) -- 0:00:02
966000 -- (-588.750) (-588.547) [-587.072] (-591.014) * (-588.061) (-591.670) (-588.390) [-588.730] -- 0:00:02
966500 -- (-594.535) [-588.083] (-591.264) (-588.990) * (-587.422) [-588.259] (-589.823) (-588.508) -- 0:00:02
967000 -- (-586.829) (-586.785) [-591.149] (-590.595) * (-589.322) [-589.385] (-587.173) (-590.063) -- 0:00:01
967500 -- [-591.358] (-587.322) (-595.285) (-586.946) * [-588.097] (-587.491) (-587.753) (-590.165) -- 0:00:01
968000 -- (-589.596) (-590.434) [-588.470] (-588.599) * (-593.743) (-588.699) [-590.918] (-593.091) -- 0:00:01
968500 -- (-587.263) (-590.056) [-590.301] (-588.148) * (-590.904) [-588.101] (-593.475) (-590.790) -- 0:00:01
969000 -- (-588.076) (-588.657) [-586.879] (-594.596) * (-588.888) (-588.867) [-589.623] (-597.155) -- 0:00:01
969500 -- (-589.016) [-592.021] (-588.688) (-591.384) * (-592.468) [-590.284] (-590.378) (-590.221) -- 0:00:01
970000 -- (-588.129) (-588.566) [-588.110] (-588.845) * (-591.549) (-589.322) (-587.097) [-590.420] -- 0:00:01
Average standard deviation of split frequencies: 0.008029
970500 -- (-586.522) (-589.300) (-588.182) [-589.766] * (-589.712) (-590.315) (-588.399) [-589.098] -- 0:00:01
971000 -- (-588.426) (-589.187) [-588.324] (-589.861) * (-590.078) [-588.674] (-587.672) (-589.595) -- 0:00:01
971500 -- (-592.584) [-590.598] (-590.973) (-589.656) * (-591.756) (-590.133) [-586.667] (-589.280) -- 0:00:01
972000 -- (-590.512) (-588.188) [-588.620] (-588.311) * (-586.980) [-590.832] (-587.881) (-588.218) -- 0:00:01
972500 -- (-589.259) (-589.648) [-588.565] (-590.584) * (-587.063) (-588.570) (-587.748) [-586.649] -- 0:00:01
973000 -- [-587.118] (-588.953) (-588.887) (-588.174) * [-586.610] (-587.635) (-586.673) (-588.473) -- 0:00:01
973500 -- (-593.019) [-588.416] (-590.466) (-588.833) * (-593.400) [-594.939] (-587.526) (-592.889) -- 0:00:01
974000 -- (-594.783) [-594.244] (-586.914) (-589.552) * (-588.114) (-590.396) [-587.534] (-588.534) -- 0:00:01
974500 -- (-591.221) (-592.041) [-587.010] (-587.166) * [-588.416] (-591.225) (-589.421) (-587.828) -- 0:00:01
975000 -- (-587.307) (-587.905) [-587.002] (-588.659) * [-587.565] (-592.257) (-587.315) (-589.156) -- 0:00:01
Average standard deviation of split frequencies: 0.007760
975500 -- (-586.926) (-588.249) (-592.649) [-589.121] * (-591.294) [-589.165] (-589.869) (-589.819) -- 0:00:01
976000 -- (-593.566) (-587.170) [-588.793] (-589.615) * [-588.423] (-587.068) (-588.487) (-589.193) -- 0:00:01
976500 -- (-589.221) [-589.315] (-588.829) (-590.071) * (-588.005) (-590.018) [-587.792] (-589.660) -- 0:00:01
977000 -- (-590.656) (-588.302) [-587.972] (-591.741) * (-587.056) [-586.307] (-593.971) (-586.438) -- 0:00:01
977500 -- (-587.609) [-588.854] (-591.942) (-587.992) * [-587.321] (-587.858) (-591.158) (-587.435) -- 0:00:01
978000 -- (-589.713) (-588.239) [-588.762] (-589.121) * (-590.157) (-587.552) (-586.971) [-586.933] -- 0:00:01
978500 -- (-589.290) (-588.411) (-589.080) [-590.050] * (-588.550) (-587.034) (-587.222) [-590.333] -- 0:00:01
979000 -- (-587.614) (-591.360) (-588.595) [-590.131] * (-588.583) (-588.107) [-587.868] (-587.536) -- 0:00:01
979500 -- [-586.617] (-591.153) (-592.936) (-589.656) * (-586.456) (-592.037) [-587.237] (-589.495) -- 0:00:01
980000 -- [-588.163] (-591.835) (-592.187) (-588.232) * [-588.435] (-589.895) (-586.905) (-591.584) -- 0:00:01
Average standard deviation of split frequencies: 0.007499
980500 -- (-589.156) (-591.955) (-588.126) [-589.942] * (-587.781) (-591.507) [-586.953] (-587.518) -- 0:00:01
981000 -- (-586.365) [-590.307] (-587.551) (-587.012) * (-589.166) (-591.257) (-587.395) [-590.196] -- 0:00:01
981500 -- [-586.565] (-591.008) (-589.950) (-589.966) * (-589.583) [-593.304] (-586.580) (-594.261) -- 0:00:01
982000 -- (-590.097) (-593.028) (-588.274) [-589.520] * [-587.239] (-587.101) (-588.257) (-587.284) -- 0:00:01
982500 -- (-587.453) (-587.665) (-588.041) [-587.897] * (-587.280) (-589.937) [-587.359] (-587.584) -- 0:00:01
983000 -- (-590.694) (-587.734) [-587.406] (-587.547) * (-587.794) (-588.522) (-591.820) [-587.941] -- 0:00:01
983500 -- (-588.732) (-587.311) [-587.895] (-587.875) * [-587.650] (-588.882) (-596.386) (-587.698) -- 0:00:00
984000 -- [-586.591] (-590.744) (-589.749) (-588.137) * (-590.200) [-590.865] (-589.249) (-588.540) -- 0:00:00
984500 -- (-587.182) (-587.586) [-590.572] (-591.786) * (-587.496) (-588.686) (-589.240) [-589.240] -- 0:00:00
985000 -- (-587.265) (-589.631) (-588.473) [-586.738] * (-587.278) (-588.201) [-588.718] (-587.109) -- 0:00:00
Average standard deviation of split frequencies: 0.007171
985500 -- (-588.586) [-589.432] (-587.628) (-586.442) * (-587.921) [-586.410] (-588.768) (-589.394) -- 0:00:00
986000 -- (-589.705) (-590.806) (-587.910) [-589.942] * [-588.125] (-586.243) (-587.665) (-588.292) -- 0:00:00
986500 -- (-589.169) (-589.391) [-586.782] (-587.957) * (-588.429) (-586.589) (-587.325) [-589.148] -- 0:00:00
987000 -- (-587.160) (-588.605) (-586.239) [-589.591] * (-588.591) [-586.660] (-587.038) (-590.246) -- 0:00:00
987500 -- [-590.249] (-588.839) (-586.722) (-592.417) * (-593.182) (-588.772) [-587.038] (-586.518) -- 0:00:00
988000 -- (-590.994) (-588.308) (-587.203) [-590.459] * (-591.750) [-586.837] (-588.910) (-588.004) -- 0:00:00
988500 -- (-586.730) (-589.074) [-587.410] (-590.244) * (-591.666) (-587.081) (-589.718) [-587.506] -- 0:00:00
989000 -- (-587.651) (-587.885) (-592.014) [-590.000] * (-592.826) [-587.972] (-590.674) (-589.102) -- 0:00:00
989500 -- (-588.871) [-586.580] (-592.340) (-587.382) * (-586.854) (-589.643) [-587.130] (-587.944) -- 0:00:00
990000 -- [-589.021] (-589.148) (-586.964) (-588.199) * [-587.554] (-586.720) (-587.268) (-589.491) -- 0:00:00
Average standard deviation of split frequencies: 0.007201
990500 -- (-586.215) (-590.408) [-586.517] (-586.630) * (-586.346) (-586.273) [-587.386] (-589.086) -- 0:00:00
991000 -- (-586.223) (-588.645) [-587.597] (-588.353) * [-586.391] (-587.656) (-587.442) (-589.427) -- 0:00:00
991500 -- (-587.932) (-587.918) [-586.365] (-587.154) * [-586.451] (-589.469) (-589.263) (-589.591) -- 0:00:00
992000 -- [-588.251] (-591.610) (-586.478) (-588.488) * (-588.224) (-593.039) [-588.116] (-587.449) -- 0:00:00
992500 -- (-588.829) (-592.002) [-587.341] (-593.169) * [-586.608] (-589.866) (-590.963) (-588.038) -- 0:00:00
993000 -- (-588.400) (-587.982) [-587.794] (-587.763) * (-586.768) (-591.078) (-587.697) [-587.668] -- 0:00:00
993500 -- (-589.009) [-586.872] (-588.051) (-592.198) * (-587.021) [-587.743] (-587.600) (-589.184) -- 0:00:00
994000 -- [-598.909] (-592.549) (-587.197) (-593.000) * (-588.700) [-588.142] (-589.522) (-593.644) -- 0:00:00
994500 -- (-589.207) (-587.576) (-590.193) [-587.221] * [-587.441] (-589.118) (-591.634) (-586.584) -- 0:00:00
995000 -- (-590.803) (-586.706) [-592.498] (-588.229) * [-587.982] (-588.881) (-590.240) (-586.230) -- 0:00:00
Average standard deviation of split frequencies: 0.007068
995500 -- (-587.166) (-588.132) [-589.553] (-588.404) * (-591.810) (-587.292) [-589.170] (-587.860) -- 0:00:00
996000 -- [-588.828] (-587.188) (-587.215) (-587.953) * [-588.502] (-589.782) (-590.738) (-591.468) -- 0:00:00
996500 -- (-587.525) [-588.071] (-587.561) (-589.244) * [-587.294] (-588.741) (-588.622) (-588.751) -- 0:00:00
997000 -- (-587.735) (-591.313) [-586.584] (-586.629) * (-586.843) (-589.402) [-588.950] (-588.743) -- 0:00:00
997500 -- (-586.400) (-592.865) [-588.598] (-587.238) * (-589.960) [-587.566] (-591.477) (-587.121) -- 0:00:00
998000 -- (-588.630) (-595.176) [-588.170] (-587.972) * (-587.684) (-587.098) [-589.041] (-587.083) -- 0:00:00
998500 -- [-587.275] (-592.177) (-591.539) (-587.738) * (-586.480) (-588.175) (-588.447) [-586.496] -- 0:00:00
999000 -- [-588.411] (-591.265) (-589.881) (-592.301) * [-587.449] (-587.959) (-592.537) (-586.746) -- 0:00:00
999500 -- (-586.473) (-588.186) [-591.676] (-588.680) * (-586.333) (-588.440) (-587.422) [-587.680] -- 0:00:00
1000000 -- [-588.270] (-587.809) (-588.295) (-587.866) * [-588.230] (-587.025) (-586.966) (-588.035) -- 0:00:00
Average standard deviation of split frequencies: 0.007192
Analysis completed in 60 seconds
Analysis used 58.51 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -586.01
Likelihood of best state for "cold" chain of run 2 was -586.01
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 70 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
34.4 % ( 27 %) Dirichlet(Pi{all})
34.0 % ( 29 %) Slider(Pi{all})
78.6 % ( 61 %) Multiplier(Alpha{1,2})
77.6 % ( 58 %) Multiplier(Alpha{3})
24.4 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.8 % ( 58 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
33.7 % ( 31 %) Dirichlet(Pi{all})
33.8 % ( 21 %) Slider(Pi{all})
78.2 % ( 49 %) Multiplier(Alpha{1,2})
78.0 % ( 49 %) Multiplier(Alpha{3})
23.9 % ( 33 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166145 0.82 0.67
3 | 166451 166892 0.84
4 | 166935 167250 166327
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166695 0.82 0.67
3 | 166075 167234 0.84
4 | 166313 166775 166908
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -587.63
| 1 2|
| 2 1 1 |
| 1 1 1 |
| 2 2 2 22 |
| 1 2 1 2 111 1 2 |
| 2 1 1 1 * 21 *1 22 2 2 2 |
| 1 1 1 2 2 1 1 21 2 2 1 2 |
| 2 1 22 1 1 2 2*1 2 111 1 2 1 |
| 1 1 2 22 21 1 2 12 * |
|1 22 1 2 2 2 1* 11 1|
|2 1 2 2 2 1 |
| 2 1 1 2 2 1 2 |
| 2 1 1 |
| 1 2 1 1 1 2 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -589.41
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -587.74 -591.88
2 -587.76 -591.46
--------------------------------------
TOTAL -587.75 -591.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890302 0.088247 0.330790 1.446417 0.853635 1421.22 1461.11 1.000
r(A<->C){all} 0.162002 0.018816 0.000124 0.435537 0.124249 216.05 217.44 1.000
r(A<->G){all} 0.160506 0.018846 0.000112 0.433472 0.124935 155.94 224.91 1.004
r(A<->T){all} 0.174020 0.019580 0.000025 0.446177 0.139401 203.70 308.54 1.004
r(C<->G){all} 0.155814 0.018042 0.000086 0.419243 0.118661 225.46 245.91 1.000
r(C<->T){all} 0.162538 0.019662 0.000027 0.459295 0.126638 131.76 190.31 1.000
r(G<->T){all} 0.185120 0.021937 0.000018 0.472351 0.154779 161.52 179.70 1.000
pi(A){all} 0.196819 0.000374 0.156531 0.232789 0.196326 1235.98 1241.14 1.000
pi(C){all} 0.274712 0.000441 0.234690 0.316848 0.274759 1310.42 1383.81 1.000
pi(G){all} 0.290598 0.000494 0.249718 0.335884 0.289878 1294.98 1336.70 1.000
pi(T){all} 0.237871 0.000435 0.198349 0.279207 0.237391 1193.33 1242.77 1.000
alpha{1,2} 0.436866 0.233661 0.000193 1.418664 0.270404 989.54 1174.71 1.000
alpha{3} 0.449342 0.224962 0.000294 1.427722 0.293254 1172.76 1275.34 1.000
pinvar{all} 0.996334 0.000020 0.988214 0.999999 0.997733 1282.30 1355.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ...**.
9 -- ..**..
10 -- .**...
11 -- ..****
12 -- ....**
13 -- .*.***
14 -- .*...*
15 -- .*.*..
16 -- ..*..*
17 -- .****.
18 -- .*..*.
19 -- .***.*
20 -- .**.**
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 453 0.150899 0.001413 0.149900 0.151899 2
8 448 0.149234 0.012248 0.140573 0.157895 2
9 447 0.148901 0.003298 0.146569 0.151233 2
10 446 0.148568 0.004711 0.145237 0.151899 2
11 432 0.143904 0.010364 0.136576 0.151233 2
12 426 0.141905 0.000000 0.141905 0.141905 2
13 426 0.141905 0.008480 0.135909 0.147901 2
14 424 0.141239 0.006595 0.136576 0.145903 2
15 424 0.141239 0.000942 0.140573 0.141905 2
16 423 0.140906 0.005182 0.137242 0.144570 2
17 421 0.140240 0.019315 0.126582 0.153897 2
18 420 0.139907 0.007537 0.134577 0.145237 2
19 419 0.139574 0.011777 0.131246 0.147901 2
20 414 0.137908 0.010364 0.130580 0.145237 2
21 412 0.137242 0.005653 0.133245 0.141239 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098422 0.009916 0.000033 0.305232 0.067884 1.001 2
length{all}[2] 0.100454 0.010155 0.000004 0.298123 0.069143 1.000 2
length{all}[3] 0.098944 0.009056 0.000086 0.296305 0.069901 1.000 2
length{all}[4] 0.099918 0.010520 0.000004 0.308572 0.068886 1.001 2
length{all}[5] 0.100178 0.010764 0.000050 0.311105 0.067411 1.000 2
length{all}[6] 0.100079 0.010083 0.000058 0.301164 0.067399 1.000 2
length{all}[7] 0.096294 0.008368 0.000163 0.279428 0.069282 1.001 2
length{all}[8] 0.095304 0.008039 0.000050 0.284503 0.065449 0.998 2
length{all}[9] 0.101246 0.009553 0.000001 0.273882 0.077812 1.002 2
length{all}[10] 0.100154 0.011269 0.000297 0.330287 0.066420 0.998 2
length{all}[11] 0.096245 0.008760 0.000173 0.283791 0.069662 0.998 2
length{all}[12] 0.097592 0.008786 0.000027 0.291098 0.069020 1.006 2
length{all}[13] 0.104578 0.010969 0.000013 0.310401 0.071280 0.998 2
length{all}[14] 0.091994 0.009347 0.000004 0.292679 0.063555 1.000 2
length{all}[15] 0.096039 0.009072 0.000051 0.275849 0.068522 1.021 2
length{all}[16] 0.095244 0.009555 0.000158 0.307330 0.066853 1.000 2
length{all}[17] 0.094929 0.007972 0.000081 0.277807 0.064429 0.998 2
length{all}[18] 0.090253 0.008745 0.000275 0.287954 0.061298 1.000 2
length{all}[19] 0.093406 0.009367 0.000023 0.285442 0.064515 0.999 2
length{all}[20] 0.106661 0.010491 0.000019 0.285767 0.079325 1.005 2
length{all}[21] 0.097739 0.010190 0.000044 0.287108 0.069601 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007192
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.021
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 426
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 142 / 142 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 142 / 142 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067416 0.098252 0.103345 0.086687 0.101368 0.105544 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -633.792228
Iterating by ming2
Initial: fx= 633.792228
x= 0.06742 0.09825 0.10335 0.08669 0.10137 0.10554 0.30000 1.30000
1 h-m-p 0.0000 0.0005 338.9730 +++ 577.747670 m 0.0005 14 | 1/8
2 h-m-p 0.0011 0.0056 57.9546 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 312.8607 ++ 564.110503 m 0.0001 45 | 2/8
4 h-m-p 0.0011 0.0101 36.7987 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 280.6347 ++ 557.516072 m 0.0001 76 | 3/8
6 h-m-p 0.0008 0.0153 27.0615 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 243.4800 ++ 556.179004 m 0.0000 107 | 4/8
8 h-m-p 0.0002 0.0227 19.6718 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 198.8743 ++ 555.612712 m 0.0000 137 | 5/8
10 h-m-p 0.0002 0.0350 13.1169 ----------.. | 5/8
11 h-m-p 0.0000 0.0000 140.6472 ++ 555.297608 m 0.0000 167 | 6/8
12 h-m-p 0.0691 8.0000 0.0000 ------Y 555.297608 0 0.0000 184 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 ------C 555.297608 0 0.0000 203
Out..
lnL = -555.297608
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072821 0.096056 0.036048 0.046372 0.068068 0.020670 0.299594 0.850605 0.513646
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.853472
np = 9
lnL0 = -602.180225
Iterating by ming2
Initial: fx= 602.180225
x= 0.07282 0.09606 0.03605 0.04637 0.06807 0.02067 0.29959 0.85060 0.51365
1 h-m-p 0.0000 0.0002 334.1598 ++ 585.309767 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0003 227.8324 ++ 574.668546 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0001 473.2272 ++ 569.437111 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0003 406.0593 ++ 559.713787 m 0.0003 50 | 4/9
5 h-m-p 0.0000 0.0000 28312.2137 ++ 558.387533 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 10078.0582 ++ 555.297571 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 555.297571 m 8.0000 86 | 6/9
8 h-m-p 0.0160 8.0000 0.0929 -----------N 555.297571 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0006 +++++ 555.297570 m 8.0000 130 | 6/9
10 h-m-p 0.0192 3.2998 0.2713 ------------Y 555.297570 0 0.0000 157 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 555.297570 m 8.0000 175 | 6/9
12 h-m-p 0.0029 1.4682 0.5244 -----------C 555.297570 0 0.0000 201 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 555.297570 m 8.0000 219 | 6/9
14 h-m-p 0.0105 5.2626 0.2085 ----------Y 555.297570 0 0.0000 244 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 555.297570 m 8.0000 262 | 6/9
16 h-m-p 0.0078 3.9071 0.2623 ---------Y 555.297570 0 0.0000 286 | 6/9
17 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297570 m 8.0000 330 | 6/9
19 h-m-p 0.0083 4.1528 0.2680 -------------.. | 6/9
20 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297570 m 8.0000 374 | 6/9
21 h-m-p 0.0082 4.1118 0.2708 --------C 555.297570 0 0.0000 397 | 6/9
22 h-m-p 0.0160 8.0000 0.0003 -------------.. | 6/9
23 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297570 m 8.0000 441 | 6/9
24 h-m-p 0.0083 4.1385 0.2692 ----------Y 555.297570 0 0.0000 466 | 6/9
25 h-m-p 0.0160 8.0000 0.0008 +++++ 555.297569 m 8.0000 484 | 6/9
26 h-m-p 0.0246 3.8716 0.2571 ---------Y 555.297569 0 0.0000 508 | 6/9
27 h-m-p 0.0160 8.0000 0.0002 +++++ 555.297569 m 8.0000 526 | 6/9
28 h-m-p 0.0035 1.5917 0.5077 ------------.. | 6/9
29 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297569 m 8.0000 569 | 6/9
30 h-m-p 0.0085 4.2349 0.2649 -------------.. | 6/9
31 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297569 m 8.0000 613 | 6/9
32 h-m-p 0.0085 4.2744 0.2626 ---------C 555.297569 0 0.0000 637 | 6/9
33 h-m-p 0.0160 8.0000 0.0006 +++++ 555.297569 m 8.0000 655 | 6/9
34 h-m-p 0.0191 3.8890 0.2521 -----------Y 555.297569 0 0.0000 681 | 6/9
35 h-m-p 0.0160 8.0000 0.0025 +++++ 555.297567 m 8.0000 699 | 6/9
36 h-m-p 0.0775 4.2745 0.2537 --------------.. | 6/9
37 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297567 m 8.0000 744 | 6/9
38 h-m-p 0.0091 4.5354 0.2516 ------------C 555.297567 0 0.0000 771 | 6/9
39 h-m-p 0.0006 0.3134 0.9568 +++++ 555.297477 m 0.3134 789 | 7/9
40 h-m-p 0.7862 3.9310 0.2716 ----------------.. | 7/9
41 h-m-p 0.0160 8.0000 0.0005 +++++ 555.297474 m 8.0000 835 | 7/9
42 h-m-p 0.0274 6.5345 0.1548 --------------.. | 7/9
43 h-m-p 0.0160 8.0000 0.0005 +++++ 555.297472 m 8.0000 878 | 7/9
44 h-m-p 0.0286 6.6522 0.1527 ----------Y 555.297472 0 0.0000 902 | 7/9
45 h-m-p 0.0005 0.2456 0.0035 +++++ 555.297471 m 0.2456 919 | 8/9
46 h-m-p 0.0160 8.0000 0.1066 ----------Y 555.297471 0 0.0000 943 | 8/9
47 h-m-p 0.0160 8.0000 0.0000 -------Y 555.297471 0 0.0000 963 | 8/9
48 h-m-p 0.0160 8.0000 0.0000 --N 555.297471 0 0.0003 978
Out..
lnL = -555.297471
979 lfun, 2937 eigenQcodon, 11748 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034525 0.109762 0.049240 0.051310 0.081033 0.095537 0.180433 1.455301 0.575756 0.496426 1.510924
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.567472
np = 11
lnL0 = -612.232008
Iterating by ming2
Initial: fx= 612.232008
x= 0.03452 0.10976 0.04924 0.05131 0.08103 0.09554 0.18043 1.45530 0.57576 0.49643 1.51092
1 h-m-p 0.0000 0.0003 320.6810 +++ 584.897100 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0005 167.9835 ++ 574.625932 m 0.0005 31 | 2/11
3 h-m-p 0.0000 0.0000 4498.5044 ++ 573.519517 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 6969.3653 ++ 561.312725 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 13397.8771 ++ 557.272519 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0001 1884.5541 ++ 555.297576 m 0.0001 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 555.297576 m 8.0000 101 | 6/11
8 h-m-p 0.0247 2.8465 0.0372 ++++ 555.297570 m 2.8465 122 | 7/11
9 h-m-p 0.1258 4.1839 0.2715 --------------Y 555.297570 0 0.0000 155 | 7/11
10 h-m-p 0.0160 8.0000 0.0001 +++++ 555.297570 m 8.0000 176 | 7/11
11 h-m-p 0.0016 0.7827 1.4659 ---------Y 555.297570 0 0.0000 203 | 7/11
12 h-m-p 0.0153 7.6556 0.0192 +++++ 555.297566 m 7.6556 220 | 8/11
13 h-m-p 0.2265 1.8876 0.5014 ----------C 555.297566 0 0.0000 248 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 555.297566 m 8.0000 268 | 8/11
15 h-m-p 0.0160 8.0000 1.5139 ----------N 555.297566 0 0.0000 295 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 ---N 555.297566 0 0.0001 312 | 8/11
17 h-m-p 0.0160 8.0000 1.0424 +++++ 555.297451 m 8.0000 332 | 8/11
18 h-m-p 1.6000 8.0000 0.2146 ++ 555.297451 m 8.0000 346 | 8/11
19 h-m-p 1.6000 8.0000 0.8827 ++ 555.297451 m 8.0000 363 | 8/11
20 h-m-p 1.6000 8.0000 0.0461 ++ 555.297451 m 8.0000 380 | 8/11
21 h-m-p 0.6377 8.0000 0.5787 ++ 555.297451 m 8.0000 397 | 8/11
22 h-m-p 1.6000 8.0000 0.0000 Y 555.297451 0 1.6000 414 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 Y 555.297451 0 0.0160 431
Out..
lnL = -555.297451
432 lfun, 1728 eigenQcodon, 7776 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -555.327672 S = -555.298059 -0.011384
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:06
did 20 / 48 patterns 0:06
did 30 / 48 patterns 0:06
did 40 / 48 patterns 0:06
did 48 / 48 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060938 0.048926 0.015926 0.078827 0.040573 0.053836 0.000100 0.482536 1.501595
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.139357
np = 9
lnL0 = -594.549317
Iterating by ming2
Initial: fx= 594.549317
x= 0.06094 0.04893 0.01593 0.07883 0.04057 0.05384 0.00011 0.48254 1.50160
1 h-m-p 0.0000 0.0000 307.7562 ++ 594.311327 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0138 34.9480 +++++ 583.916666 m 0.0138 29 | 2/9
3 h-m-p 0.0001 0.0005 216.2976 ++ 570.666894 m 0.0005 41 | 3/9
4 h-m-p 0.0033 0.0179 27.2877 ++ 556.310148 m 0.0179 53 | 4/9
5 h-m-p 0.0001 0.0005 88.1211 ----------.. | 4/9
6 h-m-p 0.0000 0.0000 267.7507 ++ 556.133951 m 0.0000 85 | 5/9
7 h-m-p 0.0160 8.0000 1.6309 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 231.8317 ++ 555.457058 m 0.0000 120 | 6/9
9 h-m-p 0.0160 8.0000 1.3336 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 189.5885 ++ 555.350991 m 0.0000 155 | 7/9
11 h-m-p 0.0160 8.0000 0.9430 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 134.0872 ++ 555.297451 m 0.0000 192 | 8/9
13 h-m-p 1.1310 8.0000 0.0000 N 555.297451 0 1.1310 204 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 555.297451 0 1.6000 217
Out..
lnL = -555.297451
218 lfun, 2398 eigenQcodon, 13080 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078870 0.073021 0.079457 0.019373 0.105545 0.073437 0.000100 0.900000 0.468168 1.106401 1.299791
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.277494
np = 11
lnL0 = -609.488521
Iterating by ming2
Initial: fx= 609.488521
x= 0.07887 0.07302 0.07946 0.01937 0.10554 0.07344 0.00011 0.90000 0.46817 1.10640 1.29979
1 h-m-p 0.0000 0.0000 283.1415 ++ 609.365906 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 121.5254 ++++ 594.890913 m 0.0012 32 | 2/11
3 h-m-p 0.0002 0.0012 169.1443 ++ 561.342273 m 0.0012 46 | 3/11
4 h-m-p 0.0000 0.0001 112.5965 ++ 561.092652 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0003 741.8239 +++ 558.202459 m 0.0003 75 | 5/11
6 h-m-p 0.0000 0.0000 6162.0805 ++ 558.049600 m 0.0000 89 | 6/11
7 h-m-p 0.0000 0.0000 3662.6562 ++ 557.796992 m 0.0000 103 | 7/11
8 h-m-p 0.0012 0.0108 16.1332 ++ 555.297544 m 0.0108 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 555.297544 m 8.0000 131 | 8/11
10 h-m-p 0.0011 0.5262 0.5604 +++++ 555.297451 m 0.5262 151 | 9/11
11 h-m-p 1.6000 8.0000 0.0001 C 555.297451 0 0.4000 168 | 9/11
12 h-m-p 0.0861 8.0000 0.0003 -Y 555.297451 0 0.0054 185 | 9/11
13 h-m-p 0.0793 8.0000 0.0000 N 555.297451 0 0.0793 201 | 9/11
14 h-m-p 0.4783 8.0000 0.0000 N 555.297451 0 0.4783 217 | 9/11
15 h-m-p 0.0747 8.0000 0.0000 Y 555.297451 0 0.0747 233 | 9/11
16 h-m-p 0.1298 8.0000 0.0000 -N 555.297451 0 0.0081 250 | 9/11
17 h-m-p 0.1420 8.0000 0.0000 Y 555.297451 0 0.0355 266
Out..
lnL = -555.297451
267 lfun, 3204 eigenQcodon, 17622 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -555.336628 S = -555.298059 -0.017044
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:14
did 20 / 48 patterns 0:14
did 30 / 48 patterns 0:14
did 40 / 48 patterns 0:14
did 48 / 48 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=142
NC_011896_1_WP_010907615_1_237_MLBR_RS01165 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NC_002677_1_NP_301291_1_163_panD MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN
**************************************************
NC_011896_1_WP_010907615_1_237_MLBR_RS01165 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
NC_002677_1_NP_301291_1_163_panD NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270 NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA
**************************************************
NC_011896_1_WP_010907615_1_237_MLBR_RS01165 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
NC_002677_1_NP_301291_1_163_panD YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270 YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
******************************************
>NC_011896_1_WP_010907615_1_237_MLBR_RS01165 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC TATTTGATCCCCGGATCGGTGCGCGG >NC_002677_1_NP_301291_1_163_panD ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC TATTTGATCCCCGGATCGGTGCGCGG >NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC TATTTGATCCCCGGATCGGTGCGCGG >NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC TATTTGATCCCCGGATCGGTGCGCGG >NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC TATTTGATCCCCGGATCGGTGCGCGG >NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270 ATGTTACGGACGATGCTAAAGTCTAAGATTCATCGCGCCACCGTCACGCA GGCTTATCTGCACTATGTCGGTTCGGTGACCATCGATGCCGATTTGATGG GCGCTGCGGACCTGCTTGAGGGTGAACAGGTTACCATTGTTGACATCAAT AACGGTGCCCGGCTCGTCACCTACGCAATTGCTGGCGAGCGTGGCACCGG TGTGATTGGAATCAATGGCGCCGCAGCGCATCTTGTTCATCCGGGCGATC TGGTAATCCTGATCTCCTATGGGACCATGGAAGATGCCGAGGCGCACGCT TATCAGCCGCGGATTGTGTTCGTCGACGCCGATAACAAACCGATCGATCT GGGCCACGATCCAGGCTCCGTGCCCTTGGACATATCTGTCGCGGCTGAAC TATTTGATCCCCGGATCGGTGCGCGG
>NC_011896_1_WP_010907615_1_237_MLBR_RS01165 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR >NC_002677_1_NP_301291_1_163_panD MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR >NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR >NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR >NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR >NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270 MLRTMLKSKIHRATVTQAYLHYVGSVTIDADLMGAADLLEGEQVTIVDIN NGARLVTYAIAGERGTGVIGINGAAAHLVHPGDLVILISYGTMEDAEAHA YQPRIVFVDADNKPIDLGHDPGSVPLDISVAAELFDPRIGAR
#NEXUS
[ID: 9071215193]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907615_1_237_MLBR_RS01165
NC_002677_1_NP_301291_1_163_panD
NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765
NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670
NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225
NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907615_1_237_MLBR_RS01165,
2 NC_002677_1_NP_301291_1_163_panD,
3 NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765,
4 NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670,
5 NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225,
6 NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06788438,2:0.06914251,3:0.06990082,4:0.06888639,5:0.0674113,6:0.06739944);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06788438,2:0.06914251,3:0.06990082,4:0.06888639,5:0.0674113,6:0.06739944);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -587.74 -591.88
2 -587.76 -591.46
--------------------------------------
TOTAL -587.75 -591.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/panD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890302 0.088247 0.330790 1.446417 0.853635 1421.22 1461.11 1.000
r(A<->C){all} 0.162002 0.018816 0.000124 0.435537 0.124249 216.05 217.44 1.000
r(A<->G){all} 0.160506 0.018846 0.000112 0.433472 0.124935 155.94 224.91 1.004
r(A<->T){all} 0.174020 0.019580 0.000025 0.446177 0.139401 203.70 308.54 1.004
r(C<->G){all} 0.155814 0.018042 0.000086 0.419243 0.118661 225.46 245.91 1.000
r(C<->T){all} 0.162538 0.019662 0.000027 0.459295 0.126638 131.76 190.31 1.000
r(G<->T){all} 0.185120 0.021937 0.000018 0.472351 0.154779 161.52 179.70 1.000
pi(A){all} 0.196819 0.000374 0.156531 0.232789 0.196326 1235.98 1241.14 1.000
pi(C){all} 0.274712 0.000441 0.234690 0.316848 0.274759 1310.42 1383.81 1.000
pi(G){all} 0.290598 0.000494 0.249718 0.335884 0.289878 1294.98 1336.70 1.000
pi(T){all} 0.237871 0.000435 0.198349 0.279207 0.237391 1193.33 1242.77 1.000
alpha{1,2} 0.436866 0.233661 0.000193 1.418664 0.270404 989.54 1174.71 1.000
alpha{3} 0.449342 0.224962 0.000294 1.427722 0.293254 1172.76 1275.34 1.000
pinvar{all} 0.996334 0.000020 0.988214 0.999999 0.997733 1282.30 1355.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/panD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 142
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 1 1 1 1 1 1
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 3 3 3 3 3 3 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 5 5 5 5 5 5 | Asp GAT 8 8 8 8 8 8 | Gly GGT 5 5 5 5 5 5
GTC 5 5 5 5 5 5 | GCC 6 6 6 6 6 6 | GAC 4 4 4 4 4 4 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 3 3 3 3 3 3 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 4 4 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907615_1_237_MLBR_RS01165
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
#2: NC_002677_1_NP_301291_1_163_panD
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
#3: NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
#4: NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
#5: NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
#6: NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 0
TTC 6 | TCC 12 | TAC 6 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 6
CTC 6 | CCC 12 | CAC 18 | CGC 6
CTA 12 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 30 | CCG 18 | CAG 18 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 0 | Asn N AAT 12 | Ser S AGT 0
ATC 42 | ACC 36 | AAC 12 | AGC 0
ATA 6 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 24 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 30 | Asp D GAT 48 | Gly G GGT 30
GTC 30 | GCC 36 | GAC 24 | GGC 42
GTA 6 | GCA 12 | Glu E GAA 18 | GGA 6
GTG 24 | GCG 30 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10563 C:0.22535 A:0.22535 G:0.44366
position 2: T:0.31690 C:0.26056 A:0.27465 G:0.14789
position 3: T:0.28873 C:0.33803 A:0.09155 G:0.28169
Average T:0.23709 C:0.27465 A:0.19718 G:0.29108
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -555.297608 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299594 1.299791
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907615_1_237_MLBR_RS01165: 0.000004, NC_002677_1_NP_301291_1_163_panD: 0.000004, NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765: 0.000004, NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670: 0.000004, NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225: 0.000004, NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29959
omega (dN/dS) = 1.29979
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 325.9 100.1 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 325.9 100.1 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 325.9 100.1 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 325.9 100.1 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 325.9 100.1 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 325.9 100.1 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -555.297471 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.180433 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907615_1_237_MLBR_RS01165: 0.000004, NC_002677_1_NP_301291_1_163_panD: 0.000004, NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765: 0.000004, NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670: 0.000004, NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225: 0.000004, NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.18043
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 328.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 328.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 328.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 328.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 328.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 328.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -555.297451 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 12.435164
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907615_1_237_MLBR_RS01165: 0.000004, NC_002677_1_NP_301291_1_163_panD: 0.000004, NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765: 0.000004, NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670: 0.000004, NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225: 0.000004, NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 12.43516
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907615_1_237_MLBR_RS01165)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -555.297451 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.869085
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907615_1_237_MLBR_RS01165: 0.000004, NC_002677_1_NP_301291_1_163_panD: 0.000004, NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765: 0.000004, NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670: 0.000004, NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225: 0.000004, NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.86909
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -555.297451 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.375931 1.870041
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907615_1_237_MLBR_RS01165: 0.000004, NC_002677_1_NP_301291_1_163_panD: 0.000004, NZ_LVXE01000009_1_WP_010907615_1_2868_A3216_RS04765: 0.000004, NZ_LYPH01000016_1_WP_010907615_1_567_A8144_RS02670: 0.000004, NZ_CP029543_1_WP_010907615_1_237_DIJ64_RS01225: 0.000004, NZ_AP014567_1_WP_010907615_1_246_JK2ML_RS01270: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.37593
(p1 = 0.00001) w = 1.87004
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.87004
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 332.9 93.1 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907615_1_237_MLBR_RS01165)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:14
Model 1: NearlyNeutral -555.297471 Model 2: PositiveSelection -555.297451 Model 0: one-ratio -555.297608 Model 7: beta -555.297451 Model 8: beta&w>1 -555.297451 Model 0 vs 1 2.7399999999033753E-4 Model 2 vs 1 3.999999989900971E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
