--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 29 03:47:31 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/48/CG11594-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -4034.84         -4052.01
2      -4034.65         -4047.42
--------------------------------------
TOTAL    -4034.74         -4051.33
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.508780    0.002976    0.402005    0.614668    0.504720   1325.56   1394.76    1.000
r(A<->C){all}   0.111101    0.000552    0.068238    0.158792    0.109410   1130.90   1135.35    1.002
r(A<->G){all}   0.244453    0.001113    0.175405    0.304823    0.244056    820.02    826.18    1.001
r(A<->T){all}   0.116295    0.000665    0.067891    0.169065    0.114714   1062.30   1064.87    1.000
r(C<->G){all}   0.053948    0.000170    0.030250    0.079701    0.053370   1214.36   1332.74    1.000
r(C<->T){all}   0.404245    0.001641    0.325881    0.485080    0.403801    884.31    902.58    1.001
r(G<->T){all}   0.069958    0.000292    0.036645    0.102793    0.068823   1159.49   1173.51    1.000
pi(A){all}      0.222809    0.000099    0.203862    0.242381    0.222694   1075.93   1119.11    1.000
pi(C){all}      0.263765    0.000103    0.243860    0.284063    0.263588    761.48    991.29    1.000
pi(G){all}      0.295408    0.000119    0.275955    0.318777    0.295424   1166.75   1171.53    1.000
pi(T){all}      0.218018    0.000089    0.199119    0.235488    0.217888   1070.76   1198.62    1.000
alpha{1,2}      0.095779    0.001319    0.008035    0.150259    0.102875    893.41   1027.54    1.001
alpha{3}        3.150906    0.878969    1.575689    5.115115    3.044968   1313.42   1338.83    1.001
pinvar{all}     0.450773    0.003020    0.340875    0.548489    0.455333   1127.75   1136.02    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-3791.820484
Model 2: PositiveSelection	-3791.820484
Model 0: one-ratio	-3812.27574
Model 3: discrete	-3791.592743
Model 7: beta	-3794.47469
Model 8: beta&w>1	-3791.595399


Model 0 vs 1	40.91051200000038

Model 2 vs 1	0.0

Model 8 vs 7	5.758582000000388
>C1
MSSGPFFVGVDVGTGSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQADTKo
>C2
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWKVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHAEICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQGDTKo
>C3
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLVKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRRTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICDLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQGDTKo
>C4
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
DAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGKIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKEADLEELTQNNFEKLGSDVQPPGRVVGKGLTAKAAGELGLAAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAKLGED
RFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPDTIEFHNRKYKVFLQLLENQRQYRRIMQGDDTK
>C5
MASGPFFVGVDVGTGSARAALVASDGRVLEQSVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPKGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWSKE
FLKQADLEELTRNNFEILGSDVQPPGRIVGKGLTAKAAGELGLTAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITREACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAELGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQIQYRRIMQGDTKo
>C6
MSSGPYFVGVDVGTGSARAALVASDGSVLEQAVQTIKTWNPEPDYYNQSS
DNIWQSICQVVKKVIVGVDKSEVKGIGFDATCSLVVLGAQGSPLTVSKSG
EAEQNVILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLQQADLEELTRNNFEKLGSDVQPPGRKVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGSDDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKEKLGED
RFIYQHLNKLLPELAAARGLSQVGFLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALANGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPGLIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQRQYRRIMQGETKo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=550 

C1              MSSGPFFVGVDVGTGSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSS
C2              MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
C3              MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
C4              MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
C5              MASGPFFVGVDVGTGSARAALVASDGRVLEQSVQTIQTWNPEPGYYNQSS
C6              MSSGPYFVGVDVGTGSARAALVASDGSVLEQAVQTIKTWNPEPDYYNQSS
                *:***:*****************.** ****:****:******.******

C1              DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
C2              DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
C3              DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPQGSPLTVSKSG
C4              DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
C5              DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPKGSPLTVSKSG
C6              DNIWQSICQVVKKVIVGVDKSEVKGIGFDATCSLVVLGAQGSPLTVSKSG
                *************** *****:****************.:**********

C1              EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
C2              EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
C3              EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
C4              DAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
C5              EAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
C6              EAEQNVILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
                :****:*******************:.***********************

C1              NLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
C2              NLAKTFGNIWKVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
C3              NLVKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
C4              NLSKTFGKIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
C5              NLAKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWSKE
C6              NLSKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
                ** :***:**:************************************.**

C1              FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVS
C2              FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
C3              FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
C4              FLKEADLEELTQNNFEKLGSDVQPPGRVVGKGLTAKAAGELGLAAGTVVS
C5              FLKQADLEELTRNNFEILGSDVQPPGRIVGKGLTAKAAGELGLTAGTVVS
C6              FLQQADLEELTRNNFEKLGSDVQPPGRKVGKGLTAKAAGELGLSAGTVVS
                **::*******:**** ********** ***************:.*****

C1              TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
C2              TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
C3              TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
C4              TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
C5              TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITREACF
C6              TSLIDAHAGALGMFGCRSKESKGSDDVQGKMALIAGTSTCHMSITRKACF
                ***********************:**********************:***

C1              AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
C2              AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
C3              AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAQLGED
C4              AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAKLGED
C5              AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAELGED
C6              AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKEKLGED
                ******************************************** :****

C1              KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
C2              KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
C3              KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
C4              RFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
C5              KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
C6              RFIYQHLNKLLPELAAARGLSQVGFLTQDVHVWPDLHGNRSPIADPTLRG
                :*********************** *************************

C1              VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
C2              VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
C3              VITGLDMTRRTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
C4              VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
C5              VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
C6              VITGLDMTRGTESLAIKYLAFVQALANGTRHIIENLYQYGRAPFQTLLFC
                ********* **************** ***********************

C1              GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
C2              GGLAKNPLYVQCHAEICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
C3              GGLAKNPLYVQCHADICDLPALIPDEQEMVLVGAAALGAAASGHFDSLES
C4              GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
C5              GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
C6              GGLAKNPLYVQCHADICNLPGLIPDEQEMVLVGAAALGAAASGHFDSLES
                **************:**:**.*****************************

C1              ASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQA-DTKo
C2              ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQG-DTKo
C3              ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQG-DTKo
C4              ASKAMGGTGQLVKPNPDTIEFHNRKYKVFLQLLENQRQYRRIMQGDDTK-
C5              ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQIQYRRIMQG-DTKo
C6              ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQRQYRRIMQG-ETKo
                ***:***********.:*:***************** *******. :** 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  549 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  549 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16470]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [16470]--->[16470]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/48/CG11594-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.419 Mb, Max= 31.011 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSGPFFVGVDVGTGSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQA-DTKo
>C2
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWKVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHAEICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQG-DTKo
>C3
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLVKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRRTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICDLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQG-DTKo
>C4
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
DAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGKIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKEADLEELTQNNFEKLGSDVQPPGRVVGKGLTAKAAGELGLAAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAKLGED
RFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPDTIEFHNRKYKVFLQLLENQRQYRRIMQGDDTK-
>C5
MASGPFFVGVDVGTGSARAALVASDGRVLEQSVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPKGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWSKE
FLKQADLEELTRNNFEILGSDVQPPGRIVGKGLTAKAAGELGLTAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITREACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAELGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQIQYRRIMQG-DTKo
>C6
MSSGPYFVGVDVGTGSARAALVASDGSVLEQAVQTIKTWNPEPDYYNQSS
DNIWQSICQVVKKVIVGVDKSEVKGIGFDATCSLVVLGAQGSPLTVSKSG
EAEQNVILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLQQADLEELTRNNFEKLGSDVQPPGRKVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGSDDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKEKLGED
RFIYQHLNKLLPELAAARGLSQVGFLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALANGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPGLIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQRQYRRIMQG-ETKo

FORMAT of file /tmp/tmp3285352841870208321aln Not Supported[FATAL:T-COFFEE]
>C1
MSSGPFFVGVDVGTGSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQA-DTKo
>C2
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWKVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHAEICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQG-DTKo
>C3
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLVKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRRTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICDLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQG-DTKo
>C4
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
DAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGKIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKEADLEELTQNNFEKLGSDVQPPGRVVGKGLTAKAAGELGLAAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAKLGED
RFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPDTIEFHNRKYKVFLQLLENQRQYRRIMQGDDTK-
>C5
MASGPFFVGVDVGTGSARAALVASDGRVLEQSVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPKGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWSKE
FLKQADLEELTRNNFEILGSDVQPPGRIVGKGLTAKAAGELGLTAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITREACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAELGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQIQYRRIMQG-DTKo
>C6
MSSGPYFVGVDVGTGSARAALVASDGSVLEQAVQTIKTWNPEPDYYNQSS
DNIWQSICQVVKKVIVGVDKSEVKGIGFDATCSLVVLGAQGSPLTVSKSG
EAEQNVILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLQQADLEELTRNNFEKLGSDVQPPGRKVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGSDDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKEKLGED
RFIYQHLNKLLPELAAARGLSQVGFLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALANGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPGLIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQRQYRRIMQG-ETKo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:550 S:99 BS:550
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.54 C1	 C2	 98.54
TOP	    1    0	 98.54 C2	 C1	 98.54
BOT	    0    2	 98.18 C1	 C3	 98.18
TOP	    2    0	 98.18 C3	 C1	 98.18
BOT	    0    3	 96.90 C1	 C4	 96.90
TOP	    3    0	 96.90 C4	 C1	 96.90
BOT	    0    4	 96.17 C1	 C5	 96.17
TOP	    4    0	 96.17 C5	 C1	 96.17
BOT	    0    5	 95.26 C1	 C6	 95.26
TOP	    5    0	 95.26 C6	 C1	 95.26
BOT	    1    2	 98.72 C2	 C3	 98.72
TOP	    2    1	 98.72 C3	 C2	 98.72
BOT	    1    3	 96.90 C2	 C4	 96.90
TOP	    3    1	 96.90 C4	 C2	 96.90
BOT	    1    4	 96.54 C2	 C5	 96.54
TOP	    4    1	 96.54 C5	 C2	 96.54
BOT	    1    5	 95.26 C2	 C6	 95.26
TOP	    5    1	 95.26 C6	 C2	 95.26
BOT	    2    3	 96.90 C3	 C4	 96.90
TOP	    3    2	 96.90 C4	 C3	 96.90
BOT	    2    4	 96.72 C3	 C5	 96.72
TOP	    4    2	 96.72 C5	 C3	 96.72
BOT	    2    5	 95.45 C3	 C6	 95.45
TOP	    5    2	 95.45 C6	 C3	 95.45
BOT	    3    4	 96.53 C4	 C5	 96.53
TOP	    4    3	 96.53 C5	 C4	 96.53
BOT	    3    5	 95.80 C4	 C6	 95.80
TOP	    5    3	 95.80 C6	 C4	 95.80
BOT	    4    5	 95.26 C5	 C6	 95.26
TOP	    5    4	 95.26 C6	 C5	 95.26
AVG	 0	 C1	  *	 97.01
AVG	 1	 C2	  *	 97.19
AVG	 2	 C3	  *	 97.19
AVG	 3	 C4	  *	 96.61
AVG	 4	 C5	  *	 96.25
AVG	 5	 C6	  *	 95.41
TOT	 TOT	  *	 96.61
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
C2              ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
C3              ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
C4              ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
C5              ATGGCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
C6              ATGTCATCCGGACCGTATTTTGTGGGCGTGGATGTGGGCACGGGCAGTGC
                *** ************:*************** *****************

C1              GAGGGCGGCCCTGGTCGCCTGCGATGGGCGTGTCCTGGAGCAGGCGGTGC
C2              GAGGGCGGCGCTGGTCGCCTCCGATGGGCGTGTCCTGGAGCAGGCGGTGC
C3              GAGGGCGGCGCTGGTCGCCTCCGATGGGCGTGTCCTGGAGCAGGCGGTGC
C4              GAGGGCTGCCCTGGTGGCCTCCGATGGCCGTGTCCTGGAGCAGGCGGTGC
C5              GAGGGCTGCCCTGGTGGCCTCCGATGGGCGTGTCCTGGAGCAGTCGGTGC
C6              GAGGGCGGCCCTGGTGGCCTCCGATGGGAGTGTCCTGGAGCAGGCGGTGC
                ****** ** ***** **** ****** .************** ******

C1              AGACGATCCAAACGTGGAATCCTGAGCCGGGCTACTACAACCAGTCATCC
C2              AGACGATCCAAACGTGGAACCCCGAGCCGGGCTACTACAACCAGTCATCC
C3              AGACGATCCAAACGTGGAACCCCGAGCCGGGCTACTACAACCAGTCCTCC
C4              AGACGATCCAAACGTGGAACCCAGAGCCGGGCTACTACAACCAGTCGTCC
C5              AGACGATCCAAACCTGGAACCCAGAGCCGGGCTACTACAACCAGTCCTCC
C6              AGACGATCAAAACCTGGAATCCAGAGCCGGACTACTACAACCAGTCATCC
                ********.**** ***** ** *******.*************** ***

C1              GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
C2              GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
C3              GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
C4              GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
C5              GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
C6              GATAATATTTGGCAATCCATCTGCCAGGTGGTGAAGAAAGTCATCGTCGG
                ********:*****.***************************** * ***

C1              CGTCGATAAGTCAAAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCT
C2              CGTCGATAAGTCGAAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCC
C3              CGTCGATAAGTCAGAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCT
C4              CGTCGATAAGTCAAAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCT
C5              CGTCGATAAGTCAGAAGTCAAGGGCATTGGCTTTGATGCCACCTGCTCCT
C6              CGTCGATAAGTCAGAAGTCAAGGGCATTGGCTTCGACGCCACCTGCTCCT
                ************..******************* ** ************ 

C1              TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACGGTGAGCAAGTCCGGT
C2              TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACGGTGAGCAAGTCCGGT
C3              TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACGGTGAGCAAGTCCGGT
C4              TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACAGTGAGCAAGTCCGGT
C5              TGGTGGTTCTGGGCCCCAAGGGATCTCCGTTGACGGTGAGCAAATCCGGT
C6              TGGTGGTTCTGGGTGCCCAAGGATCCCCACTGACAGTGAGCAAATCCGGC
                *************  **.*.***** **. ****.********.***** 

C1              GAGGCGGAGCAGAACATAATCCTCTGGATGGACCATCGTGCCGAGCAGGA
C2              GAGGCGGAGCAGAACATAATCCTCTGGATGGACCATCGTGCCGAGCAGGA
C3              GAGGCGGAGCAGAACATAATCCTCTGGATGGACCATCGTGCCGAGCAGGA
C4              GATGCGGAGCAGAACATAATACTCTGGATGGACCATCGTGCCGAGCAGGA
C5              GAGGCGGAGCAGAACATAATTCTCTGGATGGACCATCGTGCCGAGCAGGA
C6              GAAGCGGAGCAGAACGTAATCCTGTGGATGGACCATCGTGCCGAGCAGGA
                ** ************.**** ** **************************

C1              AACCCAAGAGATCAATGCCTTCAAGCACTCGCTGCTGAAATATGTGGGTG
C2              AACCCAAGAGATCAATGCCTTCAAACACTCGCTGCTGAAATATGTGGGTG
C3              AACCCAAGAGATTAATGCCTTCAAGCACTCGCTGCTGAAATATGTGGGTG
C4              AACCCAGGAGATAAACGCCTTCAAGAACCCGCTGCTCAAGTATGTGGGTG
C5              AACCCAGGAGATAAATGCCTTCAAGAACCCGCTGCTGAAGTATGTGGGTG
C6              AACCCAGGAGATAAATGCCTTTAAGAACCCACTACTTAAATATGTGGGTG
                ******.***** ** ***** **..** *.**.** **.**********

C1              GTCAGGTTTCGCTGGAAATGGAGGTTCCCAAATTGCTGTGGCTGAAGAGG
C2              GTCAGGTTTCGCTGGAAATGGAGGTTCCCAAATTGCTGTGGCTGAAGAGG
C3              GTCAGGTATCGCTGGAAATGGAGGTTCCCAAATTGCTCTGGCTGAAGAGG
C4              GTCAGGTTTCGCTGGAAATGGAGGTTCCCAAGTTGCTGTGGCTGAAGAGG
C5              GTCAGGTTTCGCTGGAAATGGAGGTTCCTAAATTGCTGTGGCTAAAGCGG
C6              GCCAGGTTTCGCTGGAGATGGAGGTCCCGAAACTCCTCTGGTTGAAGAGG
                * *****:********.******** ** **. * ** *** *.***.**

C1              AATCTGTCACAGACTTTTGGAAATATTTGGAGGGTCTTTGACCTGCCCGA
C2              AATCTGGCAAAGACCTTTGGAAATATATGGAAGGTCTTTGACCTGCCCGA
C3              AATCTGGTAAAGACCTTTGGAAATATATGGAGGGTCTTTGACCTGCCCGA
C4              AATCTCTCAAAGACCTTTGGAAAGATTTGGCGGGTCTTTGACCTGCCCGA
C5              AATCTTGCAAAGACCTTTGGAAATATTTGGAGGGTCTTCGACCTGCCCGA
C6              AATCTCTCGAAGACCTTTGGCAATATTTGGCGAGTTTTCGATCTGCCCGA
                *****   ..**** *****.** **:***...** ** ** ********

C1              CTTTCTGACCTGGCGAGCCACTGGAGTGGACACCCGATCACTTTGCTCGG
C2              CTTTCTGACCTGGCGAGCCACTGGAGTGGATACCCGATCACTTTGCTCGG
C3              CTTTTTAACCTGGCGAGCCACTGGAGTGGACACCCGATCACTTTGCTCGG
C4              CTTTCTGACCTGGAGAGCCACTGGTGTGGATACCCGATCACTTTGCTCAG
C5              CTTTCTGACCTGGAGAGCCACTGGTGTGGATACCCGATCGCTTTGCTCAG
C6              CTTCCTCACCTGGCGAGCAACTGGTGTGGACACCCGATCACTTTGCTCGG
                ***  * ******.****.*****:***** ********.********.*

C1              TGGTGTGCAAGTGGAACTACGATGCAGCGAATGGCAGTTGGAACAAGGAG
C2              TTGTGTGCAAGTGGAACTACGATGCAGCGAATGGCAGTTGGAACAAGGAG
C3              TGGTGTGCAAGTGGAACTACGATGCGGCGAATGGCAGTTGGAACAAGGAG
C4              TGGTGTGCAAGTGGAACTACGATGCAGCGAATGGCAGCTGGAACAAGGAG
C5              TGGTGTGCAAGTGGAACTATGATGCAGCGAATGGCAGTTGGAGCAAGGAG
C6              TGGTTTGCAAGTGGAACTACGATGCAGCAAATGGCAGCTGGAACAAGGAG
                * ** ************** *****.**.******** ****.*******

C1              TTCCTGAAGCAGGCGGACTTGGAGGAGTTGACACAGAATAACTTCGAGAA
C2              TTCCTGAAGCAGGCGGACTTGGAGGAGTTGACTCAGAATAACTTCGAGAA
C3              TTCCTGAAGCAGGCGGACTTGGAGGAGTTGACTCAGAATAACTTCGAGAA
C4              TTCCTGAAAGAGGCCGACTTGGAGGAGTTGACCCAGAATAACTTCGAGAA
C5              TTCCTCAAACAGGCGGATTTGGAGGAGTTGACCCGGAATAACTTCGAGAT
C6              TTCCTCCAGCAGGCGGACCTGGAGGAGTTGACCCGGAACAACTTCGAGAA
                ***** .*. **** **  ************* *.*** **********:

C1              ATTGGGCAGTGATGTCCAGCCGCCTGGCCGAACGGTGGGCAAAGGACTCA
C2              ATTGGGCAGTGATGTCCAGCCACCTGGCCGAACGGTGGGCAAAGGACTCA
C3              ATTGGGCAGTGATGTCCAGCCACCTGGCCGAACGGTGGGCAAAGGACTCA
C4              ACTGGGCAGTGATGTCCAGCCTCCTGGCCGAGTAGTGGGCAAAGGACTCA
C5              ATTGGGCAGTGATGTCCAGCCTCCTGGCCGAATAGTGGGCAAAGGACTCA
C6              GCTGGGCAGTGATGTCCAGCCGCCGGGCAGAAAGGTGGGCAAAGGTCTTA
                . ******************* ** ***.**. .***********:** *

C1              CGGCCAAGGCTGCTGGGGAACTGGGCTTATCCGCCGGCACTGTGGTGAGC
C2              CTGCCAAGGCTGCCGGGGAATTGGGCTTATCCGTCGGCACTGTGGTGAGC
C3              CTGCCAAGGCTGCCGGGGAATTGGGCTTATCCGTCGGTACTGTGGTAAGC
C4              CTGCCAAGGCAGCCGGGGAATTGGGCTTAGCCGCCGGCACTGTGGTCAGC
C5              CTGCCAAGGCTGCCGGGGAATTGGGCTTAACCGCCGGCACTGTGGTTAGC
C6              CGGCCAAGGCTGCCGGGGAATTGGGTTTGTCCGCTGGAACTGTGGTGAGC
                * ********:** ****** **** **. ***  ** ******** ***

C1              ACCTCCCTAATCGATGCCCATGCTGGCGCCTTGGGAATGTTTGGATGCCG
C2              ACCTCCCTAATCGATGCCCACGCTGGCGCCTTGGGAATGTTTGGCTGCCG
C3              ACCTCCCTAATCGATGCCCACGCTGGCGCCTTGGGAATGTTTGGCTGCCG
C4              ACCTCTCTAATCGATGCCCATGCTGGCGCCTTGGGAATGTTTGGCTGCCG
C5              ACCTCTCTAATCGACGCCCATGCTGGCGCCTTGGGAATGTTTGGGTGCCG
C6              ACTTCGTTAATAGATGCCCATGCTGGTGCCCTGGGAATGTTTGGTTGCCG
                ** **  ****.** ***** ***** *** ************* *****

C1              CTCAAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCTCTGA
C2              CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCGCTGA
C3              CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCGCTGA
C4              CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCGCTGA
C5              CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGCAAGATGGCGCTGA
C6              CTCTAAGGAATCCAAAGGTTCCGATGATGTCCAGGGTAAAATGGCTTTGA
                *** *****.*****.*** **** *********** **.*****  ***

C1              TTGCCGGTACATCCACCTGCCACATGAGCATCACCCGGAAGGCATGCTTC
C2              TTGCCGGTACATCCACCTGCCACATGAGCATCACTCGGAAGGCCTGCTTC
C3              TTGCCGGTACATCCACCTGCCACATGAGCATCACCCGGAAGGCATGCTTC
C4              TTGCCGGCACATCCACCTGCCACATGAGCATCACGCGGAAGGCCTGCTTC
C5              TTGCCGGCACATCCACTTGCCACATGAGCATCACCCGGGAGGCCTGCTTC
C6              TTGCTGGTACCTCAACCTGCCACATGAGCATCACCCGAAAGGCCTGTTTC
                **** ** **.**.** ***************** **..****.** ***

C1              GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCCGGCTACTT
C2              GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCGGGCTACTT
C3              GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCGGGCTACTT
C4              GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATCATTCCGGGTTACTT
C5              GCCCAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCGGGATACTT
C6              GCCCAAGGGGTTTGGGGTCCCTACCAGGATGCCATTATTCCCGGCTATTT
                **.***** ************** *********** ***** ** ** **

C1              CCTAAACGAGGGTGGTCAGAGCATCGCAGGACATCTCCTAGATCACGTCC
C2              CCTAAACGAGGGTGGGCAGAGCATCGCAGGACATCTCCTAGATCACGTCC
C3              CCTAAACGAGGGTGGACAGAGCATCGCAGGACATCTCCTAGATCACGTCC
C4              CCTGAACGAGGGCGGTCAGAGCATCGCCGGACACCTCCTGGATCACGTCC
C5              CCTGAACGAGGGCGGTCAGAGCATCGCAGGACACCTCCTAGATCACGTCC
C6              CCTCAACGAAGGTGGTCAGAGCATTGCAGGTCATCTCCTGGATCACGTCC
                *** *****.** ** ******** **.**:** *****.**********

C1              TCAAGTCGCATGAATCCTACGCCGAACTGAAATCCCAATTGGGAGAGGAT
C2              TCAAGTCGCACGAATCCTACGCCGAACTGAAATCTCAATTGGGAGAGGAT
C3              TCAAGTCGCACGAATCCTACGCCGAACTGAAAGCCCAATTGGGAGAGGAT
C4              TCAAGTCGCATGAATCCTACGCTGAGCTGAAAGCCAAGTTGGGAGAGGAT
C5              TCAAGTCGCATGAATCCTACGCTGAACTGAAAGCCGAACTGGGAGAGGAT
C6              TCAAGTCCCACGAATCCTATGCTGAACTGAAGGAGAAACTGGGTGAGGAT
                ******* ** ******** ** **.*****. .  *. ****:******

C1              AAGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCAGCAGC
C2              AAGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCAGCTGC
C3              AAGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCAGCTGC
C4              AGGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCTGCAGC
C5              AAGTTTATCTACCAGCATCTTAATAAGCTGCTGCCGGAACTGGCAGCAGC
C6              AGGTTCATCTATCAGCATCTCAATAAGTTGCTGCCCGAATTGGCCGCTGC
                *.*** ***** ******** ****** ******* *** **** **:**

C1              TCGAGGATTAAGCCAGGTGGGCTGTCTCACCCAGGATGTCCATGTCTGGC
C2              GCGAGGATTAAGCCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
C3              TCGAGGATTAAGTCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
C4              TCGAGGATTGAGCCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
C5              TCGAGGATTAAGCCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
C6              TCGGGGATTGAGTCAGGTGGGATTTCTTACCCAGGATGTCCATGTCTGGC
                 **.*****.** ******** * *** **********************

C1              CGGACTTGCATGGCAATCGGTCGCCCATCGCAGATCCCACGCTGCGAGGA
C2              CGGACTTGCATGGCAATCGGTCGCCCATCGCAGATCCCACGCTGCGAGGA
C3              CGGACTTGCATGGCAATCGGTCGCCCATCGCAGATCCCACGCTGCGAGGA
C4              CGGACTTGCATGGCAATCGGTCGCCCATCGCCGATCCCACGCTGCGAGGA
C5              CGGACCTGCATGGAAATCGGTCACCCATCGCCGATCCCACGCTGCGAGGA
C6              CGGATTTGCATGGCAATCGCTCGCCCATCGCCGATCCCACGCTGCGAGGA
                ****  *******.***** **.********.******************

C1              GTGATTACTGGACTGGACATGACGCGAGGAACTGAATCTCTGGCCATCAA
C2              GTGATTACTGGACTGGACATGACGCGAGGAACTGAATCTCTGGCCATCAA
C3              GTGATTACTGGACTGGACATGACGAGAAGAACAGAATCTCTGGCCATCAA
C4              GTGATTACTGGTCTGGATATGACGCGCGGAACTGAATCTCTGGCCATCAA
C5              GTGATTACTGGTCTGGATATGACGCGAGGAACTGAATCTCTGGCCATCAA
C6              GTGATCACTGGCTTGGATATGACGCGAGGAACTGAATCTCTGGCCATTAA
                ***** *****  **** ******.*..****:************** **

C1              ATACTTGGCGTTCGTCCAAGCTCTGGCTTACGGCACACGTCACATTATTG
C2              ATACTTGGCGTTCGTCCAAGCTCTTGCTTACGGCACACGTCATATTATTG
C3              ATACTTGGCGTTCGTCCAAGCTCTGGCTTACGGCACTCGTCACATTATCG
C4              ATACTTGGCGTTCGTTCAAGCTCTGGCTTACGGCACACGTCACATTATCG
C5              ATACTTGGCGTTCGTCCAAGCTCTGGCTTACGGCACACGTCACATTATCG
C6              ATACCTGGCTTTCGTTCAAGCACTGGCTAATGGAACCCGTCACATTATCG
                **** **** ***** *****:** ***:* **.** ***** ***** *

C1              AAAACCTTTACCAGTACGGTAGAGCTCCCTTTCAAACGCTACTTTTCTGC
C2              AAAACCTTTACCAGTACGGTAGAGCTCCCTTTCAAACGCTACTTTTCTGC
C3              AAAATCTTTACCAGTACGGTAGAGCTCCCTTTCAAACGCTACTTTTCTGC
C4              AGAACCTCTATCAGTATGGTAGAGCTCCCTTTCAAACGCTGCTTTTCTGC
C5              AGAACCTTTACCAGTACGGTAGAGCTCCCTTTCAAACACTACTTTTCTGC
C6              AGAACCTCTATCAATACGGTAGGGCACCCTTCCAAACGCTTCTCTTCTGC
                *.** ** ** **.** *****.**:***** *****.** ** ******

C1              GGGGGATTGGCCAAGAATCCTCTGTACGTACAATGTCATGCGGACATTTG
C2              GGGGGATTGGCCAAGAATCCTCTGTACGTACAATGCCATGCGGAGATTTG
C3              GGGGGATTGGCCAAGAATCCTCTGTACGTACAATGTCATGCGGACATTTG
C4              GGCGGATTGGCCAAGAATCCCTTGTACGTACAGTGCCATGCGGATATCTG
C5              GGGGGATTGGCCAAGAATCCCTTGTACGTACAATGCCATGCGGACATTTG
C6              GGCGGACTGGCCAAGAATCCTTTGTATGTGCAATGCCATGCGGATATTTG
                ** *** *************  **** **.**.** ******** ** **

C1              CAATCTGCCCGCACTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGCG
C2              CAATCTGCCCGCACTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGCG
C3              CGATCTACCCGCACTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGCG
C4              CAATCTGCCCGCTTTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGAG
C5              CAATCTGCCCGCATTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGTG
C6              CAATCTGCCCGGCTTGATTCCCGATGAACAGGAAATGGTTCTGGTGGGAG
                *.****.****   ******* ************************** *

C1              CTGCTGCCTTGGGAGCCGCTGCCTCCGGCCACTTCGACAGCTTGGAGAGC
C2              CTGCTGCCTTGGGAGCCGCTGCCTCCGGCCACTTCGACAGCTTGGAGAGC
C3              CTGCTGCCTTGGGAGCCGCTGCCTCCGGCCACTTCGACAGCTTGGAGAGC
C4              CCGCTGCCTTGGGTGCCGCTGCCTCCGGACACTTTGACAGCTTGGAGAGC
C5              CTGCTGCCTTGGGTGCCGCTGCCTCCGGACACTTTGACAGCTTGGAGAGC
C6              CTGCTGCCCTGGGAGCCGCTGCCTCCGGGCACTTTGACAGCTTGGAGAGC
                * ****** ****:************** ***** ***************

C1              GCCTCGAAATCCATGGGTGGCACTGGCCAGCTGGTGAAGCCGAACGCGGA
C2              GCCTCGAAAGCCATGGGTGGCACTGGCCAGCTGGTGAAGCCGAACGCGGA
C3              GCCTCGAAAGCCATGGGTGGCACTGGCCAGCTGGTGAAGCCGAACGCGGA
C4              GCCTCAAAAGCCATGGGTGGCACTGGACAGCTGGTGAAGCCGAACCCGGA
C5              GCCTCGAAAGCCATGGGTGGCACTGGCCAGCTTGTAAAGCCGAACCCGGA
C6              GCCTCGAAGGCCATGGGTGGCACTGGCCAGCTGGTGAAGCCAAACCCGGA
                *****.**. ****************.***** **.*****.*** ****

C1              AACGCTTGAGTTCCACAATCGCAAGTACAAGGTGTTCCTGCAGCTGCTGG
C2              AACGCTTGAGTTCCACAATCGCAAGTACAAGGTGTTCCTGCAGCTGTTGG
C3              AACGCTTGAGTTCCACAATCGCAAGTACAAGGTGTTCCTGCAGCTGCTGG
C4              CACCATAGAGTTCCACAATCGCAAGTACAAGGTGTTCCTACAGCTGCTGG
C5              AACCCTAGAGTTCCACAATCGCAAGTACAAGGTGTTCCTACAGCTGCTGG
C6              AACCCTGGAGTTCCACAACCGCAAATACAAAGTGTTCCTACAACTATTGG
                .** .* *********** *****.*****.********.**.**. ***

C1              AGAACCAACGACAGTACAGGCGCATTATGCAGGCA---GACACAAAG---
C2              AGAACCAGCGCCAGTACAGGCGCATTATGCAGGGA---GACACTAAG---
C3              AGAACCAGCGCCAGTACAGGCGCATTATGCAGGGA---GACACTAAG---
C4              AGAACCAACGCCAGTACAGGCGCATTATGCAGGGAGACGACACTAAG---
C5              AGAACCAAATCCAGTACAGGCGCATTATGCAGGGA---GACACAAAG---
C6              AGAACCAACGCCAGTACCGACGCATTATGCAGGGA---GAAACAAAG---
                *******.. .******.*.************* *   **.**:***   



>C1
ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
GAGGGCGGCCCTGGTCGCCTGCGATGGGCGTGTCCTGGAGCAGGCGGTGC
AGACGATCCAAACGTGGAATCCTGAGCCGGGCTACTACAACCAGTCATCC
GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
CGTCGATAAGTCAAAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCT
TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACGGTGAGCAAGTCCGGT
GAGGCGGAGCAGAACATAATCCTCTGGATGGACCATCGTGCCGAGCAGGA
AACCCAAGAGATCAATGCCTTCAAGCACTCGCTGCTGAAATATGTGGGTG
GTCAGGTTTCGCTGGAAATGGAGGTTCCCAAATTGCTGTGGCTGAAGAGG
AATCTGTCACAGACTTTTGGAAATATTTGGAGGGTCTTTGACCTGCCCGA
CTTTCTGACCTGGCGAGCCACTGGAGTGGACACCCGATCACTTTGCTCGG
TGGTGTGCAAGTGGAACTACGATGCAGCGAATGGCAGTTGGAACAAGGAG
TTCCTGAAGCAGGCGGACTTGGAGGAGTTGACACAGAATAACTTCGAGAA
ATTGGGCAGTGATGTCCAGCCGCCTGGCCGAACGGTGGGCAAAGGACTCA
CGGCCAAGGCTGCTGGGGAACTGGGCTTATCCGCCGGCACTGTGGTGAGC
ACCTCCCTAATCGATGCCCATGCTGGCGCCTTGGGAATGTTTGGATGCCG
CTCAAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCTCTGA
TTGCCGGTACATCCACCTGCCACATGAGCATCACCCGGAAGGCATGCTTC
GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCCGGCTACTT
CCTAAACGAGGGTGGTCAGAGCATCGCAGGACATCTCCTAGATCACGTCC
TCAAGTCGCATGAATCCTACGCCGAACTGAAATCCCAATTGGGAGAGGAT
AAGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCAGCAGC
TCGAGGATTAAGCCAGGTGGGCTGTCTCACCCAGGATGTCCATGTCTGGC
CGGACTTGCATGGCAATCGGTCGCCCATCGCAGATCCCACGCTGCGAGGA
GTGATTACTGGACTGGACATGACGCGAGGAACTGAATCTCTGGCCATCAA
ATACTTGGCGTTCGTCCAAGCTCTGGCTTACGGCACACGTCACATTATTG
AAAACCTTTACCAGTACGGTAGAGCTCCCTTTCAAACGCTACTTTTCTGC
GGGGGATTGGCCAAGAATCCTCTGTACGTACAATGTCATGCGGACATTTG
CAATCTGCCCGCACTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGCG
CTGCTGCCTTGGGAGCCGCTGCCTCCGGCCACTTCGACAGCTTGGAGAGC
GCCTCGAAATCCATGGGTGGCACTGGCCAGCTGGTGAAGCCGAACGCGGA
AACGCTTGAGTTCCACAATCGCAAGTACAAGGTGTTCCTGCAGCTGCTGG
AGAACCAACGACAGTACAGGCGCATTATGCAGGCA---GACACAAAG---
>C2
ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
GAGGGCGGCGCTGGTCGCCTCCGATGGGCGTGTCCTGGAGCAGGCGGTGC
AGACGATCCAAACGTGGAACCCCGAGCCGGGCTACTACAACCAGTCATCC
GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
CGTCGATAAGTCGAAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCC
TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACGGTGAGCAAGTCCGGT
GAGGCGGAGCAGAACATAATCCTCTGGATGGACCATCGTGCCGAGCAGGA
AACCCAAGAGATCAATGCCTTCAAACACTCGCTGCTGAAATATGTGGGTG
GTCAGGTTTCGCTGGAAATGGAGGTTCCCAAATTGCTGTGGCTGAAGAGG
AATCTGGCAAAGACCTTTGGAAATATATGGAAGGTCTTTGACCTGCCCGA
CTTTCTGACCTGGCGAGCCACTGGAGTGGATACCCGATCACTTTGCTCGG
TTGTGTGCAAGTGGAACTACGATGCAGCGAATGGCAGTTGGAACAAGGAG
TTCCTGAAGCAGGCGGACTTGGAGGAGTTGACTCAGAATAACTTCGAGAA
ATTGGGCAGTGATGTCCAGCCACCTGGCCGAACGGTGGGCAAAGGACTCA
CTGCCAAGGCTGCCGGGGAATTGGGCTTATCCGTCGGCACTGTGGTGAGC
ACCTCCCTAATCGATGCCCACGCTGGCGCCTTGGGAATGTTTGGCTGCCG
CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCGCTGA
TTGCCGGTACATCCACCTGCCACATGAGCATCACTCGGAAGGCCTGCTTC
GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCGGGCTACTT
CCTAAACGAGGGTGGGCAGAGCATCGCAGGACATCTCCTAGATCACGTCC
TCAAGTCGCACGAATCCTACGCCGAACTGAAATCTCAATTGGGAGAGGAT
AAGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCAGCTGC
GCGAGGATTAAGCCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
CGGACTTGCATGGCAATCGGTCGCCCATCGCAGATCCCACGCTGCGAGGA
GTGATTACTGGACTGGACATGACGCGAGGAACTGAATCTCTGGCCATCAA
ATACTTGGCGTTCGTCCAAGCTCTTGCTTACGGCACACGTCATATTATTG
AAAACCTTTACCAGTACGGTAGAGCTCCCTTTCAAACGCTACTTTTCTGC
GGGGGATTGGCCAAGAATCCTCTGTACGTACAATGCCATGCGGAGATTTG
CAATCTGCCCGCACTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGCG
CTGCTGCCTTGGGAGCCGCTGCCTCCGGCCACTTCGACAGCTTGGAGAGC
GCCTCGAAAGCCATGGGTGGCACTGGCCAGCTGGTGAAGCCGAACGCGGA
AACGCTTGAGTTCCACAATCGCAAGTACAAGGTGTTCCTGCAGCTGTTGG
AGAACCAGCGCCAGTACAGGCGCATTATGCAGGGA---GACACTAAG---
>C3
ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
GAGGGCGGCGCTGGTCGCCTCCGATGGGCGTGTCCTGGAGCAGGCGGTGC
AGACGATCCAAACGTGGAACCCCGAGCCGGGCTACTACAACCAGTCCTCC
GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
CGTCGATAAGTCAGAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCT
TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACGGTGAGCAAGTCCGGT
GAGGCGGAGCAGAACATAATCCTCTGGATGGACCATCGTGCCGAGCAGGA
AACCCAAGAGATTAATGCCTTCAAGCACTCGCTGCTGAAATATGTGGGTG
GTCAGGTATCGCTGGAAATGGAGGTTCCCAAATTGCTCTGGCTGAAGAGG
AATCTGGTAAAGACCTTTGGAAATATATGGAGGGTCTTTGACCTGCCCGA
CTTTTTAACCTGGCGAGCCACTGGAGTGGACACCCGATCACTTTGCTCGG
TGGTGTGCAAGTGGAACTACGATGCGGCGAATGGCAGTTGGAACAAGGAG
TTCCTGAAGCAGGCGGACTTGGAGGAGTTGACTCAGAATAACTTCGAGAA
ATTGGGCAGTGATGTCCAGCCACCTGGCCGAACGGTGGGCAAAGGACTCA
CTGCCAAGGCTGCCGGGGAATTGGGCTTATCCGTCGGTACTGTGGTAAGC
ACCTCCCTAATCGATGCCCACGCTGGCGCCTTGGGAATGTTTGGCTGCCG
CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCGCTGA
TTGCCGGTACATCCACCTGCCACATGAGCATCACCCGGAAGGCATGCTTC
GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCGGGCTACTT
CCTAAACGAGGGTGGACAGAGCATCGCAGGACATCTCCTAGATCACGTCC
TCAAGTCGCACGAATCCTACGCCGAACTGAAAGCCCAATTGGGAGAGGAT
AAGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCAGCTGC
TCGAGGATTAAGTCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
CGGACTTGCATGGCAATCGGTCGCCCATCGCAGATCCCACGCTGCGAGGA
GTGATTACTGGACTGGACATGACGAGAAGAACAGAATCTCTGGCCATCAA
ATACTTGGCGTTCGTCCAAGCTCTGGCTTACGGCACTCGTCACATTATCG
AAAATCTTTACCAGTACGGTAGAGCTCCCTTTCAAACGCTACTTTTCTGC
GGGGGATTGGCCAAGAATCCTCTGTACGTACAATGTCATGCGGACATTTG
CGATCTACCCGCACTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGCG
CTGCTGCCTTGGGAGCCGCTGCCTCCGGCCACTTCGACAGCTTGGAGAGC
GCCTCGAAAGCCATGGGTGGCACTGGCCAGCTGGTGAAGCCGAACGCGGA
AACGCTTGAGTTCCACAATCGCAAGTACAAGGTGTTCCTGCAGCTGCTGG
AGAACCAGCGCCAGTACAGGCGCATTATGCAGGGA---GACACTAAG---
>C4
ATGTCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
GAGGGCTGCCCTGGTGGCCTCCGATGGCCGTGTCCTGGAGCAGGCGGTGC
AGACGATCCAAACGTGGAACCCAGAGCCGGGCTACTACAACCAGTCGTCC
GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
CGTCGATAAGTCAAAAGTCAAGGGCATTGGCTTCGATGCCACCTGCTCCT
TGGTGGTTCTGGGCCCCCAGGGATCGCCGCTGACAGTGAGCAAGTCCGGT
GATGCGGAGCAGAACATAATACTCTGGATGGACCATCGTGCCGAGCAGGA
AACCCAGGAGATAAACGCCTTCAAGAACCCGCTGCTCAAGTATGTGGGTG
GTCAGGTTTCGCTGGAAATGGAGGTTCCCAAGTTGCTGTGGCTGAAGAGG
AATCTCTCAAAGACCTTTGGAAAGATTTGGCGGGTCTTTGACCTGCCCGA
CTTTCTGACCTGGAGAGCCACTGGTGTGGATACCCGATCACTTTGCTCAG
TGGTGTGCAAGTGGAACTACGATGCAGCGAATGGCAGCTGGAACAAGGAG
TTCCTGAAAGAGGCCGACTTGGAGGAGTTGACCCAGAATAACTTCGAGAA
ACTGGGCAGTGATGTCCAGCCTCCTGGCCGAGTAGTGGGCAAAGGACTCA
CTGCCAAGGCAGCCGGGGAATTGGGCTTAGCCGCCGGCACTGTGGTCAGC
ACCTCTCTAATCGATGCCCATGCTGGCGCCTTGGGAATGTTTGGCTGCCG
CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGTAAAATGGCGCTGA
TTGCCGGCACATCCACCTGCCACATGAGCATCACGCGGAAGGCCTGCTTC
GCACAAGGTGTTTGGGGTCCCTATCAGGATGCCATCATTCCGGGTTACTT
CCTGAACGAGGGCGGTCAGAGCATCGCCGGACACCTCCTGGATCACGTCC
TCAAGTCGCATGAATCCTACGCTGAGCTGAAAGCCAAGTTGGGAGAGGAT
AGGTTTATCTACCAGCATCTTAATAAGTTGCTGCCGGAACTGGCTGCAGC
TCGAGGATTGAGCCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
CGGACTTGCATGGCAATCGGTCGCCCATCGCCGATCCCACGCTGCGAGGA
GTGATTACTGGTCTGGATATGACGCGCGGAACTGAATCTCTGGCCATCAA
ATACTTGGCGTTCGTTCAAGCTCTGGCTTACGGCACACGTCACATTATCG
AGAACCTCTATCAGTATGGTAGAGCTCCCTTTCAAACGCTGCTTTTCTGC
GGCGGATTGGCCAAGAATCCCTTGTACGTACAGTGCCATGCGGATATCTG
CAATCTGCCCGCTTTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGAG
CCGCTGCCTTGGGTGCCGCTGCCTCCGGACACTTTGACAGCTTGGAGAGC
GCCTCAAAAGCCATGGGTGGCACTGGACAGCTGGTGAAGCCGAACCCGGA
CACCATAGAGTTCCACAATCGCAAGTACAAGGTGTTCCTACAGCTGCTGG
AGAACCAACGCCAGTACAGGCGCATTATGCAGGGAGACGACACTAAG---
>C5
ATGGCATCCGGACCGTTTTTTGTGGGCGTGGACGTGGGCACGGGCAGTGC
GAGGGCTGCCCTGGTGGCCTCCGATGGGCGTGTCCTGGAGCAGTCGGTGC
AGACGATCCAAACCTGGAACCCAGAGCCGGGCTACTACAACCAGTCCTCC
GATAATATATGGCAGTCCATCTGCCAGGTGGTGAAGAAAGTCATTGGCGG
CGTCGATAAGTCAGAAGTCAAGGGCATTGGCTTTGATGCCACCTGCTCCT
TGGTGGTTCTGGGCCCCAAGGGATCTCCGTTGACGGTGAGCAAATCCGGT
GAGGCGGAGCAGAACATAATTCTCTGGATGGACCATCGTGCCGAGCAGGA
AACCCAGGAGATAAATGCCTTCAAGAACCCGCTGCTGAAGTATGTGGGTG
GTCAGGTTTCGCTGGAAATGGAGGTTCCTAAATTGCTGTGGCTAAAGCGG
AATCTTGCAAAGACCTTTGGAAATATTTGGAGGGTCTTCGACCTGCCCGA
CTTTCTGACCTGGAGAGCCACTGGTGTGGATACCCGATCGCTTTGCTCAG
TGGTGTGCAAGTGGAACTATGATGCAGCGAATGGCAGTTGGAGCAAGGAG
TTCCTCAAACAGGCGGATTTGGAGGAGTTGACCCGGAATAACTTCGAGAT
ATTGGGCAGTGATGTCCAGCCTCCTGGCCGAATAGTGGGCAAAGGACTCA
CTGCCAAGGCTGCCGGGGAATTGGGCTTAACCGCCGGCACTGTGGTTAGC
ACCTCTCTAATCGACGCCCATGCTGGCGCCTTGGGAATGTTTGGGTGCCG
CTCGAAGGAGTCCAAGGGTGCCGACGATGTCCAGGGCAAGATGGCGCTGA
TTGCCGGCACATCCACTTGCCACATGAGCATCACCCGGGAGGCCTGCTTC
GCCCAAGGTGTTTGGGGTCCCTATCAGGATGCCATTATTCCGGGATACTT
CCTGAACGAGGGCGGTCAGAGCATCGCAGGACACCTCCTAGATCACGTCC
TCAAGTCGCATGAATCCTACGCTGAACTGAAAGCCGAACTGGGAGAGGAT
AAGTTTATCTACCAGCATCTTAATAAGCTGCTGCCGGAACTGGCAGCAGC
TCGAGGATTAAGCCAGGTGGGTTGTCTCACCCAGGATGTCCATGTCTGGC
CGGACCTGCATGGAAATCGGTCACCCATCGCCGATCCCACGCTGCGAGGA
GTGATTACTGGTCTGGATATGACGCGAGGAACTGAATCTCTGGCCATCAA
ATACTTGGCGTTCGTCCAAGCTCTGGCTTACGGCACACGTCACATTATCG
AGAACCTTTACCAGTACGGTAGAGCTCCCTTTCAAACACTACTTTTCTGC
GGGGGATTGGCCAAGAATCCCTTGTACGTACAATGCCATGCGGACATTTG
CAATCTGCCCGCATTGATTCCGGATGAACAGGAAATGGTTCTGGTGGGTG
CTGCTGCCTTGGGTGCCGCTGCCTCCGGACACTTTGACAGCTTGGAGAGC
GCCTCGAAAGCCATGGGTGGCACTGGCCAGCTTGTAAAGCCGAACCCGGA
AACCCTAGAGTTCCACAATCGCAAGTACAAGGTGTTCCTACAGCTGCTGG
AGAACCAAATCCAGTACAGGCGCATTATGCAGGGA---GACACAAAG---
>C6
ATGTCATCCGGACCGTATTTTGTGGGCGTGGATGTGGGCACGGGCAGTGC
GAGGGCGGCCCTGGTGGCCTCCGATGGGAGTGTCCTGGAGCAGGCGGTGC
AGACGATCAAAACCTGGAATCCAGAGCCGGACTACTACAACCAGTCATCC
GATAATATTTGGCAATCCATCTGCCAGGTGGTGAAGAAAGTCATCGTCGG
CGTCGATAAGTCAGAAGTCAAGGGCATTGGCTTCGACGCCACCTGCTCCT
TGGTGGTTCTGGGTGCCCAAGGATCCCCACTGACAGTGAGCAAATCCGGC
GAAGCGGAGCAGAACGTAATCCTGTGGATGGACCATCGTGCCGAGCAGGA
AACCCAGGAGATAAATGCCTTTAAGAACCCACTACTTAAATATGTGGGTG
GCCAGGTTTCGCTGGAGATGGAGGTCCCGAAACTCCTCTGGTTGAAGAGG
AATCTCTCGAAGACCTTTGGCAATATTTGGCGAGTTTTCGATCTGCCCGA
CTTCCTCACCTGGCGAGCAACTGGTGTGGACACCCGATCACTTTGCTCGG
TGGTTTGCAAGTGGAACTACGATGCAGCAAATGGCAGCTGGAACAAGGAG
TTCCTCCAGCAGGCGGACCTGGAGGAGTTGACCCGGAACAACTTCGAGAA
GCTGGGCAGTGATGTCCAGCCGCCGGGCAGAAAGGTGGGCAAAGGTCTTA
CGGCCAAGGCTGCCGGGGAATTGGGTTTGTCCGCTGGAACTGTGGTGAGC
ACTTCGTTAATAGATGCCCATGCTGGTGCCCTGGGAATGTTTGGTTGCCG
CTCTAAGGAATCCAAAGGTTCCGATGATGTCCAGGGTAAAATGGCTTTGA
TTGCTGGTACCTCAACCTGCCACATGAGCATCACCCGAAAGGCCTGTTTC
GCCCAAGGGGTTTGGGGTCCCTACCAGGATGCCATTATTCCCGGCTATTT
CCTCAACGAAGGTGGTCAGAGCATTGCAGGTCATCTCCTGGATCACGTCC
TCAAGTCCCACGAATCCTATGCTGAACTGAAGGAGAAACTGGGTGAGGAT
AGGTTCATCTATCAGCATCTCAATAAGTTGCTGCCCGAATTGGCCGCTGC
TCGGGGATTGAGTCAGGTGGGATTTCTTACCCAGGATGTCCATGTCTGGC
CGGATTTGCATGGCAATCGCTCGCCCATCGCCGATCCCACGCTGCGAGGA
GTGATCACTGGCTTGGATATGACGCGAGGAACTGAATCTCTGGCCATTAA
ATACCTGGCTTTCGTTCAAGCACTGGCTAATGGAACCCGTCACATTATCG
AGAACCTCTATCAATACGGTAGGGCACCCTTCCAAACGCTTCTCTTCTGC
GGCGGACTGGCCAAGAATCCTTTGTATGTGCAATGCCATGCGGATATTTG
CAATCTGCCCGGCTTGATTCCCGATGAACAGGAAATGGTTCTGGTGGGAG
CTGCTGCCCTGGGAGCCGCTGCCTCCGGGCACTTTGACAGCTTGGAGAGC
GCCTCGAAGGCCATGGGTGGCACTGGCCAGCTGGTGAAGCCAAACCCGGA
AACCCTGGAGTTCCACAACCGCAAATACAAAGTGTTCCTACAACTATTGG
AGAACCAACGCCAGTACCGACGCATTATGCAGGGA---GAAACAAAG---
>C1
MSSGPFFVGVDVGTGSARAALVACDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLSQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKSMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQAoDTK
>C2
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWKVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHAEICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQGoDTK
>C3
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPQGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLEMEVPKLLWLKR
NLVKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKQADLEELTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSVGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAQLGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRRTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICDLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNAETLEFHNRKYKVFLQLLENQRQYRRIMQGoDTK
>C4
MSSGPFFVGVDVGTGSARAALVASDGRVLEQAVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSKVKGIGFDATCSLVVLGPQGSPLTVSKSG
DAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGKIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLKEADLEELTQNNFEKLGSDVQPPGRVVGKGLTAKAAGELGLAAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAKLGED
RFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPDTIEFHNRKYKVFLQLLENQRQYRRIMQGDDTK
>C5
MASGPFFVGVDVGTGSARAALVASDGRVLEQSVQTIQTWNPEPGYYNQSS
DNIWQSICQVVKKVIGGVDKSEVKGIGFDATCSLVVLGPKGSPLTVSKSG
EAEQNIILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLAKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWSKE
FLKQADLEELTRNNFEILGSDVQPPGRIVGKGLTAKAAGELGLTAGTVVS
TSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITREACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKAELGED
KFIYQHLNKLLPELAAARGLSQVGCLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALAYGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQIQYRRIMQGoDTK
>C6
MSSGPYFVGVDVGTGSARAALVASDGSVLEQAVQTIKTWNPEPDYYNQSS
DNIWQSICQVVKKVIVGVDKSEVKGIGFDATCSLVVLGAQGSPLTVSKSG
EAEQNVILWMDHRAEQETQEINAFKNPLLKYVGGQVSLEMEVPKLLWLKR
NLSKTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYDAANGSWNKE
FLQQADLEELTRNNFEKLGSDVQPPGRKVGKGLTAKAAGELGLSAGTVVS
TSLIDAHAGALGMFGCRSKESKGSDDVQGKMALIAGTSTCHMSITRKACF
AQGVWGPYQDAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKEKLGED
RFIYQHLNKLLPELAAARGLSQVGFLTQDVHVWPDLHGNRSPIADPTLRG
VITGLDMTRGTESLAIKYLAFVQALANGTRHIIENLYQYGRAPFQTLLFC
GGLAKNPLYVQCHADICNLPGLIPDEQEMVLVGAAALGAAASGHFDSLES
ASKAMGGTGQLVKPNPETLEFHNRKYKVFLQLLENQRQYRRIMQGoETK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1650 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480390776
      Setting output file names to "/opt/ADOPS/48/CG11594-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 963878044
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0227079035
      Seed = 543507410
      Swapseed = 1480390776
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 46 unique site patterns
      Division 2 has 22 unique site patterns
      Division 3 has 113 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -5054.545434 -- -24.965149
         Chain 2 -- -4989.555562 -- -24.965149
         Chain 3 -- -4997.611268 -- -24.965149
         Chain 4 -- -4984.307295 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -5002.961748 -- -24.965149
         Chain 2 -- -5017.640538 -- -24.965149
         Chain 3 -- -4979.245740 -- -24.965149
         Chain 4 -- -5054.545434 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-5054.545] (-4989.556) (-4997.611) (-4984.307) * [-5002.962] (-5017.641) (-4979.246) (-5054.545) 
        500 -- (-4169.138) (-4166.322) (-4176.700) [-4167.050] * [-4159.950] (-4168.310) (-4176.867) (-4162.556) -- 0:00:00
       1000 -- (-4138.669) (-4138.049) (-4161.724) [-4115.999] * (-4150.810) (-4143.805) [-4140.408] (-4133.465) -- 0:00:00
       1500 -- [-4076.687] (-4093.787) (-4137.205) (-4092.697) * (-4132.058) (-4115.480) [-4121.345] (-4122.925) -- 0:11:05
       2000 -- (-4052.472) [-4042.410] (-4111.827) (-4061.131) * [-4064.647] (-4083.550) (-4102.066) (-4074.602) -- 0:08:19
       2500 -- (-4049.540) [-4041.626] (-4077.985) (-4046.160) * [-4045.819] (-4056.274) (-4096.907) (-4042.725) -- 0:06:39
       3000 -- [-4039.449] (-4035.378) (-4068.394) (-4037.508) * (-4040.529) (-4043.423) (-4083.538) [-4041.935] -- 0:05:32
       3500 -- (-4047.435) [-4038.400] (-4067.804) (-4038.639) * [-4037.738] (-4043.664) (-4053.437) (-4048.296) -- 0:04:44
       4000 -- (-4037.425) (-4045.658) (-4063.092) [-4036.534] * (-4033.575) (-4043.754) [-4044.503] (-4054.829) -- 0:04:09
       4500 -- (-4033.497) (-4042.647) (-4046.476) [-4036.428] * (-4043.915) (-4044.492) [-4036.103] (-4056.926) -- 0:03:41
       5000 -- (-4033.534) (-4037.996) [-4040.764] (-4037.823) * (-4042.396) (-4042.320) [-4035.099] (-4049.767) -- 0:06:38

      Average standard deviation of split frequencies: 0.031427

       5500 -- (-4034.148) (-4039.051) (-4037.515) [-4036.779] * (-4045.775) [-4040.116] (-4042.982) (-4042.697) -- 0:06:01
       6000 -- (-4055.399) [-4040.003] (-4040.303) (-4037.104) * (-4046.089) [-4038.881] (-4035.791) (-4041.252) -- 0:05:31
       6500 -- [-4044.124] (-4036.884) (-4040.977) (-4041.004) * [-4038.503] (-4038.072) (-4043.932) (-4042.808) -- 0:05:05
       7000 -- (-4037.145) (-4043.443) [-4037.903] (-4040.139) * (-4042.722) [-4040.134] (-4045.776) (-4044.263) -- 0:04:43
       7500 -- [-4040.827] (-4043.847) (-4052.347) (-4035.537) * (-4048.779) (-4043.059) [-4036.879] (-4040.008) -- 0:04:24
       8000 -- (-4050.566) (-4047.095) (-4048.020) [-4036.658] * [-4039.432] (-4050.663) (-4040.567) (-4042.759) -- 0:06:12
       8500 -- (-4047.071) [-4042.409] (-4040.720) (-4038.053) * (-4043.191) (-4039.782) (-4044.546) [-4037.225] -- 0:05:49
       9000 -- (-4036.283) (-4044.822) [-4036.576] (-4037.786) * (-4038.185) (-4045.365) (-4044.928) [-4040.253] -- 0:05:30
       9500 -- (-4044.365) (-4036.753) [-4036.879] (-4035.771) * [-4038.225] (-4043.115) (-4044.551) (-4033.897) -- 0:05:12
      10000 -- [-4041.701] (-4038.742) (-4038.985) (-4033.543) * (-4039.139) (-4033.248) (-4046.462) [-4046.952] -- 0:04:57

      Average standard deviation of split frequencies: 0.070711

      10500 -- [-4039.375] (-4039.748) (-4036.712) (-4032.674) * (-4049.457) (-4031.546) (-4041.910) [-4035.991] -- 0:04:42
      11000 -- (-4047.249) (-4037.725) [-4035.228] (-4045.006) * (-4039.501) (-4037.777) (-4041.743) [-4042.887] -- 0:04:29
      11500 -- (-4048.072) (-4045.765) [-4035.268] (-4038.944) * (-4040.706) (-4039.978) [-4039.610] (-4042.692) -- 0:05:43
      12000 -- [-4044.485] (-4046.193) (-4038.197) (-4037.399) * [-4035.588] (-4041.000) (-4038.821) (-4049.179) -- 0:05:29
      12500 -- [-4037.473] (-4044.883) (-4040.489) (-4036.021) * [-4034.009] (-4042.653) (-4036.838) (-4041.309) -- 0:05:16
      13000 -- (-4038.041) (-4039.439) (-4038.674) [-4038.121] * (-4044.370) (-4041.540) (-4039.724) [-4039.989] -- 0:05:03
      13500 -- (-4039.417) (-4040.827) (-4039.584) [-4040.476] * (-4040.983) (-4038.790) [-4041.787] (-4033.853) -- 0:04:52
      14000 -- (-4036.522) (-4039.060) (-4045.537) [-4043.141] * (-4040.998) [-4038.109] (-4045.498) (-4038.674) -- 0:04:41
      14500 -- (-4035.580) (-4040.757) [-4036.036] (-4037.115) * (-4039.786) [-4037.322] (-4039.138) (-4038.737) -- 0:04:31
      15000 -- (-4042.053) (-4045.373) [-4034.941] (-4032.391) * (-4041.912) (-4035.289) (-4044.524) [-4034.314] -- 0:05:28

      Average standard deviation of split frequencies: 0.047140

      15500 -- (-4037.867) [-4036.220] (-4040.819) (-4038.251) * (-4041.366) [-4040.297] (-4043.499) (-4033.337) -- 0:05:17
      16000 -- (-4038.881) [-4049.911] (-4034.543) (-4035.288) * [-4044.870] (-4041.431) (-4036.498) (-4042.105) -- 0:05:07
      16500 -- (-4038.099) (-4039.503) [-4035.248] (-4036.857) * (-4042.316) [-4036.345] (-4045.157) (-4036.346) -- 0:04:58
      17000 -- [-4041.061] (-4038.447) (-4040.066) (-4037.678) * (-4038.733) (-4036.923) (-4045.634) [-4033.611] -- 0:04:49
      17500 -- (-4039.446) [-4040.236] (-4038.284) (-4047.101) * (-4047.241) (-4043.639) (-4047.533) [-4038.335] -- 0:04:40
      18000 -- (-4042.611) (-4039.325) (-4036.778) [-4043.636] * (-4042.492) (-4039.897) [-4038.134] (-4036.783) -- 0:05:27
      18500 -- [-4038.092] (-4037.379) (-4041.960) (-4047.057) * (-4041.910) (-4038.855) (-4036.341) [-4034.347] -- 0:05:18
      19000 -- (-4038.744) [-4036.174] (-4045.347) (-4044.913) * (-4045.840) (-4037.728) (-4049.192) [-4036.487] -- 0:05:09
      19500 -- [-4045.784] (-4037.383) (-4038.205) (-4047.277) * [-4042.094] (-4044.194) (-4052.001) (-4043.892) -- 0:05:01
      20000 -- (-4041.336) (-4037.773) [-4033.395] (-4050.933) * [-4038.790] (-4047.537) (-4042.697) (-4037.991) -- 0:04:54

      Average standard deviation of split frequencies: 0.022810

      20500 -- [-4035.736] (-4040.599) (-4045.533) (-4038.865) * (-4042.903) [-4038.695] (-4046.571) (-4035.831) -- 0:04:46
      21000 -- (-4048.938) [-4040.307] (-4039.251) (-4035.111) * [-4039.002] (-4035.914) (-4043.216) (-4042.249) -- 0:04:39
      21500 -- (-4046.427) (-4039.705) (-4034.589) [-4040.765] * (-4035.391) (-4040.222) (-4043.006) [-4039.813] -- 0:05:18
      22000 -- (-4035.919) [-4044.478] (-4045.168) (-4032.485) * (-4036.890) (-4036.132) (-4041.893) [-4041.881] -- 0:05:11
      22500 -- (-4034.185) (-4037.030) (-4037.076) [-4040.237] * (-4040.987) (-4046.294) [-4038.165] (-4038.738) -- 0:05:04
      23000 -- [-4033.802] (-4040.158) (-4044.057) (-4041.465) * (-4040.484) (-4037.772) (-4039.453) [-4042.552] -- 0:04:57
      23500 -- (-4034.287) [-4043.853] (-4036.196) (-4040.381) * [-4038.771] (-4044.672) (-4036.131) (-4043.651) -- 0:04:50
      24000 -- (-4044.335) (-4044.279) [-4044.581] (-4045.565) * (-4040.735) [-4044.542] (-4037.370) (-4040.496) -- 0:04:44
      24500 -- (-4041.213) [-4036.517] (-4053.041) (-4043.095) * (-4039.938) (-4047.701) [-4035.615] (-4040.839) -- 0:04:38
      25000 -- [-4039.779] (-4039.076) (-4044.394) (-4041.716) * (-4039.718) [-4036.822] (-4033.112) (-4040.433) -- 0:05:12

      Average standard deviation of split frequencies: 0.014505

      25500 -- (-4037.488) (-4049.211) (-4043.040) [-4041.449] * (-4035.411) (-4033.964) (-4034.842) [-4042.602] -- 0:05:05
      26000 -- [-4037.615] (-4040.302) (-4039.472) (-4039.116) * [-4035.985] (-4037.208) (-4043.804) (-4038.968) -- 0:04:59
      26500 -- (-4039.480) (-4041.073) [-4036.727] (-4043.293) * (-4042.682) (-4037.578) [-4037.723] (-4037.971) -- 0:04:53
      27000 -- (-4044.254) (-4045.244) (-4038.370) [-4039.943] * [-4035.402] (-4035.814) (-4041.116) (-4045.622) -- 0:04:48
      27500 -- [-4033.828] (-4037.149) (-4041.348) (-4036.421) * (-4039.538) (-4042.307) [-4036.657] (-4036.889) -- 0:04:42
      28000 -- [-4038.105] (-4034.497) (-4042.892) (-4037.363) * (-4040.377) (-4036.355) (-4034.285) [-4038.941] -- 0:04:37
      28500 -- (-4034.934) [-4036.523] (-4045.971) (-4042.474) * (-4038.814) (-4041.857) (-4044.778) [-4041.276] -- 0:05:06
      29000 -- [-4038.281] (-4037.972) (-4042.655) (-4035.149) * (-4040.264) [-4034.194] (-4035.822) (-4042.297) -- 0:05:01
      29500 -- (-4034.427) (-4037.739) (-4042.101) [-4043.342] * (-4039.203) [-4033.564] (-4040.326) (-4037.905) -- 0:04:56
      30000 -- (-4033.749) (-4033.916) (-4033.525) [-4042.088] * (-4033.645) [-4041.461] (-4038.859) (-4040.142) -- 0:04:51

      Average standard deviation of split frequencies: 0.024595

      30500 -- (-4037.454) [-4041.972] (-4037.993) (-4041.399) * (-4040.026) [-4042.072] (-4041.330) (-4041.827) -- 0:04:46
      31000 -- (-4038.153) (-4037.355) (-4039.928) [-4034.559] * (-4040.376) [-4033.530] (-4041.276) (-4037.818) -- 0:04:41
      31500 -- (-4037.347) (-4034.469) (-4037.613) [-4041.038] * [-4035.453] (-4047.082) (-4042.321) (-4037.815) -- 0:04:36
      32000 -- (-4040.295) (-4047.845) [-4033.947] (-4044.443) * (-4039.919) [-4045.346] (-4035.369) (-4042.422) -- 0:05:02
      32500 -- [-4040.907] (-4046.086) (-4038.958) (-4048.688) * [-4036.391] (-4049.196) (-4033.339) (-4038.264) -- 0:04:57
      33000 -- (-4041.797) [-4042.944] (-4039.337) (-4039.013) * [-4046.834] (-4049.350) (-4035.410) (-4043.383) -- 0:04:53
      33500 -- (-4049.450) (-4036.476) (-4041.729) [-4037.622] * (-4038.643) (-4042.598) (-4042.166) [-4034.769] -- 0:04:48
      34000 -- (-4052.615) (-4037.543) (-4048.458) [-4036.978] * (-4052.962) (-4044.838) (-4047.499) [-4033.749] -- 0:04:44
      34500 -- (-4046.212) [-4042.129] (-4037.404) (-4037.539) * (-4040.256) (-4035.863) [-4040.300] (-4033.272) -- 0:04:39
      35000 -- [-4038.169] (-4038.405) (-4036.325) (-4046.301) * (-4039.582) (-4042.630) [-4040.456] (-4034.769) -- 0:05:03

      Average standard deviation of split frequencies: 0.031427

      35500 -- (-4049.022) (-4037.960) [-4040.704] (-4044.072) * [-4038.387] (-4044.753) (-4044.545) (-4043.190) -- 0:04:58
      36000 -- (-4038.026) (-4051.701) [-4033.375] (-4039.078) * (-4045.267) (-4055.559) (-4041.459) [-4043.469] -- 0:04:54
      36500 -- [-4034.030] (-4036.714) (-4044.252) (-4038.372) * (-4041.899) (-4039.194) (-4039.772) [-4036.991] -- 0:04:50
      37000 -- (-4038.526) (-4036.776) [-4035.569] (-4049.645) * (-4037.888) (-4036.001) [-4037.168] (-4047.825) -- 0:04:46
      37500 -- (-4039.719) [-4041.844] (-4039.914) (-4044.230) * (-4040.116) [-4035.608] (-4036.927) (-4042.244) -- 0:04:42
      38000 -- [-4037.974] (-4041.734) (-4041.025) (-4044.943) * (-4037.780) (-4031.971) (-4039.178) [-4039.757] -- 0:04:38
      38500 -- [-4046.023] (-4038.028) (-4045.622) (-4039.059) * (-4045.752) (-4047.696) [-4037.810] (-4039.940) -- 0:04:59
      39000 -- (-4045.349) [-4036.958] (-4037.576) (-4045.392) * (-4047.514) (-4038.397) (-4040.816) [-4045.168] -- 0:04:55
      39500 -- (-4038.955) (-4036.852) [-4039.322] (-4037.394) * (-4043.463) (-4041.443) (-4040.677) [-4039.205] -- 0:04:51
      40000 -- (-4030.395) (-4034.990) [-4037.792] (-4049.638) * (-4044.986) [-4047.963] (-4043.694) (-4041.178) -- 0:04:48

      Average standard deviation of split frequencies: 0.037094

      40500 -- (-4037.459) [-4037.737] (-4044.051) (-4039.848) * (-4042.353) [-4036.307] (-4038.909) (-4040.873) -- 0:04:44
      41000 -- (-4045.839) (-4041.112) [-4045.105] (-4037.332) * (-4041.690) (-4048.425) (-4037.859) [-4034.077] -- 0:04:40
      41500 -- [-4039.148] (-4034.772) (-4040.727) (-4043.400) * (-4036.322) [-4031.843] (-4042.103) (-4037.512) -- 0:04:37
      42000 -- (-4047.359) [-4038.157] (-4046.558) (-4045.788) * (-4051.194) (-4041.093) (-4037.072) [-4036.037] -- 0:04:56
      42500 -- (-4042.627) [-4038.388] (-4041.278) (-4043.191) * (-4042.160) [-4035.585] (-4039.763) (-4052.971) -- 0:04:52
      43000 -- [-4042.604] (-4038.804) (-4042.320) (-4038.331) * [-4032.255] (-4040.249) (-4035.369) (-4034.936) -- 0:04:49
      43500 -- (-4038.495) [-4041.582] (-4043.019) (-4044.790) * (-4036.616) (-4038.437) (-4036.835) [-4035.577] -- 0:04:45
      44000 -- (-4037.197) (-4043.559) [-4043.524] (-4044.077) * [-4041.231] (-4035.646) (-4039.926) (-4044.240) -- 0:04:42
      44500 -- (-4039.726) (-4044.037) [-4037.161] (-4038.250) * (-4045.552) (-4037.727) (-4041.994) [-4041.174] -- 0:04:39
      45000 -- (-4039.654) (-4047.526) (-4047.717) [-4038.901] * (-4039.633) (-4041.351) (-4038.400) [-4036.338] -- 0:04:57

      Average standard deviation of split frequencies: 0.049190

      45500 -- [-4039.452] (-4045.155) (-4050.761) (-4044.126) * (-4039.507) [-4037.008] (-4046.915) (-4049.213) -- 0:04:53
      46000 -- (-4034.641) (-4044.409) (-4046.457) [-4033.689] * [-4037.658] (-4037.384) (-4044.179) (-4039.273) -- 0:04:50
      46500 -- [-4050.098] (-4040.374) (-4045.194) (-4048.945) * (-4039.678) (-4036.575) [-4042.522] (-4047.102) -- 0:04:47
      47000 -- [-4045.599] (-4038.664) (-4032.345) (-4036.851) * (-4033.452) (-4036.624) [-4045.115] (-4040.595) -- 0:04:43
      47500 -- (-4050.598) (-4040.014) [-4039.658] (-4043.904) * (-4049.592) (-4034.951) [-4037.309] (-4043.302) -- 0:04:40
      48000 -- (-4041.459) [-4040.950] (-4037.666) (-4043.477) * [-4037.680] (-4037.203) (-4039.558) (-4042.383) -- 0:04:37
      48500 -- [-4038.659] (-4048.429) (-4040.232) (-4039.181) * [-4041.595] (-4041.037) (-4039.220) (-4032.613) -- 0:04:54
      49000 -- (-4043.665) (-4045.883) (-4036.373) [-4037.965] * (-4045.810) (-4039.084) [-4037.095] (-4043.242) -- 0:04:51
      49500 -- (-4044.518) (-4051.212) [-4040.358] (-4037.464) * (-4042.719) (-4037.525) (-4035.786) [-4043.178] -- 0:04:48
      50000 -- (-4036.741) (-4038.798) (-4040.361) [-4041.072] * (-4042.329) (-4038.757) [-4053.583] (-4041.434) -- 0:04:45

      Average standard deviation of split frequencies: 0.055824

      50500 -- (-4038.794) [-4036.258] (-4040.798) (-4036.735) * [-4033.388] (-4043.141) (-4037.383) (-4044.018) -- 0:04:42
      51000 -- (-4044.827) (-4040.598) (-4045.659) [-4040.339] * [-4034.596] (-4038.281) (-4038.163) (-4044.867) -- 0:04:39
      51500 -- (-4037.531) (-4042.497) [-4041.098] (-4040.095) * (-4040.671) (-4043.295) (-4046.293) [-4044.689] -- 0:04:36
      52000 -- [-4033.274] (-4040.051) (-4040.142) (-4042.513) * [-4034.266] (-4050.021) (-4042.198) (-4039.107) -- 0:04:51
      52500 -- [-4036.003] (-4039.152) (-4033.770) (-4040.482) * (-4035.172) (-4037.431) [-4042.618] (-4038.310) -- 0:04:48
      53000 -- (-4041.953) [-4035.517] (-4041.686) (-4041.637) * (-4037.159) [-4032.710] (-4043.740) (-4040.114) -- 0:04:45
      53500 -- [-4039.440] (-4035.918) (-4038.790) (-4043.990) * (-4040.012) (-4045.873) (-4044.699) [-4032.502] -- 0:04:43
      54000 -- (-4050.462) (-4040.357) [-4033.140] (-4041.378) * (-4040.364) [-4034.791] (-4037.288) (-4040.475) -- 0:04:40
      54500 -- (-4033.481) (-4040.145) [-4040.571] (-4035.737) * (-4038.909) [-4042.568] (-4040.578) (-4034.438) -- 0:04:37
      55000 -- (-4044.402) [-4037.233] (-4037.247) (-4040.356) * [-4042.066] (-4038.245) (-4043.031) (-4041.419) -- 0:04:34

      Average standard deviation of split frequencies: 0.040406

      55500 -- (-4039.582) (-4053.349) [-4038.138] (-4037.050) * (-4039.204) (-4046.572) [-4038.736] (-4039.017) -- 0:04:49
      56000 -- (-4038.818) (-4040.125) [-4037.615] (-4034.252) * (-4039.116) (-4042.033) (-4038.354) [-4038.841] -- 0:04:46
      56500 -- [-4039.173] (-4042.937) (-4040.574) (-4040.500) * [-4034.521] (-4041.037) (-4050.375) (-4038.362) -- 0:04:43
      57000 -- [-4036.551] (-4046.400) (-4039.911) (-4041.922) * (-4040.531) (-4042.890) (-4038.180) [-4034.857] -- 0:04:41
      57500 -- (-4037.576) (-4035.938) [-4041.308] (-4039.449) * (-4038.852) (-4037.160) (-4034.467) [-4041.316] -- 0:04:38
      58000 -- (-4036.134) [-4040.128] (-4040.046) (-4043.807) * (-4034.267) (-4034.862) (-4032.227) [-4039.672] -- 0:04:36
      58500 -- (-4038.598) (-4038.794) (-4043.639) [-4038.247] * (-4042.532) [-4042.196] (-4041.303) (-4040.606) -- 0:04:49
      59000 -- [-4035.798] (-4043.088) (-4042.338) (-4041.880) * (-4052.796) (-4040.042) [-4040.106] (-4037.826) -- 0:04:47
      59500 -- (-4038.266) (-4044.313) [-4035.602] (-4036.824) * (-4041.187) [-4034.849] (-4042.367) (-4045.822) -- 0:04:44
      60000 -- (-4035.799) [-4041.457] (-4045.402) (-4039.268) * (-4044.645) (-4039.381) [-4039.928] (-4041.756) -- 0:04:42

      Average standard deviation of split frequencies: 0.034190

      60500 -- (-4037.340) (-4041.828) [-4034.451] (-4046.555) * (-4041.432) (-4037.636) [-4040.545] (-4038.260) -- 0:04:39
      61000 -- (-4040.374) [-4043.430] (-4040.282) (-4050.688) * (-4039.779) (-4034.150) [-4039.338] (-4039.495) -- 0:04:37
      61500 -- (-4044.781) [-4039.001] (-4054.626) (-4042.861) * (-4049.376) (-4038.641) [-4035.721] (-4040.939) -- 0:04:34
      62000 -- (-4042.572) [-4037.495] (-4036.683) (-4042.928) * (-4042.211) (-4036.310) (-4040.038) [-4043.460] -- 0:04:47
      62500 -- (-4041.710) (-4040.462) [-4032.469] (-4038.101) * (-4032.338) [-4046.803] (-4042.454) (-4043.365) -- 0:04:45
      63000 -- (-4038.042) (-4034.766) (-4033.380) [-4038.534] * (-4041.334) [-4041.736] (-4035.913) (-4037.899) -- 0:04:42
      63500 -- (-4040.988) [-4037.736] (-4038.441) (-4049.191) * (-4038.108) [-4032.971] (-4036.473) (-4043.170) -- 0:04:40
      64000 -- (-4041.307) [-4036.776] (-4035.823) (-4048.592) * (-4041.562) (-4044.364) [-4034.950] (-4037.436) -- 0:04:37
      64500 -- [-4039.484] (-4038.692) (-4038.813) (-4045.100) * (-4043.224) (-4037.161) [-4034.502] (-4037.857) -- 0:04:35
      65000 -- (-4047.492) (-4034.299) [-4041.781] (-4048.091) * [-4035.029] (-4040.213) (-4033.169) (-4037.651) -- 0:04:33

      Average standard deviation of split frequencies: 0.031427

      65500 -- (-4045.435) (-4037.972) [-4036.175] (-4045.252) * (-4042.014) (-4036.987) [-4043.698] (-4043.115) -- 0:04:45
      66000 -- (-4047.514) (-4044.120) [-4039.723] (-4043.462) * (-4038.640) [-4037.803] (-4037.013) (-4045.142) -- 0:04:43
      66500 -- (-4043.248) [-4037.670] (-4036.432) (-4039.527) * [-4036.816] (-4033.740) (-4040.951) (-4040.897) -- 0:04:40
      67000 -- (-4052.690) (-4036.659) [-4038.548] (-4034.417) * (-4041.504) (-4034.384) [-4040.295] (-4048.376) -- 0:04:38
      67500 -- (-4041.891) [-4035.317] (-4039.504) (-4040.216) * (-4039.651) (-4041.838) [-4046.440] (-4045.682) -- 0:04:36
      68000 -- (-4039.639) (-4040.286) (-4036.644) [-4040.631] * (-4042.222) (-4043.351) [-4039.014] (-4036.536) -- 0:04:34
      68500 -- (-4046.125) (-4045.838) [-4035.642] (-4041.501) * (-4049.034) (-4035.090) (-4036.359) [-4036.110] -- 0:04:45
      69000 -- (-4046.521) (-4036.475) [-4046.610] (-4036.950) * (-4051.646) (-4035.826) [-4039.056] (-4039.214) -- 0:04:43
      69500 -- (-4039.995) (-4034.002) [-4046.504] (-4037.800) * (-4047.076) (-4033.953) (-4035.070) [-4035.557] -- 0:04:41
      70000 -- (-4042.161) (-4035.634) (-4036.482) [-4037.110] * (-4052.527) (-4039.953) (-4034.099) [-4037.033] -- 0:04:39

      Average standard deviation of split frequencies: 0.029352

      70500 -- (-4035.983) (-4041.856) (-4042.981) [-4035.285] * (-4052.223) (-4040.315) (-4044.871) [-4038.823] -- 0:04:36
      71000 -- (-4040.726) (-4037.215) [-4037.105] (-4038.746) * (-4045.054) (-4040.090) [-4039.853] (-4034.816) -- 0:04:34
      71500 -- [-4035.438] (-4036.651) (-4039.508) (-4037.917) * (-4050.873) [-4039.555] (-4047.173) (-4039.774) -- 0:04:32
      72000 -- (-4037.535) (-4040.665) [-4035.686] (-4045.059) * (-4043.736) (-4037.049) [-4036.396] (-4047.305) -- 0:04:43
      72500 -- [-4034.354] (-4035.192) (-4038.617) (-4041.279) * (-4045.285) (-4038.681) [-4043.628] (-4045.748) -- 0:04:41
      73000 -- [-4031.959] (-4044.598) (-4036.644) (-4041.499) * (-4042.385) [-4039.201] (-4036.338) (-4035.893) -- 0:04:39
      73500 -- (-4037.783) (-4039.148) (-4038.801) [-4037.379] * (-4045.563) [-4034.849] (-4035.149) (-4042.980) -- 0:04:37
      74000 -- (-4034.959) (-4038.356) (-4038.391) [-4039.004] * [-4045.326] (-4036.535) (-4039.420) (-4038.064) -- 0:04:35
      74500 -- (-4036.489) [-4036.799] (-4042.545) (-4034.883) * (-4035.424) (-4037.372) (-4034.923) [-4037.902] -- 0:04:33
      75000 -- (-4040.617) (-4042.634) [-4038.044] (-4040.599) * [-4048.549] (-4043.275) (-4041.669) (-4035.359) -- 0:04:31

      Average standard deviation of split frequencies: 0.029773

      75500 -- (-4034.405) [-4038.376] (-4046.803) (-4040.562) * (-4036.398) (-4037.838) [-4043.320] (-4038.503) -- 0:04:41
      76000 -- (-4039.092) (-4039.080) [-4044.377] (-4034.350) * (-4039.693) (-4041.376) (-4037.645) [-4037.519] -- 0:04:39
      76500 -- (-4037.888) (-4044.871) (-4051.006) [-4036.101] * (-4041.527) (-4038.145) [-4036.572] (-4046.863) -- 0:04:37
      77000 -- (-4041.184) (-4035.041) (-4048.853) [-4035.250] * (-4035.378) (-4043.691) [-4039.524] (-4033.423) -- 0:04:35
      77500 -- (-4042.918) [-4036.880] (-4037.565) (-4042.725) * (-4041.482) (-4045.027) (-4049.888) [-4037.842] -- 0:04:33
      78000 -- (-4039.636) (-4036.786) [-4045.373] (-4041.481) * (-4039.463) [-4036.855] (-4043.987) (-4042.449) -- 0:04:31
      78500 -- [-4038.046] (-4041.593) (-4044.288) (-4039.566) * [-4041.758] (-4035.543) (-4035.673) (-4042.274) -- 0:04:29
      79000 -- (-4041.046) (-4035.400) [-4041.676] (-4035.126) * [-4037.638] (-4040.484) (-4039.969) (-4042.201) -- 0:04:39
      79500 -- (-4036.897) [-4033.770] (-4037.157) (-4044.071) * [-4041.252] (-4042.533) (-4046.900) (-4047.071) -- 0:04:37
      80000 -- [-4034.255] (-4040.560) (-4038.767) (-4041.653) * (-4054.385) (-4045.012) (-4042.538) [-4041.252] -- 0:04:36

      Average standard deviation of split frequencies: 0.025713

      80500 -- (-4037.853) (-4042.937) [-4040.670] (-4042.384) * (-4047.860) (-4043.621) (-4043.247) [-4042.103] -- 0:04:34
      81000 -- [-4041.973] (-4044.506) (-4042.651) (-4040.506) * (-4051.439) (-4040.466) (-4043.318) [-4037.906] -- 0:04:32
      81500 -- (-4045.728) [-4037.948] (-4040.590) (-4033.730) * [-4037.569] (-4037.200) (-4047.616) (-4035.288) -- 0:04:30
      82000 -- (-4043.355) (-4040.358) (-4043.142) [-4036.715] * (-4045.503) [-4036.898] (-4049.786) (-4043.089) -- 0:04:28
      82500 -- (-4047.696) [-4037.295] (-4037.047) (-4040.482) * [-4036.318] (-4042.672) (-4039.546) (-4039.983) -- 0:04:38
      83000 -- (-4042.958) (-4046.270) (-4040.774) [-4040.098] * (-4038.923) (-4044.143) (-4032.314) [-4033.818] -- 0:04:36
      83500 -- (-4037.788) [-4034.856] (-4042.254) (-4037.666) * (-4041.291) [-4040.158] (-4041.652) (-4034.816) -- 0:04:34
      84000 -- [-4037.180] (-4041.781) (-4040.125) (-4040.229) * (-4046.555) [-4038.076] (-4034.239) (-4039.261) -- 0:04:32
      84500 -- [-4039.737] (-4052.976) (-4035.361) (-4046.203) * (-4044.008) (-4045.252) [-4042.611] (-4037.031) -- 0:04:30
      85000 -- (-4043.051) (-4048.136) (-4040.708) [-4042.911] * (-4040.906) [-4039.778] (-4037.100) (-4038.643) -- 0:04:29

      Average standard deviation of split frequencies: 0.021926

      85500 -- (-4044.532) (-4046.176) (-4038.570) [-4041.642] * (-4042.116) (-4039.459) (-4031.994) [-4036.817] -- 0:04:38
      86000 -- (-4040.508) [-4037.226] (-4042.675) (-4040.396) * [-4036.094] (-4036.197) (-4039.066) (-4039.144) -- 0:04:36
      86500 -- (-4034.028) (-4042.700) (-4036.312) [-4037.252] * (-4039.690) [-4035.840] (-4040.993) (-4044.122) -- 0:04:34
      87000 -- (-4036.240) (-4045.654) [-4044.983] (-4031.906) * (-4037.808) [-4036.222] (-4045.832) (-4036.090) -- 0:04:32
      87500 -- (-4037.763) (-4042.194) [-4033.561] (-4041.847) * (-4032.674) [-4037.348] (-4044.208) (-4042.198) -- 0:04:31
      88000 -- (-4038.695) [-4038.990] (-4042.762) (-4038.725) * [-4038.501] (-4037.487) (-4044.903) (-4039.828) -- 0:04:29
      88500 -- (-4035.824) (-4041.774) [-4036.027] (-4044.815) * (-4042.083) (-4042.144) [-4039.688] (-4037.790) -- 0:04:27
      89000 -- (-4038.458) [-4039.693] (-4040.919) (-4052.452) * [-4043.597] (-4039.817) (-4045.337) (-4038.073) -- 0:04:36
      89500 -- (-4037.243) (-4035.408) [-4040.041] (-4037.651) * (-4042.574) (-4041.173) [-4037.513] (-4042.587) -- 0:04:34
      90000 -- (-4047.998) (-4045.961) [-4041.585] (-4040.239) * (-4043.243) (-4039.436) [-4035.401] (-4034.160) -- 0:04:33

      Average standard deviation of split frequencies: 0.016638

      90500 -- (-4044.419) [-4044.188] (-4035.110) (-4047.553) * (-4039.481) (-4040.162) (-4040.628) [-4034.562] -- 0:04:31
      91000 -- (-4039.523) (-4043.621) [-4034.774] (-4045.676) * (-4039.508) (-4043.681) (-4034.226) [-4036.104] -- 0:04:29
      91500 -- (-4038.548) (-4036.685) [-4038.265] (-4042.790) * [-4043.947] (-4038.440) (-4036.112) (-4042.158) -- 0:04:28
      92000 -- (-4035.735) [-4037.723] (-4037.361) (-4041.552) * (-4038.553) [-4037.067] (-4040.815) (-4035.255) -- 0:04:26
      92500 -- (-4041.705) (-4037.325) (-4036.089) [-4036.214] * (-4040.445) (-4044.733) [-4034.218] (-4043.028) -- 0:04:34
      93000 -- [-4050.932] (-4040.258) (-4034.917) (-4035.481) * (-4043.114) (-4034.072) (-4045.955) [-4036.069] -- 0:04:33
      93500 -- (-4043.380) (-4047.975) (-4037.369) [-4037.579] * (-4045.804) (-4040.249) [-4031.534] (-4039.971) -- 0:04:31
      94000 -- [-4036.295] (-4038.838) (-4041.010) (-4039.137) * [-4040.689] (-4045.078) (-4039.566) (-4037.615) -- 0:04:29
      94500 -- [-4038.491] (-4043.623) (-4041.062) (-4034.608) * (-4048.681) (-4037.535) (-4033.572) [-4039.595] -- 0:04:28
      95000 -- [-4037.876] (-4039.816) (-4044.336) (-4038.571) * (-4046.346) (-4041.041) [-4033.834] (-4031.492) -- 0:04:26

      Average standard deviation of split frequencies: 0.017678

      95500 -- (-4040.454) (-4033.400) (-4044.671) [-4032.703] * (-4048.618) (-4043.772) [-4037.346] (-4034.212) -- 0:04:25
      96000 -- (-4040.239) (-4037.256) (-4044.213) [-4035.481] * (-4050.790) [-4039.825] (-4041.853) (-4039.005) -- 0:04:33
      96500 -- (-4036.880) [-4034.027] (-4041.891) (-4037.698) * (-4046.190) (-4048.995) [-4034.226] (-4040.397) -- 0:04:31
      97000 -- (-4037.778) [-4039.748] (-4051.026) (-4047.222) * (-4053.414) [-4046.370] (-4035.530) (-4036.812) -- 0:04:29
      97500 -- (-4038.751) (-4039.317) [-4041.339] (-4040.606) * (-4055.638) [-4037.470] (-4035.352) (-4037.478) -- 0:04:28
      98000 -- (-4037.831) (-4034.615) [-4042.644] (-4040.380) * (-4044.981) (-4036.676) (-4044.233) [-4040.084] -- 0:04:26
      98500 -- (-4036.740) (-4041.600) (-4046.226) [-4041.428] * (-4047.573) (-4036.100) (-4042.187) [-4036.530] -- 0:04:25
      99000 -- [-4035.545] (-4037.098) (-4035.578) (-4044.541) * (-4051.108) (-4034.440) [-4038.376] (-4036.240) -- 0:04:33
      99500 -- (-4042.156) [-4037.781] (-4039.767) (-4037.169) * (-4043.933) (-4047.572) (-4045.410) [-4043.495] -- 0:04:31
      100000 -- (-4041.457) (-4037.233) [-4041.617] (-4035.865) * (-4045.553) [-4035.604] (-4043.739) (-4049.030) -- 0:04:30

      Average standard deviation of split frequencies: 0.022478

      100500 -- [-4037.786] (-4043.695) (-4049.202) (-4036.373) * (-4048.748) (-4035.884) [-4037.530] (-4042.351) -- 0:04:28
      101000 -- (-4039.737) (-4030.985) [-4042.147] (-4037.113) * (-4044.949) (-4034.539) (-4047.705) [-4045.124] -- 0:04:27
      101500 -- [-4036.127] (-4044.784) (-4040.710) (-4040.296) * (-4039.692) (-4043.357) [-4040.087] (-4040.362) -- 0:04:25
      102000 -- [-4038.940] (-4037.221) (-4040.176) (-4042.844) * (-4036.522) [-4046.204] (-4039.652) (-4042.522) -- 0:04:24
      102500 -- (-4040.340) (-4035.526) (-4047.854) [-4049.156] * [-4040.530] (-4038.287) (-4037.282) (-4046.348) -- 0:04:31
      103000 -- [-4040.921] (-4038.659) (-4041.541) (-4039.922) * (-4042.400) (-4041.682) [-4037.477] (-4037.588) -- 0:04:29
      103500 -- (-4042.780) (-4035.202) [-4043.864] (-4043.632) * (-4040.547) [-4042.751] (-4042.491) (-4045.919) -- 0:04:28
      104000 -- (-4048.628) [-4038.918] (-4040.726) (-4043.799) * (-4039.672) (-4052.080) [-4047.282] (-4037.113) -- 0:04:27
      104500 -- (-4053.226) (-4036.161) (-4041.690) [-4033.994] * [-4037.692] (-4043.738) (-4037.707) (-4041.655) -- 0:04:25
      105000 -- [-4035.920] (-4038.154) (-4037.096) (-4042.461) * (-4035.266) (-4040.655) (-4045.348) [-4041.689] -- 0:04:24

      Average standard deviation of split frequencies: 0.016010

      105500 -- [-4035.935] (-4044.128) (-4040.452) (-4040.086) * [-4039.344] (-4034.212) (-4044.829) (-4040.432) -- 0:04:22
      106000 -- (-4042.157) (-4035.264) [-4033.444] (-4044.026) * (-4053.497) [-4035.921] (-4038.855) (-4040.330) -- 0:04:29
      106500 -- (-4034.368) (-4038.661) [-4033.807] (-4045.277) * (-4039.973) (-4044.560) (-4033.224) [-4039.957] -- 0:04:28
      107000 -- (-4042.264) (-4035.845) [-4038.568] (-4036.589) * [-4043.330] (-4036.912) (-4033.801) (-4041.044) -- 0:04:27
      107500 -- (-4029.993) (-4038.106) [-4034.883] (-4034.255) * (-4044.537) (-4049.634) (-4040.840) [-4037.765] -- 0:04:25
      108000 -- (-4038.080) [-4039.915] (-4037.911) (-4043.489) * (-4041.956) [-4038.408] (-4049.360) (-4037.922) -- 0:04:24
      108500 -- (-4040.104) [-4037.065] (-4042.898) (-4040.383) * (-4044.786) (-4044.368) (-4046.465) [-4041.720] -- 0:04:22
      109000 -- (-4043.265) (-4038.629) [-4038.490] (-4044.402) * [-4040.811] (-4044.236) (-4042.361) (-4039.079) -- 0:04:29
      109500 -- (-4044.960) (-4040.451) (-4047.828) [-4040.730] * (-4041.188) (-4037.738) [-4044.338] (-4037.153) -- 0:04:28
      110000 -- (-4035.550) (-4040.616) [-4044.667] (-4039.380) * [-4040.951] (-4039.374) (-4044.337) (-4048.801) -- 0:04:27

      Average standard deviation of split frequencies: 0.015335

      110500 -- (-4039.871) [-4039.876] (-4040.297) (-4034.239) * (-4046.184) (-4036.132) [-4037.024] (-4041.116) -- 0:04:25
      111000 -- [-4039.385] (-4036.289) (-4043.696) (-4042.324) * (-4039.125) [-4038.645] (-4041.168) (-4037.983) -- 0:04:24
      111500 -- (-4039.076) [-4038.238] (-4038.891) (-4039.608) * (-4041.151) [-4043.165] (-4052.460) (-4038.182) -- 0:04:22
      112000 -- [-4038.450] (-4034.867) (-4036.952) (-4044.021) * (-4043.244) [-4047.250] (-4042.235) (-4035.784) -- 0:04:21
      112500 -- (-4036.591) [-4043.111] (-4045.419) (-4044.203) * [-4039.988] (-4038.020) (-4039.413) (-4035.166) -- 0:04:28
      113000 -- [-4034.743] (-4039.663) (-4045.455) (-4039.480) * [-4037.859] (-4041.393) (-4039.279) (-4041.445) -- 0:04:26
      113500 -- (-4037.217) (-4041.815) (-4038.927) [-4046.836] * (-4040.695) [-4039.116] (-4045.688) (-4049.067) -- 0:04:25
      114000 -- (-4040.538) (-4036.207) [-4036.467] (-4036.832) * (-4035.650) (-4037.135) (-4046.109) [-4034.982] -- 0:04:24
      114500 -- (-4040.610) [-4037.507] (-4036.686) (-4042.762) * [-4040.957] (-4035.561) (-4035.331) (-4039.267) -- 0:04:22
      115000 -- (-4033.544) (-4042.360) (-4036.841) [-4041.604] * (-4039.142) (-4036.878) [-4037.080] (-4044.196) -- 0:04:21

      Average standard deviation of split frequencies: 0.014630

      115500 -- [-4041.692] (-4043.268) (-4036.359) (-4044.340) * (-4038.144) [-4039.028] (-4038.863) (-4035.357) -- 0:04:20
      116000 -- (-4037.515) [-4043.657] (-4041.519) (-4034.631) * [-4037.437] (-4044.202) (-4040.437) (-4036.812) -- 0:04:26
      116500 -- (-4039.340) [-4038.604] (-4043.407) (-4047.770) * (-4043.608) [-4038.660] (-4039.969) (-4042.468) -- 0:04:25
      117000 -- [-4038.122] (-4037.907) (-4041.639) (-4051.678) * [-4042.565] (-4044.039) (-4037.732) (-4038.049) -- 0:04:24
      117500 -- (-4036.345) [-4037.092] (-4040.507) (-4035.709) * (-4037.221) (-4041.287) [-4034.630] (-4044.470) -- 0:04:22
      118000 -- [-4036.844] (-4041.263) (-4037.608) (-4035.702) * [-4034.517] (-4043.619) (-4039.367) (-4040.501) -- 0:04:21
      118500 -- [-4037.461] (-4044.771) (-4038.732) (-4037.060) * (-4037.693) [-4034.924] (-4041.170) (-4040.763) -- 0:04:20
      119000 -- [-4037.944] (-4042.897) (-4036.216) (-4037.680) * (-4036.200) (-4039.829) [-4034.911] (-4046.032) -- 0:04:26
      119500 -- (-4038.731) (-4043.565) [-4035.663] (-4039.107) * (-4040.744) (-4034.547) (-4044.883) [-4042.157] -- 0:04:25
      120000 -- (-4041.165) (-4036.664) (-4040.913) [-4036.411] * (-4046.525) (-4035.079) (-4042.657) [-4037.590] -- 0:04:24

      Average standard deviation of split frequencies: 0.010939

      120500 -- (-4043.876) (-4043.565) (-4041.741) [-4036.383] * (-4046.090) (-4036.064) (-4040.931) [-4044.299] -- 0:04:22
      121000 -- [-4041.104] (-4041.522) (-4040.634) (-4042.218) * (-4041.180) [-4039.218] (-4042.234) (-4038.580) -- 0:04:21
      121500 -- (-4046.711) (-4037.725) (-4044.107) [-4040.738] * [-4041.117] (-4034.644) (-4034.557) (-4046.091) -- 0:04:20
      122000 -- (-4041.393) (-4040.529) [-4037.450] (-4040.017) * (-4038.573) (-4039.165) [-4035.351] (-4043.805) -- 0:04:19
      122500 -- (-4041.489) (-4040.692) (-4034.935) [-4037.178] * [-4034.622] (-4032.686) (-4039.452) (-4046.388) -- 0:04:25
      123000 -- [-4039.071] (-4044.493) (-4039.857) (-4049.125) * (-4039.804) [-4035.866] (-4043.787) (-4039.961) -- 0:04:23
      123500 -- (-4042.550) (-4037.895) (-4035.090) [-4042.326] * (-4046.618) (-4037.734) (-4045.171) [-4049.590] -- 0:04:22
      124000 -- [-4036.196] (-4036.719) (-4039.750) (-4044.650) * (-4042.230) (-4042.848) [-4035.473] (-4038.531) -- 0:04:21
      124500 -- (-4040.298) (-4037.740) (-4036.713) [-4043.905] * [-4036.250] (-4046.010) (-4040.075) (-4041.911) -- 0:04:20
      125000 -- (-4042.433) [-4037.788] (-4042.770) (-4036.340) * (-4041.518) (-4039.773) (-4035.650) [-4038.466] -- 0:04:19

      Average standard deviation of split frequencies: 0.010476

      125500 -- [-4043.288] (-4040.686) (-4043.566) (-4046.639) * (-4033.325) (-4040.727) (-4040.869) [-4039.009] -- 0:04:17
      126000 -- [-4033.832] (-4035.548) (-4045.604) (-4041.717) * (-4037.136) [-4042.116] (-4043.209) (-4041.641) -- 0:04:23
      126500 -- (-4030.116) (-4046.927) [-4043.778] (-4042.318) * [-4035.455] (-4035.337) (-4032.246) (-4031.339) -- 0:04:22
      127000 -- [-4034.971] (-4044.842) (-4037.721) (-4048.952) * (-4042.096) (-4037.218) [-4036.447] (-4037.408) -- 0:04:21
      127500 -- (-4041.076) [-4033.088] (-4037.533) (-4046.584) * (-4044.974) (-4035.128) (-4037.454) [-4036.026] -- 0:04:20
      128000 -- (-4040.460) [-4036.328] (-4035.811) (-4042.496) * (-4035.126) [-4034.742] (-4043.942) (-4035.232) -- 0:04:18
      128500 -- (-4041.521) (-4037.991) [-4036.929] (-4038.050) * (-4042.258) (-4031.216) [-4033.960] (-4040.679) -- 0:04:17
      129000 -- (-4037.399) (-4034.337) [-4042.331] (-4042.395) * (-4045.427) (-4036.116) [-4035.377] (-4040.123) -- 0:04:16
      129500 -- (-4037.599) (-4038.145) [-4037.470] (-4043.793) * (-4038.987) (-4035.104) [-4035.716] (-4035.566) -- 0:04:22
      130000 -- (-4042.397) [-4044.638] (-4039.058) (-4048.396) * [-4037.345] (-4035.642) (-4036.108) (-4036.223) -- 0:04:21

      Average standard deviation of split frequencies: 0.010102

      130500 -- (-4039.492) (-4043.531) [-4044.065] (-4046.112) * [-4038.969] (-4044.304) (-4043.600) (-4040.098) -- 0:04:19
      131000 -- [-4034.532] (-4039.921) (-4037.083) (-4038.653) * (-4043.527) [-4035.465] (-4042.669) (-4038.202) -- 0:04:18
      131500 -- (-4039.776) (-4041.404) [-4040.068] (-4049.233) * (-4039.195) [-4036.124] (-4040.777) (-4038.878) -- 0:04:17
      132000 -- [-4042.546] (-4034.921) (-4041.004) (-4046.567) * [-4041.611] (-4046.746) (-4037.556) (-4042.567) -- 0:04:16
      132500 -- (-4036.777) (-4033.417) [-4036.136] (-4041.562) * (-4043.609) (-4043.816) [-4040.750] (-4042.990) -- 0:04:15
      133000 -- (-4036.602) [-4032.880] (-4038.176) (-4039.996) * [-4034.364] (-4044.268) (-4042.532) (-4040.745) -- 0:04:20
      133500 -- [-4040.775] (-4030.825) (-4033.785) (-4044.065) * (-4042.059) (-4035.550) [-4042.140] (-4037.345) -- 0:04:19
      134000 -- (-4055.386) [-4043.649] (-4036.808) (-4041.061) * (-4037.194) (-4037.797) [-4038.144] (-4037.141) -- 0:04:18
      134500 -- [-4041.568] (-4045.218) (-4045.778) (-4035.782) * (-4047.066) (-4043.424) (-4038.642) [-4033.776] -- 0:04:17
      135000 -- (-4041.790) [-4045.467] (-4042.731) (-4041.541) * [-4042.944] (-4043.807) (-4041.004) (-4039.051) -- 0:04:16

      Average standard deviation of split frequencies: 0.006932

      135500 -- (-4035.831) (-4035.486) (-4035.039) [-4041.902] * (-4036.368) (-4039.601) (-4039.962) [-4039.543] -- 0:04:15
      136000 -- (-4039.007) (-4038.549) (-4037.886) [-4036.855] * [-4030.786] (-4044.133) (-4039.914) (-4043.235) -- 0:04:20
      136500 -- [-4037.410] (-4049.763) (-4038.035) (-4036.000) * (-4035.471) (-4039.403) (-4042.393) [-4036.304] -- 0:04:19
      137000 -- [-4038.054] (-4040.865) (-4047.688) (-4036.838) * [-4034.743] (-4045.622) (-4040.866) (-4045.805) -- 0:04:18
      137500 -- [-4032.722] (-4041.011) (-4043.506) (-4035.476) * (-4038.214) (-4039.511) [-4036.276] (-4039.634) -- 0:04:17
      138000 -- (-4034.906) (-4044.114) [-4039.236] (-4033.218) * [-4042.591] (-4044.517) (-4037.161) (-4039.180) -- 0:04:16
      138500 -- [-4030.742] (-4053.565) (-4044.145) (-4036.373) * [-4042.571] (-4041.790) (-4036.992) (-4040.217) -- 0:04:15
      139000 -- (-4045.717) [-4036.558] (-4034.163) (-4032.873) * (-4049.220) [-4038.238] (-4039.733) (-4045.233) -- 0:04:13
      139500 -- (-4043.738) (-4041.539) [-4039.505] (-4037.925) * (-4039.108) (-4040.114) [-4040.683] (-4038.250) -- 0:04:19
      140000 -- [-4046.816] (-4036.132) (-4040.032) (-4039.690) * (-4033.934) (-4041.249) [-4038.545] (-4037.800) -- 0:04:18

      Average standard deviation of split frequencies: 0.006702

      140500 -- [-4035.897] (-4036.869) (-4046.322) (-4040.681) * (-4035.151) [-4037.603] (-4037.653) (-4041.849) -- 0:04:16
      141000 -- [-4043.139] (-4040.354) (-4035.062) (-4044.415) * (-4034.164) [-4036.361] (-4039.440) (-4041.115) -- 0:04:15
      141500 -- (-4035.275) (-4038.700) [-4036.830] (-4038.490) * [-4045.947] (-4033.786) (-4032.737) (-4046.192) -- 0:04:14
      142000 -- (-4040.981) (-4036.384) (-4046.740) [-4044.703] * (-4040.974) (-4039.399) (-4044.401) [-4034.734] -- 0:04:13
      142500 -- (-4043.044) (-4033.215) [-4039.271] (-4044.548) * [-4036.795] (-4041.801) (-4038.460) (-4033.525) -- 0:04:12
      143000 -- [-4033.286] (-4036.594) (-4041.207) (-4047.006) * (-4033.202) (-4043.809) (-4041.756) [-4036.180] -- 0:04:17
      143500 -- (-4038.130) (-4046.043) (-4037.954) [-4036.527] * (-4044.080) [-403