--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:11:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/parA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1470.90         -1474.89
2      -1470.86         -1476.08
--------------------------------------
TOTAL    -1470.88         -1475.65
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.867139    0.086931    0.330989    1.453302    0.836709   1288.10   1349.43    1.000
r(A<->C){all}   0.132010    0.015340    0.000031    0.383416    0.094664    197.22    214.73    1.000
r(A<->G){all}   0.169850    0.021127    0.000064    0.467639    0.133273    152.01    206.51    1.002
r(A<->T){all}   0.173418    0.022179    0.000041    0.478055    0.131881    158.94    215.29    1.001
r(C<->G){all}   0.127226    0.014711    0.000043    0.381423    0.088599    214.29    287.97    1.000
r(C<->T){all}   0.220246    0.025780    0.000627    0.526542    0.192297    142.10    175.22    1.000
r(G<->T){all}   0.177250    0.022066    0.000089    0.469841    0.139291    181.80    230.99    1.002
pi(A){all}      0.247212    0.000180    0.221184    0.273213    0.247008   1191.47   1346.23    1.000
pi(C){all}      0.221367    0.000161    0.198337    0.246454    0.221084   1260.95   1314.25    1.000
pi(G){all}      0.260946    0.000182    0.236151    0.288769    0.260777   1335.34   1378.59    1.000
pi(T){all}      0.270475    0.000193    0.242576    0.296859    0.270114   1380.15   1410.79    1.000
alpha{1,2}      0.240804    0.073801    0.000207    0.765286    0.160054   1026.51   1168.57    1.000
alpha{3}        0.404962    0.222629    0.000105    1.336810    0.238268   1167.55   1326.98    1.002
pinvar{all}     0.996653    0.000007    0.991400    0.999911    0.997347   1359.86   1430.43    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1426.1426
Model 2: PositiveSelection	-1425.758397
Model 0: one-ratio	-1425.758257
Model 7: beta	-1426.142597
Model 8: beta&w>1	-1425.758396


Model 0 vs 1	0.7686859999998887

Model 2 vs 1	0.7684059999996862

Model 8 vs 7	0.768402000000151
>C1
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C2
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C3
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C4
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C5
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C6
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGFKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=351 

C1              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C2              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C3              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C4              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C5              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C6              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
                **************************************************

C1              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C2              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C3              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C4              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C5              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C6              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
                **************************************************

C1              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C2              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C3              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C4              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C5              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C6              GVGKTTTAVNLAAALALQGFKALVIDLDPQGNASTALGISNRQSRVFSSY
                *******************:******************************

C1              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C2              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C3              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C4              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C5              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C6              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
                **************************************************

C1              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C2              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C3              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C4              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C5              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C6              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
                **************************************************

C1              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C2              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C3              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C4              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C5              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C6              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
                **************************************************

C1              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C2              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C3              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C4              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C5              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C6              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
                **************************************************

C1              G
C2              G
C3              G
C4              G
C5              G
C6              G
                *




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  351 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  351 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10530]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10530]--->[10530]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.520 Mb, Max= 30.922 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C2              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C3              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C4              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C5              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
C6              MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
                **************************************************

C1              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C2              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C3              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C4              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C5              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
C6              EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
                **************************************************

C1              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C2              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C3              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C4              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C5              GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
C6              GVGKTTTAVNLAAALALQGFKALVIDLDPQGNASTALGISNRQSRVFSSY
                *******************:******************************

C1              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C2              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C3              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C4              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C5              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
C6              DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
                **************************************************

C1              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C2              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C3              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C4              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C5              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
C6              ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
                **************************************************

C1              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C2              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C3              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C4              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C5              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
C6              QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
                **************************************************

C1              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C2              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C3              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C4              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C5              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
C6              QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
                **************************************************

C1              G
C2              G
C3              G
C4              G
C5              G
C6              G
                *




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.72 C1	 C6	 99.72
TOP	    5    0	 99.72 C6	 C1	 99.72
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.72 C2	 C6	 99.72
TOP	    5    1	 99.72 C6	 C2	 99.72
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.72 C3	 C6	 99.72
TOP	    5    2	 99.72 C6	 C3	 99.72
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.72 C4	 C6	 99.72
TOP	    5    3	 99.72 C6	 C4	 99.72
BOT	    4    5	 99.72 C5	 C6	 99.72
TOP	    5    4	 99.72 C6	 C5	 99.72
AVG	 0	 C1	  *	 99.94
AVG	 1	 C2	  *	 99.94
AVG	 2	 C3	  *	 99.94
AVG	 3	 C4	  *	 99.94
AVG	 4	 C5	  *	 99.94
AVG	 5	 C6	  *	 99.72
TOT	 TOT	  *	 99.91
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
C2              ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
C3              ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
C4              ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
C5              ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
C6              ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
                **************************************************

C1              TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
C2              TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
C3              TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
C4              TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
C5              TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
C6              TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
                **************************************************

C1              CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
C2              CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
C3              CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
C4              CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
C5              CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
C6              CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
                **************************************************

C1              GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
C2              GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
C3              GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
C4              GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
C5              GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
C6              GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
                **************************************************

C1              GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
C2              GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
C3              GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
C4              GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
C5              GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
C6              GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
                **************************************************

C1              TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
C2              TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
C3              TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
C4              TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
C5              TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
C6              TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
                **************************************************

C1              GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
C2              GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
C3              GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
C4              GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
C5              GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
C6              GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
                **************************************************

C1              TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
C2              TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
C3              TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
C4              TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
C5              TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
C6              TCAAGGATTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
                ******* ******************************************

C1              GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
C2              GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
C3              GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
C4              GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
C5              GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
C6              GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
                **************************************************

C1              GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
C2              GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
C3              GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
C4              GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
C5              GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
C6              GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
                **************************************************

C1              ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
C2              ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
C3              ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
C4              ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
C5              ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
C6              ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
                **************************************************

C1              CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
C2              CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
C3              CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
C4              CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
C5              CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
C6              CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
                **************************************************

C1              GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
C2              GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
C3              GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
C4              GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
C5              GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
C6              GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
                **************************************************

C1              CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
C2              CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
C3              CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
C4              CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
C5              CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
C6              CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
                **************************************************

C1              AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
C2              AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
C3              AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
C4              AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
C5              AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
C6              AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
                **************************************************

C1              CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
C2              CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
C3              CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
C4              CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
C5              CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
C6              CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
                **************************************************

C1              TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
C2              TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
C3              TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
C4              TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
C5              TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
C6              TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
                **************************************************

C1              CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
C2              CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
C3              CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
C4              CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
C5              CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
C6              CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
                **************************************************

C1              CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
C2              CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
C3              CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
C4              CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
C5              CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
C6              CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
                **************************************************

C1              CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
C2              CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
C3              CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
C4              CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
C5              CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
C6              CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
                **************************************************

C1              TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
C2              TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
C3              TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
C4              TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
C5              TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
C6              TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
                **************************************************

C1              GGA
C2              GGA
C3              GGA
C4              GGA
C5              GGA
C6              GGA
                ***



>C1
ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
GGA
>C2
ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
GGA
>C3
ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
GGA
>C4
ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
GGA
>C5
ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
TCAAGGACTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
GGA
>C6
ATGAGTTCTCTTCAGGGTTGGGTTGACACCCCAGCTTTGTGGTCGGCCAG
TCTTACTGATCAGTCAGCTTTGTTATCGAGTGAAATACAAAAAACACCAC
CAGAGCCAATGTTTAGGCAAGAAGCCTATTACGACGCAGAATGTGTTGTT
GAAATGAATGTTTCACATGAAACAACAAATGAACTCGACACTCCAATCGG
GGCTGCAGCAGAACGGGCTATGCGGGTTCTTCACACCACATATGACCCAT
TGTGTCGTCCATGCCATCGGCGGTTGTTCACTATTGCGAACCAGAAGGGT
GGTGTGGGCAAGACTACTACTGCTGTTAATCTTGCGGCAGCATTGGCACT
TCAAGGATTTAAGGCGCTTGTTATTGATCTTGATCCCCAAGGTAATGCTA
GTACGGCGCTCGGTATCAGTAACCGGCAATCACGCGTGTTTTCATCGTAT
GATGTGCTCATTGGTGAAGTTTCGTTGCAGACTGCTTTGCGATGCAGCCC
ATATAACGAGCGTTTGTTTTGTCTTCCGGCCGCAATAGATCTGGCGGGTG
CTGAGATCGAATTAGTTAGTATGGTGGCGCGAGAAAACCGATTACGTACC
GCTTTAACTGAGCTTAACGACTTGGATTTTGATTATGTCTTTATTGACTG
CCCGCCGTCATTGGGATTACTGACAATAAATGCACTTGTCGCGGCACCAG
AGGTGATAATTCCGATTCAGTGTGAATACTATGCGCTTGAGGGTGTATCA
CAGTTGATGTGCAACATTGAGATGGTTAAGGCCCACCTCAATCCTCAGCT
TGAGGTAACCACTGTAATTCTTACGATGTATGACGGTCGGACAAAGCTCG
CCGACCAGGTGGCTGAAGAGGTTCGCCGGTACTTTGGAACGAAAGTGTTG
CAAACAGTGATTCCACGCAGTGTCAAAGTCTCGGAGGCTCCTGGTTATAG
CATGACTATCATAGATTATGATCCTGGTTCGCGTGGGGCAATGAGTTACC
TTGATGCAAGCCGAGAGCTCGCCGAGCGTGATCAACCACCATCGATGAAG
GGA
>C1
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C2
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C3
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C4
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C5
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G
>C6
MSSLQGWVDTPALWSASLTDQSALLSSEIQKTPPEPMFRQEAYYDAECVV
EMNVSHETTNELDTPIGAAAERAMRVLHTTYDPLCRPCHRRLFTIANQKG
GVGKTTTAVNLAAALALQGFKALVIDLDPQGNASTALGISNRQSRVFSSY
DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRT
ALTELNDLDFDYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVS
QLMCNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVAEEVRRYFGTKVL
QTVIPRSVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDQPPSMK
G


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1053 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785021
      Setting output file names to "/data/10res/parA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 779019158
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9472370972
      Seed = 1512164474
      Swapseed = 1579785021
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2360.066916 -- -24.965149
         Chain 2 -- -2360.067205 -- -24.965149
         Chain 3 -- -2360.067341 -- -24.965149
         Chain 4 -- -2360.067205 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2360.065791 -- -24.965149
         Chain 2 -- -2360.067205 -- -24.965149
         Chain 3 -- -2360.065791 -- -24.965149
         Chain 4 -- -2360.067341 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2360.067] (-2360.067) (-2360.067) (-2360.067) * [-2360.066] (-2360.067) (-2360.066) (-2360.067) 
        500 -- (-1479.882) (-1480.291) [-1477.428] (-1478.498) * (-1474.607) (-1476.892) (-1479.383) [-1479.135] -- 0:33:19
       1000 -- [-1474.455] (-1479.077) (-1477.066) (-1472.408) * (-1477.410) (-1481.370) (-1478.968) [-1476.756] -- 0:16:39
       1500 -- (-1473.973) (-1478.241) [-1475.219] (-1479.777) * (-1475.049) (-1473.566) [-1472.364] (-1476.363) -- 0:11:05
       2000 -- [-1477.156] (-1478.855) (-1483.765) (-1476.073) * [-1472.715] (-1474.952) (-1476.697) (-1482.097) -- 0:08:19
       2500 -- (-1480.079) (-1481.666) [-1476.861] (-1481.386) * (-1469.646) (-1477.395) (-1475.610) [-1473.441] -- 0:06:39
       3000 -- [-1476.763] (-1483.986) (-1471.974) (-1488.589) * (-1480.637) [-1479.700] (-1481.868) (-1478.984) -- 0:05:32
       3500 -- [-1481.118] (-1483.326) (-1473.398) (-1476.546) * (-1480.386) (-1474.508) (-1477.133) [-1474.432] -- 0:04:44
       4000 -- (-1479.422) (-1474.362) (-1474.237) [-1474.982] * (-1476.066) [-1472.313] (-1479.768) (-1482.207) -- 0:04:09
       4500 -- (-1479.875) [-1478.389] (-1472.392) (-1475.526) * (-1471.785) [-1474.903] (-1485.245) (-1474.486) -- 0:03:41
       5000 -- (-1478.902) (-1477.519) [-1471.993] (-1475.809) * [-1473.031] (-1474.532) (-1488.708) (-1475.834) -- 0:03:19

      Average standard deviation of split frequencies: 0.082309

       5500 -- (-1479.424) (-1478.241) [-1474.239] (-1471.285) * [-1475.667] (-1479.731) (-1475.137) (-1484.720) -- 0:03:00
       6000 -- (-1473.882) (-1483.092) [-1477.861] (-1480.249) * (-1477.645) (-1476.970) [-1476.329] (-1484.401) -- 0:02:45
       6500 -- (-1475.643) (-1479.308) [-1477.005] (-1479.186) * [-1476.327] (-1476.796) (-1477.659) (-1474.584) -- 0:02:32
       7000 -- [-1470.105] (-1477.778) (-1473.312) (-1475.946) * (-1480.898) [-1472.841] (-1472.803) (-1481.485) -- 0:02:21
       7500 -- [-1471.952] (-1476.673) (-1479.005) (-1479.800) * (-1476.986) (-1472.513) [-1471.466] (-1472.060) -- 0:02:12
       8000 -- (-1476.550) [-1480.249] (-1478.214) (-1477.797) * [-1473.165] (-1477.720) (-1477.024) (-1471.855) -- 0:02:04
       8500 -- (-1474.304) (-1482.532) (-1478.546) [-1475.875] * (-1474.429) [-1471.907] (-1476.215) (-1471.203) -- 0:01:56
       9000 -- (-1474.333) (-1473.773) (-1477.959) [-1471.180] * (-1477.519) (-1484.585) (-1479.818) [-1471.939] -- 0:01:50
       9500 -- (-1471.834) [-1470.348] (-1478.915) (-1477.295) * [-1471.510] (-1471.910) (-1477.797) (-1473.375) -- 0:01:44
      10000 -- [-1476.259] (-1480.987) (-1474.995) (-1485.529) * (-1479.928) (-1478.014) [-1473.569] (-1469.994) -- 0:01:39

      Average standard deviation of split frequencies: 0.069780

      10500 -- (-1477.393) (-1474.539) [-1475.512] (-1487.424) * (-1477.323) [-1471.154] (-1474.004) (-1471.708) -- 0:01:34
      11000 -- (-1471.664) (-1481.836) (-1493.261) [-1478.804] * (-1474.033) (-1480.010) (-1475.664) [-1472.459] -- 0:01:29
      11500 -- (-1471.584) (-1479.476) [-1475.948] (-1475.550) * [-1476.776] (-1483.163) (-1474.130) (-1476.517) -- 0:01:25
      12000 -- [-1473.784] (-1476.445) (-1478.147) (-1473.979) * [-1474.936] (-1472.055) (-1473.548) (-1474.735) -- 0:01:22
      12500 -- (-1475.997) (-1472.704) [-1471.609] (-1475.375) * (-1472.124) [-1474.269] (-1471.988) (-1479.474) -- 0:01:19
      13000 -- [-1468.466] (-1476.746) (-1479.135) (-1480.755) * (-1474.353) [-1472.633] (-1469.367) (-1474.774) -- 0:01:15
      13500 -- [-1478.456] (-1472.914) (-1477.051) (-1476.581) * (-1476.125) (-1471.665) [-1471.835] (-1472.810) -- 0:01:13
      14000 -- (-1492.964) (-1470.461) [-1471.190] (-1475.093) * [-1477.385] (-1469.431) (-1470.060) (-1472.895) -- 0:02:20
      14500 -- (-1473.478) (-1470.634) [-1471.107] (-1484.024) * (-1477.676) [-1473.381] (-1468.684) (-1472.533) -- 0:02:15
      15000 -- (-1474.789) (-1470.354) (-1476.037) [-1474.453] * (-1477.399) (-1482.932) [-1469.744] (-1473.209) -- 0:02:11

      Average standard deviation of split frequencies: 0.060476

      15500 -- (-1469.650) (-1473.103) (-1486.295) [-1475.863] * (-1474.593) (-1474.804) (-1470.969) [-1470.306] -- 0:02:07
      16000 -- (-1469.893) (-1473.124) (-1473.954) [-1478.359] * (-1484.329) (-1475.718) (-1471.720) [-1471.471] -- 0:02:03
      16500 -- (-1472.666) (-1473.796) (-1476.190) [-1473.686] * [-1477.623] (-1476.222) (-1470.110) (-1468.455) -- 0:01:59
      17000 -- [-1469.471] (-1478.419) (-1481.926) (-1473.322) * (-1477.834) [-1467.788] (-1470.744) (-1475.509) -- 0:01:55
      17500 -- (-1471.184) [-1474.375] (-1480.779) (-1476.170) * (-1483.029) [-1476.013] (-1471.189) (-1471.400) -- 0:01:52
      18000 -- (-1472.747) (-1472.002) (-1477.336) [-1474.651] * [-1474.134] (-1481.942) (-1470.242) (-1473.568) -- 0:01:49
      18500 -- (-1472.940) (-1475.300) [-1472.559] (-1477.453) * [-1471.998] (-1485.847) (-1470.477) (-1468.499) -- 0:01:46
      19000 -- (-1473.813) (-1476.692) [-1477.171] (-1476.724) * [-1474.547] (-1476.608) (-1471.094) (-1471.144) -- 0:01:43
      19500 -- (-1472.007) (-1478.036) (-1479.234) [-1478.334] * (-1481.647) (-1480.557) (-1471.440) [-1469.015] -- 0:01:40
      20000 -- [-1474.808] (-1474.254) (-1477.674) (-1476.619) * (-1479.516) [-1474.029] (-1472.849) (-1472.904) -- 0:01:38

      Average standard deviation of split frequencies: 0.062094

      20500 -- (-1470.308) (-1470.650) [-1477.538] (-1480.108) * [-1481.653] (-1475.113) (-1470.134) (-1470.951) -- 0:01:35
      21000 -- (-1471.336) (-1471.378) [-1471.843] (-1486.864) * (-1480.095) (-1473.138) [-1472.157] (-1470.248) -- 0:01:33
      21500 -- (-1470.808) (-1472.803) [-1474.045] (-1478.447) * (-1482.272) (-1472.816) (-1474.326) [-1472.181] -- 0:01:31
      22000 -- (-1470.284) [-1470.715] (-1480.557) (-1479.966) * (-1487.751) (-1473.236) (-1473.168) [-1470.625] -- 0:01:28
      22500 -- (-1471.811) (-1469.932) [-1471.385] (-1476.628) * (-1480.099) (-1477.985) [-1472.774] (-1470.620) -- 0:01:26
      23000 -- [-1470.369] (-1470.626) (-1480.229) (-1476.994) * (-1481.387) [-1472.801] (-1473.973) (-1472.364) -- 0:01:24
      23500 -- (-1471.486) (-1470.845) [-1477.123] (-1480.589) * [-1484.067] (-1472.291) (-1474.790) (-1468.811) -- 0:01:23
      24000 -- (-1475.613) (-1470.846) (-1477.033) [-1476.917] * [-1472.347] (-1473.880) (-1474.094) (-1469.350) -- 0:01:21
      24500 -- (-1469.906) (-1473.587) [-1479.758] (-1478.307) * [-1473.104] (-1471.398) (-1472.956) (-1470.871) -- 0:01:19
      25000 -- (-1469.210) (-1472.032) (-1484.676) [-1475.334] * (-1478.008) [-1469.410] (-1475.326) (-1469.269) -- 0:01:18

      Average standard deviation of split frequencies: 0.040579

      25500 -- (-1468.771) (-1469.758) [-1477.414] (-1495.142) * (-1475.513) [-1469.956] (-1474.133) (-1470.103) -- 0:01:16
      26000 -- (-1471.146) (-1476.227) (-1479.963) [-1480.332] * (-1482.554) [-1469.986] (-1473.103) (-1472.104) -- 0:01:14
      26500 -- (-1473.708) (-1472.334) [-1472.979] (-1475.313) * (-1476.488) (-1473.314) (-1476.228) [-1470.951] -- 0:01:13
      27000 -- (-1471.687) (-1472.722) [-1471.732] (-1473.163) * (-1477.131) (-1474.325) (-1474.763) [-1470.561] -- 0:01:12
      27500 -- (-1472.742) [-1476.318] (-1474.686) (-1473.331) * [-1471.491] (-1472.973) (-1475.518) (-1471.074) -- 0:01:10
      28000 -- (-1478.587) [-1474.630] (-1470.613) (-1473.065) * (-1471.153) (-1473.283) (-1472.766) [-1471.220] -- 0:01:09
      28500 -- [-1473.622] (-1470.222) (-1475.003) (-1471.987) * (-1470.689) (-1474.698) (-1472.854) [-1471.969] -- 0:01:42
      29000 -- (-1475.441) (-1472.456) [-1478.487] (-1472.323) * [-1469.617] (-1473.911) (-1472.648) (-1472.736) -- 0:01:40
      29500 -- (-1474.443) [-1470.235] (-1476.408) (-1472.612) * (-1471.826) (-1472.732) [-1473.889] (-1470.018) -- 0:01:38
      30000 -- (-1477.909) (-1472.109) (-1476.220) [-1472.443] * (-1474.380) (-1475.641) (-1475.119) [-1468.595] -- 0:01:37

      Average standard deviation of split frequencies: 0.034789

      30500 -- (-1474.704) [-1471.651] (-1478.952) (-1469.591) * (-1472.964) [-1474.511] (-1475.656) (-1468.935) -- 0:01:35
      31000 -- (-1474.282) (-1474.806) (-1479.976) [-1472.184] * (-1477.158) (-1475.288) (-1473.352) [-1470.731] -- 0:01:33
      31500 -- [-1470.672] (-1470.378) (-1477.423) (-1471.350) * (-1477.158) (-1472.892) (-1473.226) [-1470.625] -- 0:01:32
      32000 -- [-1468.872] (-1474.409) (-1475.022) (-1469.462) * (-1473.652) [-1470.029] (-1473.629) (-1474.208) -- 0:01:30
      32500 -- [-1470.798] (-1472.893) (-1473.606) (-1470.652) * (-1472.343) (-1470.140) (-1474.728) [-1471.768] -- 0:01:29
      33000 -- [-1469.765] (-1473.831) (-1473.923) (-1472.260) * (-1474.210) [-1470.737] (-1474.691) (-1474.327) -- 0:01:27
      33500 -- [-1469.737] (-1474.004) (-1472.272) (-1472.184) * (-1473.270) (-1471.356) [-1476.729] (-1475.104) -- 0:01:26
      34000 -- (-1468.636) [-1474.614] (-1473.206) (-1471.402) * [-1472.564] (-1471.847) (-1473.709) (-1472.229) -- 0:01:25
      34500 -- [-1470.983] (-1474.922) (-1471.598) (-1471.002) * [-1476.985] (-1471.262) (-1473.403) (-1473.836) -- 0:01:23
      35000 -- [-1475.572] (-1475.959) (-1469.386) (-1472.296) * [-1473.755] (-1470.129) (-1473.937) (-1472.453) -- 0:01:22

      Average standard deviation of split frequencies: 0.035838

      35500 -- (-1473.845) (-1475.735) (-1471.246) [-1471.225] * (-1473.851) (-1472.637) [-1473.420] (-1472.556) -- 0:01:21
      36000 -- (-1475.569) [-1473.460] (-1473.566) (-1471.507) * (-1471.004) (-1471.974) [-1472.655] (-1472.976) -- 0:01:20
      36500 -- (-1469.205) (-1470.809) (-1473.018) [-1469.001] * [-1471.423] (-1472.157) (-1471.108) (-1473.622) -- 0:01:19
      37000 -- (-1469.419) (-1468.866) (-1472.453) [-1474.160] * (-1474.067) (-1471.503) (-1472.221) [-1474.717] -- 0:01:18
      37500 -- (-1470.303) (-1472.051) (-1470.756) [-1471.913] * (-1471.328) (-1471.108) (-1473.845) [-1473.340] -- 0:01:17
      38000 -- [-1471.397] (-1471.321) (-1470.459) (-1476.049) * (-1472.268) [-1470.936] (-1472.747) (-1474.652) -- 0:01:15
      38500 -- (-1470.199) [-1474.861] (-1471.210) (-1477.034) * [-1469.729] (-1469.347) (-1473.793) (-1471.693) -- 0:01:14
      39000 -- [-1471.956] (-1470.844) (-1471.380) (-1474.933) * [-1472.682] (-1472.142) (-1473.153) (-1470.861) -- 0:01:13
      39500 -- [-1470.049] (-1473.232) (-1474.499) (-1472.366) * (-1471.067) [-1470.277] (-1473.922) (-1473.812) -- 0:01:12
      40000 -- (-1472.005) (-1469.307) (-1473.248) [-1469.265] * (-1472.433) [-1471.271] (-1473.309) (-1469.748) -- 0:01:12

      Average standard deviation of split frequencies: 0.033412

      40500 -- (-1470.633) (-1472.088) (-1472.632) [-1470.768] * [-1469.891] (-1470.813) (-1475.403) (-1470.461) -- 0:01:11
      41000 -- (-1474.536) (-1472.333) [-1473.438] (-1469.967) * (-1471.160) (-1468.599) [-1470.545] (-1474.710) -- 0:01:10
      41500 -- (-1470.517) [-1473.434] (-1473.091) (-1472.342) * (-1469.538) (-1471.996) (-1473.848) [-1470.908] -- 0:01:09
      42000 -- (-1469.521) (-1474.442) [-1471.949] (-1469.389) * [-1472.047] (-1470.832) (-1474.753) (-1474.338) -- 0:01:08
      42500 -- (-1470.415) (-1474.916) (-1472.350) [-1471.916] * (-1472.581) (-1473.838) (-1474.254) [-1474.557] -- 0:01:30
      43000 -- (-1475.462) (-1472.332) (-1473.875) [-1470.407] * [-1472.968] (-1471.437) (-1475.285) (-1470.961) -- 0:01:29
      43500 -- (-1470.298) (-1471.847) [-1472.396] (-1469.043) * (-1474.487) [-1469.863] (-1473.903) (-1469.912) -- 0:01:27
      44000 -- (-1472.600) (-1470.066) [-1471.015] (-1471.243) * [-1472.445] (-1473.209) (-1473.598) (-1471.744) -- 0:01:26
      44500 -- (-1469.905) [-1473.544] (-1472.897) (-1469.248) * (-1472.385) (-1471.230) (-1474.868) [-1471.157] -- 0:01:25
      45000 -- (-1471.137) (-1470.781) (-1473.985) [-1474.322] * (-1472.710) [-1473.725] (-1473.115) (-1469.475) -- 0:01:24

      Average standard deviation of split frequencies: 0.028047

      45500 -- (-1469.329) (-1470.500) (-1474.491) [-1470.982] * (-1476.143) (-1475.277) (-1473.637) [-1471.207] -- 0:01:23
      46000 -- (-1470.668) (-1473.087) (-1472.162) [-1469.538] * (-1474.265) (-1473.411) [-1475.303] (-1471.693) -- 0:01:22
      46500 -- [-1471.483] (-1473.087) (-1472.449) (-1471.980) * (-1473.960) [-1473.040] (-1475.747) (-1469.613) -- 0:01:22
      47000 -- (-1473.806) [-1471.120] (-1475.745) (-1475.768) * [-1472.642] (-1471.608) (-1473.782) (-1471.760) -- 0:01:21
      47500 -- (-1474.386) (-1474.850) (-1469.828) [-1476.462] * (-1472.536) [-1472.330] (-1473.296) (-1472.234) -- 0:01:20
      48000 -- (-1472.993) [-1474.085] (-1474.245) (-1473.465) * [-1471.359] (-1472.128) (-1475.649) (-1475.195) -- 0:01:19
      48500 -- (-1471.816) (-1472.464) (-1471.777) [-1472.654] * (-1472.926) [-1470.247] (-1471.913) (-1469.250) -- 0:01:18
      49000 -- (-1471.939) [-1471.951] (-1470.650) (-1469.906) * (-1474.695) (-1474.071) (-1475.681) [-1472.110] -- 0:01:17
      49500 -- [-1470.496] (-1472.569) (-1471.156) (-1469.708) * [-1471.025] (-1470.447) (-1473.352) (-1471.222) -- 0:01:16
      50000 -- [-1471.073] (-1474.934) (-1470.327) (-1473.715) * [-1470.658] (-1469.845) (-1472.882) (-1474.501) -- 0:01:16

      Average standard deviation of split frequencies: 0.021864

      50500 -- (-1473.608) (-1470.467) (-1472.297) [-1469.051] * (-1471.745) (-1468.834) [-1473.496] (-1473.373) -- 0:01:15
      51000 -- (-1472.973) (-1471.107) (-1471.955) [-1472.225] * (-1473.246) (-1471.938) (-1475.699) [-1470.913] -- 0:01:14
      51500 -- [-1472.596] (-1472.404) (-1473.193) (-1473.693) * (-1474.727) (-1471.485) [-1471.705] (-1472.856) -- 0:01:13
      52000 -- [-1469.012] (-1471.373) (-1470.884) (-1471.614) * [-1471.473] (-1470.224) (-1477.181) (-1473.079) -- 0:01:12
      52500 -- (-1470.623) (-1472.280) (-1470.842) [-1472.634] * (-1470.176) (-1471.066) [-1471.310] (-1473.260) -- 0:01:12
      53000 -- (-1473.630) (-1473.483) (-1469.529) [-1471.159] * (-1471.523) (-1472.233) (-1475.696) [-1470.689] -- 0:01:11
      53500 -- [-1471.566] (-1474.923) (-1471.730) (-1472.702) * (-1473.400) (-1471.505) (-1473.162) [-1468.288] -- 0:01:10
      54000 -- [-1471.057] (-1474.226) (-1470.473) (-1473.781) * [-1472.045] (-1474.115) (-1474.044) (-1470.228) -- 0:01:10
      54500 -- [-1475.383] (-1473.855) (-1473.689) (-1480.216) * (-1472.873) (-1472.967) (-1474.335) [-1472.984] -- 0:01:09
      55000 -- [-1471.717] (-1475.460) (-1474.274) (-1477.903) * [-1472.446] (-1475.184) (-1473.609) (-1472.654) -- 0:01:08

      Average standard deviation of split frequencies: 0.020380

      55500 -- (-1471.977) (-1475.041) (-1473.166) [-1475.591] * [-1472.206] (-1471.622) (-1476.973) (-1471.560) -- 0:01:08
      56000 -- [-1472.553] (-1475.926) (-1472.454) (-1477.160) * (-1475.493) (-1474.095) [-1474.446] (-1470.515) -- 0:01:07
      56500 -- (-1473.463) (-1473.455) (-1472.150) [-1472.718] * (-1474.428) (-1473.646) [-1475.064] (-1469.551) -- 0:01:06
      57000 -- [-1473.437] (-1471.435) (-1475.471) (-1470.854) * (-1475.369) (-1472.432) (-1475.137) [-1471.297] -- 0:01:06
      57500 -- (-1472.053) [-1472.829] (-1474.089) (-1470.752) * (-1474.544) (-1472.555) [-1472.324] (-1477.376) -- 0:01:21
      58000 -- (-1470.661) [-1472.003] (-1472.813) (-1472.760) * (-1475.372) [-1472.434] (-1473.269) (-1471.042) -- 0:01:21
      58500 -- (-1473.565) [-1472.760] (-1471.814) (-1470.926) * (-1474.751) (-1477.480) [-1470.332] (-1473.393) -- 0:01:20
      59000 -- (-1475.332) [-1472.431] (-1473.618) (-1470.907) * (-1477.350) [-1470.622] (-1470.407) (-1474.520) -- 0:01:19
      59500 -- [-1471.654] (-1473.427) (-1473.759) (-1470.320) * (-1474.811) (-1471.715) [-1469.747] (-1471.201) -- 0:01:19
      60000 -- (-1474.819) (-1473.643) (-1474.152) [-1470.144] * [-1474.201] (-1470.309) (-1472.722) (-1471.977) -- 0:01:18

      Average standard deviation of split frequencies: 0.023797

      60500 -- (-1472.897) (-1474.143) [-1473.150] (-1470.660) * (-1473.143) (-1473.071) [-1473.487] (-1472.404) -- 0:01:17
      61000 -- (-1474.314) (-1471.162) [-1473.423] (-1470.792) * (-1472.451) [-1472.046] (-1473.218) (-1475.625) -- 0:01:16
      61500 -- (-1473.694) [-1470.407] (-1475.478) (-1472.603) * [-1471.212] (-1471.546) (-1470.488) (-1473.779) -- 0:01:16
      62000 -- (-1472.670) [-1470.879] (-1475.708) (-1472.962) * (-1474.644) (-1474.703) (-1472.714) [-1470.597] -- 0:01:15
      62500 -- [-1476.317] (-1471.116) (-1472.317) (-1472.146) * [-1471.899] (-1473.636) (-1469.765) (-1473.591) -- 0:01:15
      63000 -- [-1473.564] (-1473.878) (-1473.540) (-1470.112) * (-1471.938) (-1472.006) [-1470.141] (-1472.025) -- 0:01:14
      63500 -- (-1475.569) [-1470.686] (-1472.523) (-1474.237) * [-1472.150] (-1470.941) (-1471.080) (-1469.178) -- 0:01:13
      64000 -- (-1472.674) (-1472.944) [-1471.920] (-1472.409) * (-1470.139) (-1470.806) [-1471.704] (-1470.080) -- 0:01:13
      64500 -- [-1470.563] (-1475.216) (-1472.066) (-1472.120) * (-1471.309) [-1470.825] (-1471.107) (-1470.229) -- 0:01:12
      65000 -- (-1469.798) (-1471.953) [-1470.746] (-1472.618) * (-1470.931) (-1472.597) [-1470.221] (-1474.070) -- 0:01:11

      Average standard deviation of split frequencies: 0.021070

      65500 -- [-1469.371] (-1470.830) (-1474.140) (-1474.440) * (-1472.437) (-1470.058) (-1472.026) [-1469.665] -- 0:01:11
      66000 -- (-1470.681) (-1471.940) [-1474.331] (-1473.990) * (-1471.247) (-1471.235) (-1472.344) [-1470.254] -- 0:01:10
      66500 -- (-1470.406) (-1473.555) [-1473.870] (-1468.626) * (-1471.228) (-1470.162) [-1469.395] (-1472.097) -- 0:01:10
      67000 -- (-1472.093) [-1470.249] (-1474.212) (-1472.457) * (-1473.251) (-1469.740) [-1472.203] (-1470.097) -- 0:01:09
      67500 -- (-1472.418) [-1472.334] (-1473.417) (-1473.344) * (-1473.730) (-1471.743) (-1471.859) [-1472.381] -- 0:01:09
      68000 -- (-1470.878) [-1471.296] (-1471.293) (-1473.243) * (-1473.108) (-1471.344) (-1474.555) [-1471.088] -- 0:01:08
      68500 -- [-1473.159] (-1470.547) (-1471.502) (-1475.212) * (-1472.967) [-1471.360] (-1470.671) (-1474.676) -- 0:01:07
      69000 -- (-1474.337) (-1473.839) [-1470.026] (-1473.466) * (-1474.595) [-1470.552] (-1469.806) (-1472.166) -- 0:01:07
      69500 -- (-1471.456) [-1469.485] (-1474.877) (-1472.967) * (-1471.107) [-1473.091] (-1474.574) (-1471.105) -- 0:01:06
      70000 -- [-1473.481] (-1470.849) (-1471.934) (-1474.139) * (-1471.858) (-1470.754) [-1477.151] (-1470.517) -- 0:01:06

      Average standard deviation of split frequencies: 0.022470

      70500 -- (-1472.682) (-1471.092) (-1472.123) [-1471.370] * (-1472.876) (-1475.922) (-1471.037) [-1471.395] -- 0:01:05
      71000 -- (-1474.549) (-1470.916) (-1473.367) [-1471.091] * (-1475.207) (-1472.464) (-1468.491) [-1471.216] -- 0:01:05
      71500 -- (-1474.899) (-1473.672) (-1472.719) [-1471.695] * (-1473.675) (-1473.780) (-1474.857) [-1474.342] -- 0:01:17
      72000 -- [-1474.013] (-1471.811) (-1472.760) (-1475.798) * [-1477.886] (-1474.471) (-1470.259) (-1474.513) -- 0:01:17
      72500 -- (-1472.770) (-1470.915) (-1484.443) [-1471.095] * (-1473.254) (-1471.456) (-1472.140) [-1471.192] -- 0:01:16
      73000 -- (-1470.021) (-1476.117) (-1479.509) [-1469.858] * (-1473.269) (-1470.112) [-1472.800] (-1470.844) -- 0:01:16
      73500 -- (-1474.558) (-1469.938) (-1469.212) [-1473.463] * (-1474.207) (-1478.682) [-1470.126] (-1474.740) -- 0:01:15
      74000 -- (-1471.801) (-1475.457) (-1472.310) [-1471.271] * (-1473.352) [-1474.002] (-1471.224) (-1471.410) -- 0:01:15
      74500 -- (-1473.880) (-1474.215) (-1470.776) [-1469.002] * (-1473.001) (-1472.967) [-1472.883] (-1470.227) -- 0:01:14
      75000 -- (-1471.937) (-1473.563) (-1471.532) [-1470.746] * (-1472.407) (-1471.320) [-1471.817] (-1471.541) -- 0:01:14

      Average standard deviation of split frequencies: 0.022399

      75500 -- (-1471.280) (-1474.717) [-1472.530] (-1469.559) * (-1477.597) (-1470.587) [-1471.360] (-1470.479) -- 0:01:13
      76000 -- (-1470.001) (-1470.662) [-1473.473] (-1470.967) * (-1476.091) (-1471.886) (-1470.731) [-1471.563] -- 0:01:12
      76500 -- (-1472.437) [-1469.026] (-1473.919) (-1470.381) * (-1472.951) [-1472.130] (-1473.686) (-1472.954) -- 0:01:12
      77000 -- (-1472.226) (-1474.098) (-1470.849) [-1471.228] * (-1473.140) (-1473.691) [-1471.803] (-1473.893) -- 0:01:11
      77500 -- (-1470.318) [-1474.278] (-1472.080) (-1474.227) * (-1472.425) (-1470.406) [-1473.676] (-1474.401) -- 0:01:11
      78000 -- [-1472.973] (-1469.286) (-1469.513) (-1473.139) * (-1472.812) (-1472.305) (-1472.931) [-1475.807] -- 0:01:10
      78500 -- [-1473.187] (-1471.517) (-1470.671) (-1472.619) * (-1472.761) (-1470.687) [-1474.741] (-1476.236) -- 0:01:10
      79000 -- [-1469.280] (-1471.033) (-1469.826) (-1469.972) * (-1476.129) [-1472.201] (-1471.342) (-1475.682) -- 0:01:09
      79500 -- (-1469.958) (-1470.373) (-1470.277) [-1472.721] * (-1473.524) (-1470.183) [-1473.139] (-1476.238) -- 0:01:09
      80000 -- (-1472.189) [-1471.279] (-1468.656) (-1475.139) * (-1476.577) [-1471.802] (-1472.972) (-1474.995) -- 0:01:09

      Average standard deviation of split frequencies: 0.025323

      80500 -- (-1469.354) (-1469.721) (-1471.888) [-1474.121] * (-1471.455) (-1470.657) [-1471.781] (-1472.583) -- 0:01:08
      81000 -- (-1470.078) (-1471.979) (-1472.406) [-1472.365] * (-1471.575) (-1471.298) (-1474.076) [-1469.435] -- 0:01:08
      81500 -- (-1471.983) (-1469.911) [-1471.706] (-1472.500) * [-1472.435] (-1470.330) (-1473.733) (-1471.885) -- 0:01:07
      82000 -- (-1473.425) (-1471.534) (-1471.051) [-1473.226] * (-1474.000) (-1472.295) [-1472.536] (-1475.740) -- 0:01:07
      82500 -- (-1471.484) (-1471.976) [-1473.585] (-1473.757) * (-1472.647) (-1472.175) (-1472.588) [-1475.163] -- 0:01:06
      83000 -- (-1469.276) (-1470.318) (-1476.708) [-1473.493] * [-1470.594] (-1472.507) (-1472.960) (-1470.307) -- 0:01:06
      83500 -- (-1475.818) (-1471.421) (-1473.944) [-1470.036] * (-1472.949) [-1470.632] (-1474.054) (-1472.067) -- 0:01:05
      84000 -- [-1474.891] (-1471.971) (-1473.776) (-1473.471) * (-1476.736) (-1471.741) (-1471.694) [-1469.446] -- 0:01:05
      84500 -- (-1475.175) [-1470.019] (-1474.886) (-1477.161) * (-1475.263) [-1472.545] (-1472.555) (-1471.107) -- 0:01:05
      85000 -- (-1472.061) [-1471.153] (-1470.101) (-1471.999) * (-1473.034) [-1470.906] (-1474.357) (-1470.161) -- 0:01:04

      Average standard deviation of split frequencies: 0.027119

      85500 -- (-1471.259) (-1472.342) [-1473.879] (-1470.195) * (-1475.879) [-1470.964] (-1470.593) (-1472.440) -- 0:01:14
      86000 -- [-1472.679] (-1469.685) (-1472.586) (-1473.019) * (-1475.248) (-1473.176) [-1469.363] (-1475.235) -- 0:01:14
      86500 -- (-1469.362) [-1472.036] (-1472.975) (-1473.402) * [-1471.951] (-1474.525) (-1470.946) (-1473.844) -- 0:01:13
      87000 -- (-1471.169) [-1473.595] (-1472.687) (-1474.511) * (-1471.672) (-1474.465) [-1470.540] (-1473.356) -- 0:01:13
      87500 -- [-1470.780] (-1473.001) (-1469.642) (-1473.280) * (-1470.461) (-1474.534) (-1471.544) [-1473.366] -- 0:01:13
      88000 -- [-1470.505] (-1470.103) (-1476.372) (-1474.417) * (-1469.719) (-1470.996) (-1471.078) [-1473.269] -- 0:01:12
      88500 -- (-1470.296) [-1469.863] (-1472.506) (-1475.165) * (-1473.138) (-1472.776) [-1472.554] (-1474.873) -- 0:01:12
      89000 -- (-1474.197) (-1469.645) (-1471.058) [-1473.562] * (-1472.804) (-1477.296) [-1470.349] (-1476.885) -- 0:01:11
      89500 -- (-1471.697) (-1471.141) [-1474.342] (-1471.496) * [-1473.355] (-1475.044) (-1471.036) (-1472.773) -- 0:01:11
      90000 -- (-1472.861) [-1470.853] (-1471.737) (-1470.038) * (-1474.639) (-1474.401) [-1472.991] (-1471.721) -- 0:01:10

      Average standard deviation of split frequencies: 0.023657

      90500 -- (-1474.185) (-1470.859) [-1473.225] (-1469.095) * (-1472.335) (-1475.597) [-1470.383] (-1471.891) -- 0:01:10
      91000 -- (-1475.369) [-1471.776] (-1479.193) (-1468.545) * [-1480.017] (-1472.084) (-1472.001) (-1472.921) -- 0:01:09
      91500 -- (-1474.560) (-1470.828) (-1479.016) [-1477.295] * (-1473.549) [-1473.859] (-1473.523) (-1473.009) -- 0:01:09
      92000 -- (-1473.530) [-1471.406] (-1472.703) (-1469.861) * [-1473.314] (-1475.977) (-1471.144) (-1471.677) -- 0:01:09
      92500 -- (-1472.162) (-1469.439) [-1473.152] (-1471.918) * (-1472.885) [-1471.107] (-1473.830) (-1472.880) -- 0:01:08
      93000 -- (-1476.042) (-1478.412) [-1473.003] (-1474.083) * (-1478.595) [-1471.538] (-1472.970) (-1472.128) -- 0:01:08
      93500 -- (-1475.661) (-1474.134) (-1472.879) [-1475.372] * (-1473.915) [-1473.825] (-1471.082) (-1475.498) -- 0:01:07
      94000 -- [-1475.405] (-1472.650) (-1470.994) (-1475.884) * (-1471.658) (-1473.566) [-1472.330] (-1469.200) -- 0:01:07
      94500 -- (-1474.898) (-1473.029) (-1471.407) [-1473.346] * (-1471.569) (-1474.969) (-1472.812) [-1468.798] -- 0:01:07
      95000 -- (-1474.338) (-1475.581) [-1470.259] (-1474.038) * (-1473.700) (-1474.979) (-1475.576) [-1467.954] -- 0:01:06

      Average standard deviation of split frequencies: 0.023325

      95500 -- (-1477.259) (-1479.119) [-1472.599] (-1469.450) * (-1473.694) (-1473.321) [-1469.668] (-1470.433) -- 0:01:06
      96000 -- [-1480.132] (-1475.750) (-1473.259) (-1469.082) * (-1474.421) (-1470.845) [-1469.212] (-1470.760) -- 0:01:05
      96500 -- [-1470.667] (-1471.242) (-1471.541) (-1471.899) * (-1471.827) (-1474.335) [-1470.237] (-1469.576) -- 0:01:05
      97000 -- (-1471.980) (-1471.371) [-1469.770] (-1469.926) * [-1472.679] (-1472.986) (-1475.451) (-1469.693) -- 0:01:05
      97500 -- (-1473.579) (-1469.160) (-1474.674) [-1473.065] * (-1474.897) (-1472.765) [-1472.490] (-1472.160) -- 0:01:04
      98000 -- (-1476.445) (-1473.032) [-1470.710] (-1472.515) * (-1474.452) [-1470.720] (-1472.364) (-1473.240) -- 0:01:04
      98500 -- (-1471.506) (-1471.290) (-1473.153) [-1472.241] * (-1475.143) (-1476.993) (-1471.557) [-1472.064] -- 0:01:04
      99000 -- (-1469.679) [-1471.105] (-1470.559) (-1473.717) * (-1472.213) [-1471.186] (-1473.195) (-1471.338) -- 0:01:03
      99500 -- (-1474.508) (-1473.121) (-1469.500) [-1470.130] * (-1470.392) [-1472.871] (-1473.132) (-1473.005) -- 0:01:03
      100000 -- (-1471.126) (-1472.718) (-1470.713) [-1471.773] * (-1476.071) (-1472.846) [-1472.773] (-1472.744) -- 0:01:02

      Average standard deviation of split frequencies: 0.022712

      100500 -- (-1477.896) [-1472.438] (-1469.907) (-1473.922) * [-1473.271] (-1474.749) (-1475.684) (-1469.573) -- 0:01:11
      101000 -- [-1469.158] (-1470.171) (-1473.185) (-1471.960) * [-1470.134] (-1474.355) (-1474.855) (-1474.147) -- 0:01:11
      101500 -- (-1470.091) [-1473.745] (-1471.292) (-1472.428) * [-1469.527] (-1472.777) (-1471.225) (-1472.857) -- 0:01:10
      102000 -- (-1470.330) (-1471.470) [-1470.923] (-1470.446) * (-1472.247) (-1471.975) [-1470.010] (-1473.792) -- 0:01:10
      102500 -- (-1471.422) [-1473.367] (-1473.805) (-1473.511) * (-1472.487) (-1470.789) [-1471.089] (-1468.125) -- 0:01:10
      103000 -- [-1471.185] (-1475.935) (-1469.988) (-1475.255) * (-1475.608) [-1473.411] (-1472.244) (-1470.827) -- 0:01:09
      103500 -- (-1472.611) [-1472.587] (-1470.493) (-1473.653) * [-1469.727] (-1473.310) (-1471.740) (-1471.156) -- 0:01:09
      104000 -- (-1472.939) (-1469.632) (-1469.630) [-1468.762] * (-1469.967) (-1474.809) [-1472.356] (-1469.508) -- 0:01:08
      104500 -- (-1473.375) (-1476.530) (-1473.127) [-1470.666] * (-1472.684) (-1474.250) [-1469.807] (-1471.482) -- 0:01:08
      105000 -- (-1472.197) (-1471.766) (-1471.520) [-1470.844] * (-1472.507) (-1474.479) [-1472.918] (-1472.473) -- 0:01:08

      Average standard deviation of split frequencies: 0.020417

      105500 -- (-1469.903) (-1470.713) [-1469.634] (-1472.569) * (-1470.588) (-1469.888) (-1473.103) [-1472.624] -- 0:01:07
      106000 -- (-1470.324) (-1472.724) [-1470.572] (-1473.969) * (-1471.949) (-1474.163) (-1470.951) [-1469.909] -- 0:01:07
      106500 -- (-1470.122) (-1472.565) (-1473.571) [-1475.226] * (-1471.006) (-1472.496) (-1471.416) [-1469.984] -- 0:01:07
      107000 -- (-1471.448) (-1472.756) [-1469.182] (-1470.982) * (-1471.664) (-1473.040) [-1469.202] (-1474.628) -- 0:01:06
      107500 -- [-1470.458] (-1472.258) (-1470.656) (-1473.461) * (-1472.776) (-1474.367) [-1471.074] (-1472.471) -- 0:01:06
      108000 -- (-1474.184) (-1474.959) (-1469.070) [-1474.287] * (-1473.323) (-1474.042) (-1471.219) [-1473.741] -- 0:01:06
      108500 -- [-1471.415] (-1471.876) (-1472.471) (-1474.874) * (-1473.617) (-1471.848) (-1470.859) [-1471.588] -- 0:01:05
      109000 -- [-1473.977] (-1472.188) (-1475.534) (-1478.282) * (-1473.154) [-1473.737] (-1471.550) (-1474.183) -- 0:01:05
      109500 -- (-1471.472) (-1471.536) [-1472.707] (-1479.311) * [-1471.768] (-1473.987) (-1475.313) (-1471.580) -- 0:01:05
      110000 -- (-1470.464) (-1472.695) [-1469.645] (-1473.351) * (-1470.625) (-1476.583) [-1471.644] (-1471.567) -- 0:01:04

      Average standard deviation of split frequencies: 0.019676

      110500 -- (-1470.401) (-1475.214) (-1469.955) [-1473.937] * (-1470.511) (-1477.941) [-1470.007] (-1473.373) -- 0:01:04
      111000 -- [-1473.877] (-1476.206) (-1469.348) (-1476.120) * (-1473.164) (-1475.618) [-1473.732] (-1473.605) -- 0:01:04
      111500 -- (-1473.731) (-1474.867) [-1473.293] (-1472.483) * [-1473.232] (-1475.455) (-1472.035) (-1472.112) -- 0:01:03
      112000 -- (-1472.754) (-1472.571) (-1470.746) [-1471.127] * [-1472.131] (-1470.396) (-1470.954) (-1471.052) -- 0:01:03
      112500 -- (-1471.287) [-1471.598] (-1469.735) (-1473.415) * [-1470.469] (-1473.579) (-1473.143) (-1471.817) -- 0:01:03
      113000 -- [-1476.007] (-1475.349) (-1472.783) (-1472.211) * (-1473.725) [-1470.017] (-1474.342) (-1467.269) -- 0:01:02
      113500 -- [-1474.809] (-1473.287) (-1470.518) (-1473.915) * (-1474.705) (-1472.586) [-1470.754] (-1469.507) -- 0:01:02
      114000 -- (-1468.713) (-1472.694) [-1470.042] (-1472.864) * (-1473.496) [-1468.575] (-1471.484) (-1468.246) -- 0:01:02
      114500 -- [-1470.334] (-1473.486) (-1469.958) (-1474.627) * (-1472.349) (-1471.573) [-1469.993] (-1469.397) -- 0:01:01
      115000 -- (-1475.144) [-1471.549] (-1471.483) (-1474.639) * (-1471.038) [-1472.221] (-1471.852) (-1473.342) -- 0:01:09

      Average standard deviation of split frequencies: 0.019710

      115500 -- (-1472.301) (-1470.764) [-1474.495] (-1473.289) * (-1472.220) (-1470.580) [-1471.436] (-1474.044) -- 0:01:08
      116000 -- (-1472.126) (-1470.994) [-1471.410] (-1473.675) * (-1475.790) (-1476.398) (-1470.276) [-1471.384] -- 0:01:08
      116500 -- (-1474.774) (-1471.096) [-1470.441] (-1473.165) * (-1474.164) (-1472.429) [-1470.737] (-1475.750) -- 0:01:08
      117000 -- [-1475.942] (-1474.727) (-1472.079) (-1474.426) * (-1475.898) [-1474.213] (-1471.726) (-1475.048) -- 0:01:07
      117500 -- (-1473.237) (-1472.889) (-1469.149) [-1474.429] * (-1472.904) (-1473.204) [-1470.876] (-1471.184) -- 0:01:07
      118000 -- (-1473.195) (-1470.742) (-1473.832) [-1471.686] * (-1472.837) (-1470.046) (-1472.286) [-1475.272] -- 0:01:07
      118500 -- (-1473.052) (-1472.524) [-1473.270] (-1470.904) * (-1470.792) (-1472.780) [-1471.473] (-1473.897) -- 0:01:06
      119000 -- [-1472.547] (-1473.860) (-1474.869) (-1474.435) * (-1469.615) [-1474.665] (-1472.656) (-1469.679) -- 0:01:06
      119500 -- (-1473.100) [-1469.747] (-1473.195) (-1470.871) * (-1472.445) (-1471.258) [-1469.211] (-1472.717) -- 0:01:06
      120000 -- (-1470.956) (-1470.309) [-1473.915] (-1474.119) * (-1475.055) (-1473.142) [-1469.988] (-1472.282) -- 0:01:06

      Average standard deviation of split frequencies: 0.017888

      120500 -- (-1470.838) [-1473.981] (-1475.922) (-1474.007) * [-1473.924] (-1473.399) (-1470.359) (-1471.528) -- 0:01:05
      121000 -- (-1471.693) (-1473.401) [-1474.037] (-1478.207) * (-1473.535) (-1470.415) (-1468.907) [-1473.656] -- 0:01:05
      121500 -- (-1477.381) (-1476.723) (-1474.359) [-1470.860] * [-1472.603] (-1469.638) (-1477.112) (-1470.479) -- 0:01:05
      122000 -- (-1470.766) [-1471.430] (-1470.312) (-1474.362) * (-1472.191) [-1475.574] (-1471.101) (-1470.029) -- 0:01:04
      122500 -- [-1472.697] (-1470.459) (-1471.308) (-1474.562) * (-1474.169) (-1474.235) (-1471.623) [-1468.785] -- 0:01:04
      123000 -- [-1469.719] (-1474.988) (-1471.345) (-1476.550) * (-1473.662) [-1471.447] (-1471.381) (-1470.797) -- 0:01:04
      123500 -- (-1471.483) (-1474.834) [-1469.213] (-1477.150) * (-1471.344) (-1471.446) [-1471.244] (-1471.309) -- 0:01:03
      124000 -- (-1470.085) (-1472.333) (-1474.338) [-1470.846] * (-1471.695) (-1471.941) (-1472.634) [-1468.985] -- 0:01:03
      124500 -- [-1471.200] (-1475.844) (-1473.661) (-1472.113) * (-1472.090) (-1472.698) (-1472.860) [-1468.532] -- 0:01:03
      125000 -- (-1471.300) [-1472.779] (-1471.718) (-1470.847) * [-1473.626] (-1473.085) (-1475.182) (-1471.322) -- 0:01:03

      Average standard deviation of split frequencies: 0.017397

      125500 -- [-1469.988] (-1469.583) (-1470.269) (-1471.956) * (-1474.587) [-1470.578] (-1473.446) (-1471.015) -- 0:01:02
      126000 -- (-1471.140) [-1471.687] (-1472.772) (-1473.027) * [-1474.089] (-1472.704) (-1472.041) (-1470.475) -- 0:01:02
      126500 -- (-1474.028) (-1470.937) (-1470.917) [-1471.078] * [-1474.068] (-1471.865) (-1473.031) (-1471.161) -- 0:01:02
      127000 -- [-1468.998] (-1468.806) (-1472.922) (-1472.508) * (-1473.861) (-1472.650) (-1473.181) [-1472.785] -- 0:01:01
      127500 -- [-1471.823] (-1469.389) (-1473.052) (-1470.795) * (-1471.998) (-1471.670) (-1473.902) [-1469.132] -- 0:01:01
      128000 -- [-1473.448] (-1471.469) (-1469.781) (-1476.339) * (-1472.743) (-1471.257) [-1475.868] (-1470.955) -- 0:01:01
      128500 -- (-1475.085) [-1474.754] (-1471.648) (-1477.492) * (-1473.017) [-1469.023] (-1472.324) (-1469.009) -- 0:01:01
      129000 -- (-1472.203) [-1472.375] (-1468.376) (-1473.120) * (-1472.307) (-1469.808) [-1471.529] (-1469.542) -- 0:01:00
      129500 -- (-1471.203) (-1470.559) (-1469.435) [-1473.058] * (-1470.823) (-1471.608) [-1472.757] (-1470.235) -- 0:01:07
      130000 -- (-1471.755) [-1470.743] (-1471.566) (-1478.679) * (-1473.212) [-1470.016] (-1472.324) (-1469.488) -- 0:01:06

      Average standard deviation of split frequencies: 0.018580

      130500 -- (-1472.713) (-1472.637) [-1474.192] (-1474.706) * (-1472.445) (-1469.478) [-1469.774] (-1470.884) -- 0:01:06
      131000 -- (-1474.203) (-1473.650) [-1474.800] (-1474.388) * (-1473.208) [-1469.953] (-1470.214) (-1475.383) -- 0:01:06
      131500 -- (-1474.900) [-1472.686] (-1474.759) (-1475.762) * [-1470.566] (-1472.683) (-1469.940) (-1471.841) -- 0:01:06
      132000 -- [-1470.551] (-1473.593) (-1472.106) (-1475.214) * (-1474.196) (-1474.993) [-1472.909] (-1474.107) -- 0:01:05
      132500 -- (-1469.563) (-1474.663) [-1473.790] (-1479.280) * [-1470.290] (-1476.889) (-1474.430) (-1470.842) -- 0:01:05
      133000 -- (-1470.384) (-1472.615) [-1470.989] (-1472.136) * [-1470.268] (-1473.791) (-1473.508) (-1472.523) -- 0:01:05
      133500 -- (-1474.516) (-1473.711) (-1474.519) [-1473.010] * (-1472.809) (-1472.643) (-1471.874) [-1469.491] -- 0:01:04
      134000 -- [-1476.431] (-1472.405) (-1473.398) (-1471.967) * (-1470.726) (-1473.036) [-1470.972] (-1471.308) -- 0:01:04
      134500 -- (-1474.366) (-1474.027) (-1473.457) [-1471.825] * (-1477.778) (-1473.289) [-1469.180] (-1469.747) -- 0:01:04
      135000 -- (-1474.323) (-1469.899) (-1470.965) [-1472.469] * (-1471.356) (-1472.491) (-1478.140) [-1472.609] -- 0:01:04

      Average standard deviation of split frequencies: 0.017331

      135500 -- (-1474.137) (-1469.666) [-1474.720] (-1472.472) * (-1471.700) (-1471.528) [-1474.212] (-1472.944) -- 0:01:03
      136000 -- (-1472.941) (-1472.407) (-1476.569) [-1470.148] * (-1473.753) (-1474.973) [-1474.664] (-1470.964) -- 0:01:03
      136500 -- [-1471.942] (-1470.899) (-1474.523) (-1472.671) * (-1475.260) (-1476.239) [-1473.213] (-1472.198) -- 0:01:03
      137000 -- [-1471.401] (-1473.654) (-1472.935) (-1473.767) * (-1479.141) [-1474.524] (-1474.821) (-1475.881) -- 0:01:02
      137500 -- (-1470.066) (-1473.843) (-1472.595) [-1471.874] * [-1469.959] (-1472.964) (-1478.644) (-1472.987) -- 0:01:02
      138000 -- (-1469.959) (-1474.749) [-1472.591] (-1471.730) * [-1469.574] (-1472.254) (-1475.039) (-1475.295) -- 0:01:02
      138500 -- (-1470.957) (-1473.816) [-1472.354] (-1473.831) * [-1469.345] (-1470.160) (-1475.255) (-1469.612) -- 0:01:02
      139000 -- (-1471.092) (-1472.424) (-1473.356) [-1477.935] * (-1472.546) [-1474.070] (-1473.613) (-1473.529) -- 0:01:01
      139500 -- (-1474.540) (-1470.940) [-1472.833] (-1472.443) * (-1473.793) (-1472.780) [-1471.521] (-1472.315) -- 0:01:01
      140000 -- (-1473.820) [-1469.882] (-1471.822) (-1474.400) * (-1471.963) (-1472.494) [-1470.979] (-1473.592) -- 0:01:01

      Average standard deviation of split frequencies: 0.016942

      140500 -- (-1472.774) [-1471.750] (-1472.953) (-1473.950) * (-1473.363) [-1470.548] (-1475.708) (-1470.065) -- 0:01:01
      141000 -- (-1475.728) [-1469.912] (-1472.039) (-1471.970) * (-1469.561) [-1472.045] (-1470.731) (-1472.944) -- 0:01:00
      141500 -- [-1478.426] (-1471.292) (-1473.057) (-1468.426) * (-1473.697) (-1470.588) [-1469.321] (-1473.716) -- 0:01:00
      142000 -- (-1470.826) [-1470.718] (-1474.034) (-1468.625) * (-1469.825) (-1469.220) [-1473.729] (-1470.357) -- 0:01:00
      142500 -- (-1472.340) (-1472.206) (-1477.782) [-1469.895] * (-1473.259) (-1471.538) (-1471.828) [-1472.024] -- 0:01:00
      143000 -- (-1470.122) [-1471.662] (-1477.775) (-1475.179) * [-1472.994] (-1470.810) (-1473.391) (-1471.371) -- 0:00:59
      143500 -- [-1478.159] (-1471.077) (-1476.589) (-1476.130) * (-1471.226) (-1473.668) (-1473.648) [-1473.611] -- 0:00:59
      144000 -- [-1476.159] (-1476.603) (-1472.802) (-1475.213) * [-1470.788] (-1476.408) (-1470.927) (-1473.221) -- 0:00:59
      144500 -- (-1471.075) (-1473.417) (-1472.694) [-1473.202] * (-1472.464) [-1469.960] (-1471.472) (-1476.339) -- 0:01:05
      145000 -- (-1470.700) [-1474.074] (-1470.912) (-1477.776) * [-1471.068] (-1471.111) (-1474.071) (-1477.209) -- 0:01:04

      Average standard deviation of split frequencies: 0.015785

      145500 -- (-1472.521) (-1474.462) (-1475.245) [-1472.861] * (-1470.737) (-1469.765) [-1476.006] (-1475.262) -- 0:01:04
      146000 -- (-1474.351) (-1472.917) [-1474.106] (-1475.413) * (-1473.404) [-1472.657] (-1471.769) (-1470.944) -- 0:01:04
      146500 -- [-1473.001] (-1471.734) (-1468.840) (-1474.497) * (-1474.205) [-1472.646] (-1470.495) (-1470.543) -- 0:01:04
      147000 -- (-1474.288) [-1470.464] (-1474.947) (-1477.821) * (-1473.435) (-1470.047) [-1474.924] (-1470.722) -- 0:01:03
      147500 -- (-1473.729) [-1470.514] (-1475.978) (-1472.521) * [-1472.146] (-1472.614) (-1471.364) (-1470.898) -- 0:01:03
      148000 -- (-1474.407) (-1475.707) (-1478.546) [-1469.804] * (-1474.665) [-1475.513] (-1473.296) (-1469.306) -- 0:01:03
      148500 -- (-1473.226) (-1476.673) (-1474.706) [-1472.404] * (-1471.453) (-1470.163) [-1471.369] (-1470.282) -- 0:01:03
      149000 -- (-1474.124) (-1473.549) (-1478.782) [-1470.945] * [-1471.551] (-1471.012) (-1471.970) (-1470.169) -- 0:01:02
      149500 -- (-1475.716) [-1471.756] (-1478.560) (-1473.588) * (-1472.945) (-1472.500) [-1473.381] (-1473.224) -- 0:01:02
      150000 -- (-1473.231) (-1473.790) (-1477.486) [-1472.804] * (-1474.784) (-1471.528) (-1481.380) [-1472.076] -- 0:01:02

      Average standard deviation of split frequencies: 0.016339

      150500 -- [-1472.842] (-1472.285) (-1473.487) (-1477.763) * [-1471.710] (-1473.759) (-1475.878) (-1472.119) -- 0:01:02
      151000 -- (-1472.399) [-1472.698] (-1473.554) (-1473.443) * [-1471.581] (-1471.216) (-1474.102) (-1472.170) -- 0:01:01
      151500 -- [-1470.940] (-1473.416) (-1474.134) (-1472.445) * [-1470.827] (-1471.457) (-1472.070) (-1469.818) -- 0:01:01
      152000 -- (-1474.374) [-1470.603] (-1473.326) (-1472.938) * [-1474.956] (-1471.356) (-1473.620) (-1471.009) -- 0:01:01
      152500 -- [-1473.497] (-1474.218) (-1475.718) (-1473.460) * (-1472.261) (-1470.709) [-1471.402] (-1468.816) -- 0:01:01
      153000 -- [-1472.168] (-1472.605) (-1472.897) (-1478.168) * (-1472.522) (-1471.397) [-1470.453] (-1471.230) -- 0:01:00
      153500 -- (-1472.398) (-1472.047) [-1471.084] (-1475.728) * (-1471.669) (-1472.868) [-1469.074] (-1470.803) -- 0:01:00
      154000 -- (-1473.081) (-1471.624) (-1472.100) [-1470.366] * [-1473.029] (-1474.515) (-1469.381) (-1469.729) -- 0:01:00
      154500 -- (-1471.892) [-1473.012] (-1472.047) (-1472.776) * (-1477.237) [-1473.250] (-1470.030) (-1472.068) -- 0:01:00
      155000 -- (-1473.621) (-1472.422) (-1470.475) [-1470.352] * (-1471.416) (-1471.977) (-1470.946) [-1471.485] -- 0:00:59

      Average standard deviation of split frequencies: 0.015613

      155500 -- (-1474.819) [-1473.839] (-1471.344) (-1471.202) * (-1474.675) [-1473.087] (-1469.067) (-1470.976) -- 0:00:59
      156000 -- (-1474.001) [-1472.425] (-1471.302) (-1471.098) * [-1472.478] (-1476.184) (-1471.800) (-1473.607) -- 0:00:59
      156500 -- (-1471.506) [-1473.001] (-1470.397) (-1472.688) * [-1471.649] (-1470.808) (-1474.218) (-1475.169) -- 0:00:59
      157000 -- (-1471.641) (-1470.539) [-1471.552] (-1473.506) * [-1472.063] (-1471.607) (-1471.908) (-1470.457) -- 0:00:59
      157500 -- (-1476.639) [-1473.086] (-1471.447) (-1473.753) * (-1470.419) (-1470.426) [-1471.240] (-1470.267) -- 0:00:58
      158000 -- [-1476.669] (-1473.030) (-1471.287) (-1471.324) * (-1469.643) (-1474.670) [-1472.405] (-1471.231) -- 0:00:58
      158500 -- (-1480.997) (-1476.125) [-1468.912] (-1470.802) * (-1470.749) (-1476.039) [-1469.527] (-1470.828) -- 0:00:58
      159000 -- [-1479.353] (-1474.930) (-1471.769) (-1472.828) * [-1476.553] (-1477.248) (-1470.274) (-1473.824) -- 0:01:03
      159500 -- (-1477.022) (-1472.739) (-1473.009) [-1470.465] * (-1474.054) (-1473.978) (-1471.935) [-1479.519] -- 0:01:03
      160000 -- (-1474.873) [-1473.425] (-1470.851) (-1471.799) * (-1474.661) (-1472.982) (-1472.619) [-1475.200] -- 0:01:02

      Average standard deviation of split frequencies: 0.016300

      160500 -- (-1472.164) [-1472.683] (-1472.958) (-1470.561) * [-1471.237] (-1473.686) (-1470.940) (-1470.165) -- 0:01:02
      161000 -- (-1474.607) (-1471.791) (-1473.190) [-1472.774] * (-1471.225) (-1477.899) [-1473.372] (-1472.966) -- 0:01:02
      161500 -- (-1473.503) (-1475.085) (-1470.891) [-1471.104] * (-1471.622) (-1472.377) (-1478.623) [-1473.869] -- 0:01:02
      162000 -- (-1473.157) (-1471.378) [-1469.109] (-1473.462) * [-1471.236] (-1472.513) (-1474.079) (-1471.254) -- 0:01:02
      162500 -- (-1472.865) (-1473.284) [-1470.458] (-1473.960) * (-1474.371) (-1475.260) (-1475.049) [-1476.700] -- 0:01:01
      163000 -- (-1473.425) (-1473.680) [-1471.757] (-1474.636) * (-1476.108) [-1472.731] (-1473.680) (-1475.191) -- 0:01:01
      163500 -- [-1472.140] (-1472.279) (-1474.570) (-1472.196) * (-1472.116) (-1473.187) (-1474.322) [-1471.180] -- 0:01:01
      164000 -- (-1471.200) (-1474.364) [-1473.287] (-1478.122) * [-1473.947] (-1474.448) (-1469.470) (-1473.189) -- 0:01:01
      164500 -- [-1470.884] (-1473.694) (-1477.760) (-1475.017) * (-1474.357) (-1473.036) (-1470.413) [-1470.616] -- 0:01:00
      165000 -- [-1472.723] (-1474.101) (-1477.823) (-1472.870) * [-1472.688] (-1473.961) (-1470.802) (-1476.237) -- 0:01:00

      Average standard deviation of split frequencies: 0.015992

      165500 -- [-1475.514] (-1473.158) (-1474.173) (-1473.842) * (-1473.267) (-1473.889) [-1470.299] (-1475.214) -- 0:01:00
      166000 -- (-1472.215) [-1474.145] (-1472.740) (-1475.951) * (-1476.149) (-1472.724) (-1472.677) [-1471.179] -- 0:01:00
      166500 -- (-1470.403) [-1477.562] (-1471.042) (-1473.632) * [-1472.908] (-1473.455) (-1475.073) (-1469.630) -- 0:01:00
      167000 -- (-1473.134) (-1471.802) (-1473.231) [-1473.552] * (-1472.898) [-1472.245] (-1473.594) (-1470.768) -- 0:00:59
      167500 -- (-1477.623) (-1472.695) (-1470.420) [-1472.400] * (-1471.973) (-1472.576) (-1477.695) [-1467.761] -- 0:00:59
      168000 -- (-1475.125) (-1471.960) [-1469.002] (-1472.556) * (-1480.449) (-1473.094) (-1476.451) [-1468.662] -- 0:00:59
      168500 -- [-1474.103] (-1473.465) (-1469.337) (-1472.442) * (-1471.511) (-1472.182) (-1473.701) [-1472.452] -- 0:00:59
      169000 -- [-1471.739] (-1472.909) (-1474.138) (-1473.760) * (-1472.599) (-1473.135) (-1475.201) [-1470.587] -- 0:00:59
      169500 -- (-1480.560) [-1471.226] (-1470.510) (-1474.388) * (-1477.838) [-1469.941] (-1473.918) (-1472.513) -- 0:00:58
      170000 -- [-1474.576] (-1469.565) (-1472.800) (-1474.008) * [-1470.900] (-1472.082) (-1474.683) (-1470.283) -- 0:00:58

      Average standard deviation of split frequencies: 0.016112

      170500 -- (-1472.301) [-1470.389] (-1476.120) (-1474.809) * (-1471.673) (-1472.925) [-1472.575] (-1469.285) -- 0:00:58
      171000 -- (-1471.995) [-1472.049] (-1473.189) (-1471.723) * (-1472.024) (-1474.168) (-1476.158) [-1472.502] -- 0:00:58
      171500 -- (-1471.973) (-1472.473) (-1471.162) [-1470.385] * (-1472.402) [-1470.182] (-1475.609) (-1474.229) -- 0:00:57
      172000 -- (-1470.740) (-1475.152) [-1474.591] (-1472.663) * (-1472.122) (-1470.080) [-1471.071] (-1473.833) -- 0:00:57
      172500 -- [-1469.609] (-1473.230) (-1474.169) (-1470.036) * (-1474.681) (-1470.351) (-1469.344) [-1469.906] -- 0:00:57
      173000 -- (-1470.242) (-1470.790) (-1472.896) [-1474.362] * (-1473.359) [-1471.121] (-1476.127) (-1472.418) -- 0:00:57
      173500 -- [-1470.325] (-1477.470) (-1475.358) (-1472.452) * (-1475.455) [-1475.006] (-1470.017) (-1473.289) -- 0:01:01
      174000 -- (-1470.044) (-1475.101) [-1471.691] (-1474.711) * (-1469.393) (-1469.533) [-1469.458] (-1473.091) -- 0:01:01
      174500 -- [-1471.106] (-1476.143) (-1470.793) (-1471.785) * (-1471.120) [-1471.314] (-1470.650) (-1472.690) -- 0:01:01
      175000 -- (-1472.007) (-1474.024) [-1471.347] (-1477.572) * (-1472.166) [-1470.064] (-1469.452) (-1470.063) -- 0:01:01

      Average standard deviation of split frequencies: 0.015922

      175500 -- (-1469.895) (-1477.299) [-1471.705] (-1474.819) * (-1477.311) (-1471.522) (-1470.196) [-1469.211] -- 0:01:01
      176000 -- (-1469.572) (-1474.859) [-1469.588] (-1475.818) * [-1471.108] (-1474.216) (-1471.842) (-1470.778) -- 0:01:00
      176500 -- (-1470.327) [-1474.383] (-1472.246) (-1474.764) * (-1471.478) [-1472.010] (-1472.575) (-1475.567) -- 0:01:00
      177000 -- [-1470.962] (-1473.513) (-1473.571) (-1471.598) * [-1472.968] (-1470.290) (-1475.455) (-1476.835) -- 0:01:00
      177500 -- [-1469.016] (-1471.395) (-1473.299) (-1471.834) * (-1473.419) (-1474.746) (-1474.519) [-1474.208] -- 0:01:00
      178000 -- (-1469.957) (-1475.266) (-1473.251) [-1469.987] * (-1470.809) (-1471.538) [-1473.039] (-1470.568) -- 0:01:00
      178500 -- [-1470.583] (-1471.311) (-1475.946) (-1471.041) * (-1475.023) [-1473.725] (-1473.308) (-1470.404) -- 0:00:59
      179000 -- (-1470.382) [-1472.717] (-1477.884) (-1471.104) * (-1474.768) [-1477.277] (-1480.694) (-1469.871) -- 0:00:59
      179500 -- (-1469.834) (-1471.516) (-1473.483) [-1472.261] * (-1472.459) (-1476.360) (-1473.986) [-1468.602] -- 0:00:59
      180000 -- (-1468.875) (-1473.195) (-1472.501) [-1472.655] * (-1469.028) (-1476.033) [-1474.591] (-1471.099) -- 0:00:59

      Average standard deviation of split frequencies: 0.016380

      180500 -- (-1470.047) (-1472.452) (-1469.712) [-1474.142] * (-1476.834) (-1472.068) (-1471.935) [-1469.117] -- 0:00:59
      181000 -- (-1472.653) (-1473.493) [-1472.987] (-1475.343) * [-1471.063] (-1472.202) (-1469.162) (-1472.318) -- 0:00:58
      181500 -- [-1469.592] (-1472.039) (-1473.119) (-1470.629) * (-1477.092) (-1473.804) [-1471.601] (-1474.179) -- 0:00:58
      182000 -- [-1470.572] (-1475.184) (-1473.738) (-1472.677) * (-1473.615) [-1475.466] (-1473.257) (-1472.870) -- 0:00:58
      182500 -- [-1471.224] (-1474.227) (-1471.996) (-1470.788) * (-1472.123) (-1475.660) (-1470.632) [-1475.594] -- 0:00:58
      183000 -- [-1471.751] (-1475.621) (-1472.297) (-1472.099) * (-1475.360) (-1476.310) (-1472.522) [-1477.014] -- 0:00:58
      183500 -- (-1470.886) (-1473.674) [-1474.042] (-1473.114) * (-1473.540) (-1471.984) [-1472.888] (-1471.825) -- 0:00:57
      184000 -- [-1470.602] (-1474.538) (-1471.176) (-1473.917) * [-1471.883] (-1475.067) (-1471.918) (-1473.361) -- 0:00:57
      184500 -- (-1472.254) (-1474.606) [-1472.683] (-1474.922) * (-1470.781) [-1479.231] (-1469.315) (-1471.121) -- 0:00:57
      185000 -- (-1470.407) (-1473.716) [-1471.165] (-1473.453) * (-1472.612) (-1470.533) (-1474.096) [-1470.453] -- 0:00:57

      Average standard deviation of split frequencies: 0.016615

      185500 -- [-1469.689] (-1477.069) (-1471.816) (-1470.173) * (-1472.704) (-1475.289) [-1471.227] (-1470.327) -- 0:00:57
      186000 -- (-1472.785) (-1473.691) [-1470.774] (-1476.469) * (-1473.076) (-1469.550) (-1471.349) [-1469.197] -- 0:00:56
      186500 -- [-1477.743] (-1470.307) (-1471.219) (-1471.659) * (-1473.273) (-1473.101) (-1470.742) [-1468.747] -- 0:00:56
      187000 -- (-1473.766) (-1471.815) (-1472.835) [-1475.293] * (-1469.867) (-1474.581) (-1476.971) [-1472.932] -- 0:00:56
      187500 -- (-1474.812) (-1470.440) [-1471.448] (-1475.359) * [-1471.278] (-1478.132) (-1473.944) (-1469.832) -- 0:00:56
      188000 -- (-1473.598) [-1475.021] (-1473.558) (-1478.038) * (-1471.958) [-1471.839] (-1473.788) (-1472.372) -- 0:01:00
      188500 -- [-1470.219] (-1474.993) (-1469.219) (-1474.323) * (-1470.240) (-1470.499) (-1469.709) [-1472.034] -- 0:01:00
      189000 -- [-1470.007] (-1473.619) (-1470.908) (-1472.347) * [-1474.906] (-1471.016) (-1473.140) (-1470.967) -- 0:01:00
      189500 -- (-1469.924) (-1471.190) [-1472.702] (-1473.346) * (-1472.379) (-1471.261) [-1470.211] (-1470.629) -- 0:00:59
      190000 -- (-1476.870) (-1474.047) (-1473.397) [-1473.211] * (-1470.952) [-1471.158] (-1471.452) (-1474.546) -- 0:00:59

      Average standard deviation of split frequencies: 0.016143

      190500 -- (-1477.507) [-1472.117] (-1472.079) (-1474.762) * (-1478.114) (-1472.579) [-1471.328] (-1472.465) -- 0:00:59
      191000 -- [-1472.235] (-1472.264) (-1472.145) (-1473.580) * (-1473.891) (-1473.761) [-1471.571] (-1469.475) -- 0:00:59
      191500 -- [-1471.672] (-1473.364) (-1474.180) (-1472.064) * (-1471.040) (-1476.747) (-1473.066) [-1474.233] -- 0:00:59
      192000 -- (-1471.539) (-1474.142) (-1476.895) [-1474.336] * (-1472.032) (-1471.707) (-1472.820) [-1471.709] -- 0:00:58
      192500 -- [-1471.463] (-1473.402) (-1472.725) (-1473.241) * (-1470.095) (-1472.800) [-1474.272] (-1468.679) -- 0:00:58
      193000 -- (-1472.520) (-1476.272) (-1469.510) [-1472.089] * (-1471.149) [-1472.642] (-1475.532) (-1470.005) -- 0:00:58
      193500 -- (-1473.642) (-1473.791) [-1470.193] (-1472.612) * (-1473.238) (-1475.077) [-1470.959] (-1469.188) -- 0:00:58
      194000 -- [-1470.359] (-1473.111) (-1468.237) (-1472.437) * (-1474.987) (-1473.186) (-1474.942) [-1472.995] -- 0:00:58
      194500 -- [-1471.417] (-1473.722) (-1470.252) (-1473.237) * [-1475.803] (-1472.044) (-1472.695) (-1472.130) -- 0:00:57
      195000 -- (-1472.087) [-1474.864] (-1471.843) (-1472.706) * (-1473.415) [-1471.630] (-1472.818) (-1472.674) -- 0:00:57

      Average standard deviation of split frequencies: 0.013629

      195500 -- (-1472.442) (-1474.064) [-1470.997] (-1474.500) * (-1474.741) [-1472.510] (-1472.641) (-1471.093) -- 0:00:57
      196000 -- (-1472.101) [-1475.827] (-1472.624) (-1473.030) * (-1473.123) [-1472.185] (-1472.941) (-1468.241) -- 0:00:57
      196500 -- (-1471.797) (-1475.499) [-1471.674] (-1472.281) * (-1474.090) (-1472.970) (-1473.270) [-1470.596] -- 0:00:57
      197000 -- (-1471.986) (-1472.126) (-1473.625) [-1471.179] * (-1474.254) (-1469.565) (-1470.619) [-1470.243] -- 0:00:57
      197500 -- [-1475.592] (-1477.693) (-1474.970) (-1472.306) * (-1473.524) [-1475.046] (-1472.408) (-1471.591) -- 0:00:56
      198000 -- (-1474.500) (-1476.575) (-1475.912) [-1473.610] * (-1474.856) (-1470.591) [-1473.759] (-1474.244) -- 0:00:56
      198500 -- (-1471.353) (-1470.805) [-1471.344] (-1473.281) * (-1473.142) (-1470.436) [-1471.511] (-1480.010) -- 0:00:56
      199000 -- (-1472.640) (-1472.164) (-1474.170) [-1472.195] * [-1473.755] (-1475.713) (-1470.443) (-1474.686) -- 0:00:56
      199500 -- (-1474.457) (-1473.500) [-1470.803] (-1471.479) * (-1475.755) (-1474.449) (-1473.037) [-1476.708] -- 0:00:56
      200000 -- (-1473.120) [-1472.601] (-1470.664) (-1470.491) * (-1478.125) (-1469.874) [-1471.169] (-1471.518) -- 0:00:55

      Average standard deviation of split frequencies: 0.012921

      200500 -- (-1472.799) (-1473.480) (-1470.403) [-1471.067] * (-1476.231) [-1472.742] (-1471.385) (-1469.622) -- 0:00:55
      201000 -- (-1469.533) (-1473.598) [-1470.138] (-1470.295) * (-1474.851) (-1472.412) (-1473.842) [-1472.117] -- 0:00:55
      201500 -- (-1471.445) (-1473.448) (-1471.970) [-1470.642] * [-1472.347] (-1478.185) (-1472.919) (-1476.173) -- 0:00:55
      202000 -- (-1469.850) (-1472.400) (-1472.717) [-1471.250] * (-1472.286) (-1472.368) [-1473.162] (-1474.228) -- 0:00:55
      202500 -- (-1474.429) (-1473.812) [-1470.737] (-1470.799) * (-1471.016) (-1472.574) (-1477.016) [-1472.002] -- 0:00:59
      203000 -- (-1479.665) (-1470.612) [-1470.308] (-1470.557) * (-1471.275) (-1474.601) (-1476.075) [-1470.017] -- 0:00:58
      203500 -- [-1470.511] (-1472.515) (-1473.947) (-1475.171) * (-1471.644) (-1475.034) [-1474.319] (-1471.086) -- 0:00:58
      204000 -- (-1469.729) [-1472.694] (-1477.303) (-1470.133) * (-1471.421) (-1473.487) (-1474.298) [-1471.547] -- 0:00:58
      204500 -- (-1472.359) (-1473.323) [-1473.358] (-1472.600) * [-1473.515] (-1472.720) (-1473.813) (-1471.113) -- 0:00:58
      205000 -- (-1473.956) (-1473.036) (-1469.125) [-1474.369] * (-1470.627) [-1472.672] (-1475.530) (-1476.425) -- 0:00:58

      Average standard deviation of split frequencies: 0.011846

      205500 -- (-1468.992) (-1472.629) (-1473.739) [-1470.371] * (-1476.125) (-1475.370) (-1476.741) [-1469.772] -- 0:00:57
      206000 -- [-1470.019] (-1473.957) (-1472.273) (-1472.865) * [-1473.078] (-1470.784) (-1473.473) (-1471.972) -- 0:00:57
      206500 -- [-1472.056] (-1474.158) (-1471.199) (-1473.290) * (-1472.648) (-1472.850) [-1470.500] (-1477.204) -- 0:00:57
      207000 -- [-1469.534] (-1472.840) (-1473.252) (-1472.529) * (-1471.496) (-1470.818) (-1470.734) [-1470.826] -- 0:00:57
      207500 -- (-1468.646) (-1477.990) (-1475.121) [-1470.941] * (-1470.064) (-1478.412) (-1472.706) [-1472.668] -- 0:00:57
      208000 -- (-1477.195) (-1472.611) [-1477.391] (-1470.093) * (-1473.179) (-1473.233) (-1477.092) [-1472.528] -- 0:00:57
      208500 -- (-1477.311) (-1473.970) (-1475.962) [-1472.758] * (-1473.043) (-1471.814) [-1473.278] (-1469.351) -- 0:00:56
      209000 -- (-1472.855) [-1472.581] (-1470.955) (-1472.526) * (-1469.976) [-1472.301] (-1474.392) (-1471.155) -- 0:00:56
      209500 -- (-1477.348) (-1470.418) [-1471.665] (-1473.836) * (-1471.603) (-1472.156) [-1473.266] (-1469.902) -- 0:00:56
      210000 -- (-1478.308) [-1471.449] (-1471.135) (-1475.878) * (-1472.116) (-1471.443) (-1472.039) [-1471.202] -- 0:00:56

      Average standard deviation of split frequencies: 0.011452

      210500 -- (-1469.643) (-1473.602) (-1471.867) [-1470.657] * (-1471.669) (-1473.229) (-1473.743) [-1470.455] -- 0:00:56
      211000 -- (-1471.947) [-1471.808] (-1471.035) (-1473.153) * (-1472.522) (-1473.396) [-1474.291] (-1471.012) -- 0:00:56
      211500 -- (-1474.031) (-1476.082) [-1470.538] (-1472.358) * (-1469.854) (-1472.229) (-1474.070) [-1471.954] -- 0:00:55
      212000 -- (-1472.303) (-1474.006) (-1471.726) [-1470.378] * (-1469.608) (-1472.340) [-1473.448] (-1474.864) -- 0:00:55
      212500 -- (-1472.956) (-1470.754) [-1472.951] (-1469.736) * (-1471.303) (-1471.417) (-1472.304) [-1473.349] -- 0:00:55
      213000 -- (-1471.076) (-1472.806) (-1471.834) [-1468.966] * [-1474.380] (-1471.843) (-1472.371) (-1473.762) -- 0:00:55
      213500 -- [-1471.923] (-1473.529) (-1473.570) (-1473.184) * (-1471.798) (-1469.725) [-1470.944] (-1473.306) -- 0:00:55
      214000 -- (-1473.272) (-1473.052) (-1476.788) [-1469.619] * [-1472.117] (-1471.643) (-1474.852) (-1472.542) -- 0:00:55
      214500 -- [-1469.270] (-1474.335) (-1476.328) (-1470.808) * [-1471.792] (-1471.471) (-1471.952) (-1470.747) -- 0:00:54
      215000 -- [-1472.492] (-1472.674) (-1474.911) (-1473.272) * (-1475.822) [-1470.272] (-1475.029) (-1470.045) -- 0:00:54

      Average standard deviation of split frequencies: 0.012709

      215500 -- [-1473.398] (-1470.357) (-1475.254) (-1472.431) * [-1472.235] (-1469.623) (-1474.099) (-1469.904) -- 0:00:54
      216000 -- [-1470.316] (-1471.716) (-1472.851) (-1471.302) * (-1472.100) (-1470.661) (-1476.403) [-1473.287] -- 0:00:54
      216500 -- [-1470.272] (-1474.875) (-1471.941) (-1471.414) * (-1473.897) (-1471.807) [-1475.385] (-1472.052) -- 0:00:54
      217000 -- (-1470.258) (-1474.127) (-1475.672) [-1470.929] * (-1471.708) (-1471.859) [-1473.808] (-1472.898) -- 0:00:57
      217500 -- (-1473.973) (-1471.488) [-1470.473] (-1472.588) * (-1473.323) (-1472.694) (-1472.699) [-1470.780] -- 0:00:57
      218000 -- [-1472.264] (-1471.542) (-1476.268) (-1470.244) * (-1469.994) [-1472.193] (-1474.860) (-1471.528) -- 0:00:57
      218500 -- (-1472.284) (-1474.752) (-1474.344) [-1469.918] * [-1472.597] (-1471.918) (-1475.273) (-1470.373) -- 0:00:57
      219000 -- [-1473.740] (-1470.758) (-1473.773) (-1471.367) * (-1470.256) (-1474.509) (-1474.019) [-1471.335] -- 0:00:57
      219500 -- (-1471.258) (-1470.926) (-1474.223) [-1470.437] * (-1471.948) (-1474.732) (-1471.761) [-1473.534] -- 0:00:56
      220000 -- (-1473.380) (-1473.805) [-1477.268] (-1471.845) * (-1472.650) [-1473.801] (-1478.688) (-1471.426) -- 0:00:56

      Average standard deviation of split frequencies: 0.013195

      220500 -- [-1468.272] (-1471.337) (-1473.941) (-1470.080) * (-1473.826) [-1472.037] (-1478.335) (-1473.307) -- 0:00:56
      221000 -- (-1471.098) (-1471.289) (-1475.367) [-1469.826] * [-1471.097] (-1472.638) (-1475.001) (-1472.661) -- 0:00:56
      221500 -- [-1473.325] (-1474.144) (-1478.328) (-1470.566) * (-1469.032) [-1469.983] (-1474.951) (-1471.105) -- 0:00:56
      222000 -- (-1474.920) (-1471.387) [-1471.362] (-1471.178) * [-1469.752] (-1471.734) (-1476.532) (-1469.923) -- 0:00:56
      222500 -- [-1474.416] (-1470.902) (-1471.894) (-1473.923) * [-1469.902] (-1470.396) (-1479.368) (-1471.144) -- 0:00:55
      223000 -- (-1479.448) (-1471.697) (-1471.398) [-1472.231] * (-1470.303) [-1471.796] (-1473.946) (-1473.643) -- 0:00:55
      223500 -- [-1469.671] (-1473.030) (-1472.668) (-1473.659) * (-1473.979) [-1470.716] (-1471.922) (-1471.443) -- 0:00:55
      224000 -- (-1473.216) (-1471.440) (-1472.759) [-1470.962] * (-1473.354) (-1470.019) (-1472.712) [-1473.160] -- 0:00:55
      224500 -- (-1476.377) [-1470.164] (-1473.736) (-1470.304) * (-1471.110) (-1470.313) [-1472.798] (-1474.191) -- 0:00:55
      225000 -- (-1471.502) (-1473.800) [-1471.326] (-1469.057) * (-1474.295) [-1470.254] (-1469.968) (-1475.504) -- 0:00:55

      Average standard deviation of split frequencies: 0.011936

      225500 -- (-1474.943) (-1478.399) [-1470.962] (-1471.206) * (-1473.286) (-1469.245) [-1472.808] (-1479.632) -- 0:00:54
      226000 -- (-1473.375) (-1480.974) (-1471.690) [-1474.534] * (-1472.762) (-1472.197) [-1473.414] (-1470.284) -- 0:00:54
      226500 -- (-1471.829) (-1478.232) (-1475.828) [-1472.709] * [-1473.461] (-1471.777) (-1472.064) (-1477.536) -- 0:00:54
      227000 -- [-1472.224] (-1472.968) (-1473.127) (-1470.591) * (-1474.726) [-1472.188] (-1473.762) (-1476.113) -- 0:00:54
      227500 -- (-1474.173) (-1474.157) (-1473.445) [-1474.023] * (-1475.686) [-1471.499] (-1470.709) (-1475.901) -- 0:00:54
      228000 -- (-1472.001) (-1473.356) (-1474.772) [-1475.568] * (-1473.343) (-1470.788) [-1469.730] (-1475.732) -- 0:00:54
      228500 -- (-1470.568) (-1474.129) [-1471.667] (-1474.024) * (-1474.364) (-1473.859) [-1469.668] (-1472.703) -- 0:00:54
      229000 -- (-1469.296) (-1474.534) [-1472.242] (-1471.981) * (-1473.739) (-1472.134) [-1472.485] (-1470.966) -- 0:00:53
      229500 -- [-1470.431] (-1473.635) (-1473.100) (-1473.021) * (-1474.985) (-1471.644) (-1473.247) [-1469.529] -- 0:00:53
      230000 -- (-1471.304) (-1473.133) [-1471.239] (-1485.804) * (-1475.456) (-1471.151) (-1473.025) [-1470.408] -- 0:00:53

      Average standard deviation of split frequencies: 0.012035

      230500 -- (-1471.146) (-1472.597) (-1473.143) [-1472.281] * (-1476.214) [-1472.145] (-1469.249) (-1474.934) -- 0:00:53
      231000 -- [-1470.158] (-1472.257) (-1476.310) (-1472.518) * (-1472.848) (-1470.657) (-1475.883) [-1474.356] -- 0:00:53
      231500 -- (-1470.851) (-1470.671) [-1475.687] (-1474.325) * [-1472.742] (-1471.933) (-1471.891) (-1472.313) -- 0:00:53
      232000 -- (-1470.750) (-1470.736) (-1473.257) [-1474.579] * (-1470.157) (-1472.544) (-1471.157) [-1470.413] -- 0:00:56
      232500 -- (-1474.294) (-1474.874) [-1471.000] (-1470.933) * [-1471.501] (-1473.963) (-1470.276) (-1470.980) -- 0:00:56
      233000 -- (-1471.412) (-1473.507) (-1481.535) [-1469.957] * (-1472.344) (-1477.646) [-1472.899] (-1470.081) -- 0:00:55
      233500 -- (-1470.123) [-1468.976] (-1475.809) (-1471.425) * (-1472.173) (-1472.341) (-1472.286) [-1470.803] -- 0:00:55
      234000 -- (-1469.368) (-1472.788) [-1474.580] (-1473.405) * (-1471.709) (-1472.110) (-1470.784) [-1468.957] -- 0:00:55
      234500 -- [-1469.996] (-1475.162) (-1473.748) (-1472.737) * [-1469.000] (-1469.765) (-1472.222) (-1476.184) -- 0:00:55
      235000 -- (-1471.870) [-1475.518] (-1472.179) (-1473.030) * (-1471.772) (-1472.505) (-1470.487) [-1470.772] -- 0:00:55

      Average standard deviation of split frequencies: 0.012337

      235500 -- (-1472.472) [-1474.632] (-1472.805) (-1472.621) * [-1472.118] (-1472.902) (-1471.224) (-1473.635) -- 0:00:55
      236000 -- [-1473.903] (-1473.284) (-1470.607) (-1474.736) * (-1472.060) [-1470.311] (-1470.522) (-1472.530) -- 0:00:55
      236500 -- [-1474.477] (-1475.901) (-1469.704) (-1471.137) * (-1476.694) [-1472.625] (-1475.958) (-1472.837) -- 0:00:54
      237000 -- [-1474.447] (-1472.886) (-1474.968) (-1473.238) * [-1471.229] (-1472.844) (-1474.499) (-1472.225) -- 0:00:54
      237500 -- (-1471.151) (-1471.360) [-1469.690] (-1473.012) * [-1473.289] (-1471.740) (-1475.098) (-1472.136) -- 0:00:54
      238000 -- [-1471.538] (-1472.034) (-1473.431) (-1472.632) * (-1469.561) (-1470.859) (-1473.238) [-1472.577] -- 0:00:54
      238500 -- [-1470.418] (-1473.191) (-1470.675) (-1474.572) * (-1470.061) (-1471.187) (-1472.945) [-1468.587] -- 0:00:54
      239000 -- (-1472.493) (-1472.329) [-1472.328] (-1473.001) * (-1473.192) (-1473.408) (-1471.356) [-1471.922] -- 0:00:54
      239500 -- (-1473.767) [-1471.980] (-1475.100) (-1474.758) * [-1476.876] (-1474.015) (-1471.847) (-1470.908) -- 0:00:53
      240000 -- (-1470.956) (-1474.560) [-1469.568] (-1472.204) * (-1475.968) [-1473.215] (-1473.840) (-1471.257) -- 0:00:53

      Average standard deviation of split frequencies: 0.011868

      240500 -- (-1472.136) (-1472.340) [-1469.737] (-1470.310) * [-1474.879] (-1474.722) (-1473.673) (-1473.224) -- 0:00:53
      241000 -- (-1473.757) [-1474.436] (-1472.845) (-1472.714) * (-1473.147) [-1471.452] (-1474.145) (-1472.504) -- 0:00:53
      241500 -- [-1472.424] (-1472.742) (-1472.321) (-1471.237) * (-1470.587) (-1471.794) [-1472.186] (-1472.911) -- 0:00:53
      242000 -- (-1475.019) (-1474.182) [-1473.230] (-1471.945) * (-1474.911) [-1471.651] (-1472.516) (-1470.739) -- 0:00:53
      242500 -- (-1472.769) (-1474.163) [-1474.716] (-1471.611) * [-1475.047] (-1473.585) (-1472.607) (-1470.501) -- 0:00:53
      243000 -- (-1472.975) [-1472.006] (-1471.429) (-1474.485) * [-1470.605] (-1475.738) (-1472.891) (-1469.293) -- 0:00:52
      243500 -- [-1471.476] (-1471.876) (-1471.544) (-1473.016) * [-1471.759] (-1474.602) (-1476.325) (-1475.158) -- 0:00:52
      244000 -- [-1472.287] (-1471.763) (-1471.531) (-1473.497) * (-1470.422) (-1475.506) (-1470.736) [-1473.835] -- 0:00:52
      244500 -- (-1474.055) (-1474.749) [-1470.446] (-1471.057) * (-1470.146) (-1474.216) [-1474.263] (-1470.102) -- 0:00:52
      245000 -- (-1473.591) (-1476.183) [-1470.419] (-1474.750) * (-1472.497) [-1473.910] (-1471.425) (-1471.240) -- 0:00:52

      Average standard deviation of split frequencies: 0.011178

      245500 -- (-1470.662) (-1475.793) [-1469.960] (-1474.768) * (-1469.199) [-1473.566] (-1471.502) (-1472.337) -- 0:00:52
      246000 -- (-1470.977) (-1474.923) [-1470.733] (-1470.238) * (-1474.745) (-1471.175) [-1471.080] (-1476.762) -- 0:00:52
      246500 -- (-1471.775) (-1474.511) (-1470.711) [-1470.969] * (-1468.733) (-1471.995) [-1471.294] (-1474.359) -- 0:00:55
      247000 -- [-1470.830] (-1474.416) (-1469.218) (-1473.823) * [-1472.063] (-1472.263) (-1473.146) (-1474.646) -- 0:00:54
      247500 -- (-1471.222) [-1478.036] (-1469.744) (-1470.663) * (-1473.752) (-1473.147) [-1470.816] (-1472.567) -- 0:00:54
      248000 -- (-1471.256) (-1474.977) (-1470.376) [-1470.377] * (-1471.000) [-1473.427] (-1472.878) (-1472.070) -- 0:00:54
      248500 -- [-1473.060] (-1472.913) (-1471.203) (-1474.764) * [-1473.114] (-1475.126) (-1474.648) (-1470.121) -- 0:00:54
      249000 -- (-1470.858) (-1472.453) (-1471.467) [-1475.072] * (-1470.437) (-1475.271) [-1471.224] (-1473.750) -- 0:00:54
      249500 -- (-1471.794) [-1473.579] (-1470.981) (-1470.542) * (-1470.298) [-1474.216] (-1473.523) (-1473.187) -- 0:00:54
      250000 -- (-1471.783) (-1473.167) (-1474.475) [-1471.895] * (-1472.014) (-1478.311) (-1473.395) [-1469.436] -- 0:00:54

      Average standard deviation of split frequencies: 0.010761

      250500 -- [-1471.005] (-1476.537) (-1470.634) (-1470.231) * [-1468.885] (-1473.024) (-1471.364) (-1470.043) -- 0:00:53
      251000 -- [-1469.827] (-1479.122) (-1470.151) (-1472.057) * (-1470.886) (-1471.861) [-1475.683] (-1469.463) -- 0:00:53
      251500 -- (-1468.877) [-1472.513] (-1470.276) (-1472.522) * (-1471.989) [-1469.599] (-1473.846) (-1470.054) -- 0:00:53
      252000 -- [-1469.888] (-1471.649) (-1471.898) (-1474.174) * (-1473.154) (-1474.197) (-1470.996) [-1472.234] -- 0:00:53
      252500 -- [-1471.672] (-1472.227) (-1472.318) (-1476.499) * (-1471.345) (-1473.900) (-1471.069) [-1475.130] -- 0:00:53
      253000 -- [-1470.608] (-1474.985) (-1472.746) (-1475.750) * (-1470.547) [-1471.453] (-1474.004) (-1472.163) -- 0:00:53
      253500 -- [-1469.747] (-1474.678) (-1471.428) (-1474.598) * (-1468.623) (-1474.449) [-1471.686] (-1471.928) -- 0:00:53
      254000 -- [-1471.047] (-1473.819) (-1472.198) (-1474.953) * (-1469.540) (-1471.307) [-1469.975] (-1474.934) -- 0:00:52
      254500 -- (-1472.430) (-1478.259) (-1471.157) [-1475.136] * (-1471.736) (-1474.305) (-1469.875) [-1470.554] -- 0:00:52
      255000 -- (-1470.123) (-1475.181) (-1470.069) [-1475.712] * [-1473.505] (-1474.507) (-1476.373) (-1474.139) -- 0:00:52

      Average standard deviation of split frequencies: 0.010128

      255500 -- [-1470.706] (-1474.399) (-1471.246) (-1472.136) * (-1471.191) [-1473.058] (-1471.900) (-1471.658) -- 0:00:52
      256000 -- [-1470.351] (-1473.637) (-1469.459) (-1472.627) * (-1469.172) (-1471.137) [-1478.625] (-1470.400) -- 0:00:52
      256500 -- (-1472.575) (-1475.729) [-1472.175] (-1471.837) * (-1472.646) (-1472.636) (-1472.536) [-1470.846] -- 0:00:52
      257000 -- (-1472.136) (-1473.683) [-1473.128] (-1472.200) * [-1468.812] (-1474.955) (-1473.482) (-1472.453) -- 0:00:52
      257500 -- (-1472.473) (-1471.295) [-1474.293] (-1472.320) * [-1470.476] (-1473.212) (-1477.311) (-1471.340) -- 0:00:51
      258000 -- (-1473.242) [-1472.942] (-1472.774) (-1473.947) * (-1473.068) [-1472.420] (-1471.397) (-1472.485) -- 0:00:51
      258500 -- (-1470.727) [-1469.562] (-1473.102) (-1473.881) * [-1468.026] (-1471.508) (-1471.957) (-1473.630) -- 0:00:51
      259000 -- (-1472.619) [-1471.826] (-1476.754) (-1473.414) * (-1471.265) [-1472.365] (-1471.316) (-1472.283) -- 0:00:51
      259500 -- (-1475.452) (-1473.189) [-1471.767] (-1473.706) * [-1469.524] (-1473.803) (-1468.886) (-1471.235) -- 0:00:51
      260000 -- (-1471.611) (-1472.449) (-1474.844) [-1474.620] * (-1470.745) (-1472.596) (-1471.552) [-1471.362] -- 0:00:51

      Average standard deviation of split frequencies: 0.009645

      260500 -- (-1474.254) [-1473.669] (-1475.382) (-1471.470) * [-1471.355] (-1474.502) (-1469.590) (-1475.055) -- 0:00:51
      261000 -- (-1475.659) [-1473.188] (-1474.546) (-1474.112) * (-1473.375) [-1477.312] (-1473.310) (-1471.747) -- 0:00:53
      261500 -- [-1473.158] (-1471.611) (-1474.347) (-1471.804) * [-1474.164] (-1477.837) (-1476.986) (-1473.078) -- 0:00:53
      262000 -- (-1475.074) [-1471.661] (-1469.713) (-1475.053) * (-1475.582) (-1473.961) (-1469.851) [-1471.410] -- 0:00:53
      262500 -- (-1473.832) (-1471.063) (-1475.363) [-1477.257] * [-1472.170] (-1473.509) (-1469.539) (-1472.631) -- 0:00:53
      263000 -- (-1471.398) (-1471.432) (-1471.168) [-1475.120] * [-1469.880] (-1471.868) (-1474.874) (-1472.358) -- 0:00:53
      263500 -- (-1473.566) (-1471.225) [-1469.460] (-1476.759) * [-1470.011] (-1471.640) (-1473.326) (-1469.431) -- 0:00:53
      264000 -- (-1477.541) (-1470.259) [-1474.006] (-1474.095) * (-1470.278) (-1473.286) [-1475.312] (-1472.103) -- 0:00:52
      264500 -- (-1473.731) (-1473.287) (-1470.920) [-1472.294] * (-1471.268) (-1471.660) [-1471.561] (-1472.357) -- 0:00:52
      265000 -- [-1471.262] (-1470.056) (-1471.329) (-1477.548) * (-1474.120) [-1474.188] (-1475.593) (-1471.555) -- 0:00:52

      Average standard deviation of split frequencies: 0.008369

      265500 -- [-1471.746] (-1471.445) (-1471.341) (-1474.235) * [-1471.399] (-1477.657) (-1471.902) (-1471.442) -- 0:00:52
      266000 -- (-1471.655) (-1473.305) (-1476.171) [-1470.907] * [-1473.780] (-1476.929) (-1469.771) (-1473.070) -- 0:00:52
      266500 -- (-1472.612) (-1474.652) [-1468.686] (-1471.205) * [-1472.839] (-1476.295) (-1472.371) (-1469.819) -- 0:00:52
      267000 -- (-1471.503) (-1472.875) (-1470.070) [-1470.349] * (-1472.033) [-1473.240] (-1480.546) (-1474.077) -- 0:00:52
      267500 -- [-1477.688] (-1472.618) (-1469.954) (-1473.762) * (-1472.134) [-1472.417] (-1473.599) (-1473.210) -- 0:00:52
      268000 -- (-1476.229) (-1475.368) (-1471.176) [-1472.093] * [-1472.399] (-1473.803) (-1474.334) (-1470.643) -- 0:00:51
      268500 -- (-1472.144) (-1473.717) (-1469.339) [-1471.805] * [-1472.269] (-1472.778) (-1474.677) (-1471.371) -- 0:00:51
      269000 -- (-1472.131) (-1473.494) [-1473.194] (-1472.287) * (-1473.094) (-1473.517) (-1479.383) [-1470.289] -- 0:00:51
      269500 -- (-1476.817) (-1477.613) [-1471.335] (-1471.182) * [-1472.604] (-1471.386) (-1474.734) (-1470.425) -- 0:00:51
      270000 -- (-1474.063) [-1472.364] (-1472.604) (-1473.403) * (-1475.935) [-1476.211] (-1474.826) (-1470.352) -- 0:00:51

      Average standard deviation of split frequencies: 0.009095

      270500 -- (-1475.425) (-1472.831) (-1472.790) [-1471.436] * [-1474.503] (-1474.782) (-1471.742) (-1472.608) -- 0:00:51
      271000 -- (-1470.069) (-1471.110) (-1470.859) [-1471.399] * (-1472.227) (-1476.322) [-1471.837] (-1472.269) -- 0:00:51
      271500 -- [-1470.223] (-1471.766) (-1468.678) (-1471.612) * (-1472.705) [-1474.203] (-1471.957) (-1476.293) -- 0:00:50
      272000 -- [-1470.465] (-1471.814) (-1470.565) (-1475.065) * (-1471.519) (-1474.695) [-1475.163] (-1471.514) -- 0:00:50
      272500 -- (-1473.467) [-1471.159] (-1473.061) (-1474.135) * (-1473.908) [-1472.915] (-1472.184) (-1474.276) -- 0:00:50
      273000 -- (-1473.387) (-1477.023) [-1472.443] (-1472.170) * (-1475.463) [-1473.230] (-1471.895) (-1472.795) -- 0:00:50
      273500 -- (-1471.170) (-1474.972) [-1472.268] (-1473.549) * (-1481.222) [-1472.567] (-1472.381) (-1472.524) -- 0:00:50
      274000 -- (-1471.812) (-1479.898) [-1470.504] (-1472.032) * [-1473.032] (-1473.203) (-1471.183) (-1472.547) -- 0:00:50
      274500 -- (-1470.740) (-1480.617) (-1471.934) [-1472.964] * (-1476.940) (-1474.302) [-1471.496] (-1469.733) -- 0:00:50
      275000 -- (-1472.215) (-1473.798) (-1469.459) [-1474.935] * [-1473.860] (-1473.330) (-1473.697) (-1472.755) -- 0:00:50

      Average standard deviation of split frequencies: 0.009489

      275500 -- (-1471.837) (-1474.812) (-1469.515) [-1475.863] * [-1473.805] (-1472.988) (-1472.786) (-1473.403) -- 0:00:49
      276000 -- (-1469.937) (-1473.920) (-1471.999) [-1472.817] * (-1474.088) (-1477.438) [-1472.168] (-1472.502) -- 0:00:52
      276500 -- (-1471.197) [-1475.144] (-1468.839) (-1474.223) * (-1472.504) (-1475.218) (-1474.594) [-1471.864] -- 0:00:52
      277000 -- (-1474.662) (-1472.620) (-1475.185) [-1470.999] * [-1473.379] (-1473.255) (-1476.301) (-1471.316) -- 0:00:52
      277500 -- (-1473.473) (-1479.106) (-1473.944) [-1470.381] * (-1472.349) [-1474.467] (-1472.723) (-1473.509) -- 0:00:52
      278000 -- (-1472.126) (-1473.455) (-1471.376) [-1468.177] * (-1474.269) (-1469.531) (-1472.881) [-1470.864] -- 0:00:51
      278500 -- [-1472.908] (-1476.658) (-1472.708) (-1471.708) * [-1475.297] (-1476.197) (-1472.746) (-1472.237) -- 0:00:51
      279000 -- (-1471.137) [-1473.578] (-1475.460) (-1470.381) * [-1472.688] (-1471.024) (-1472.325) (-1472.677) -- 0:00:51
      279500 -- [-1471.363] (-1474.387) (-1470.458) (-1472.269) * (-1472.502) (-1475.298) [-1473.503] (-1473.844) -- 0:00:51
      280000 -- (-1471.571) (-1471.382) (-1472.999) [-1473.767] * (-1472.901) [-1473.482] (-1473.387) (-1471.279) -- 0:00:51

      Average standard deviation of split frequencies: 0.009704

      280500 -- (-1473.902) (-1472.273) (-1472.752) [-1472.399] * [-1471.903] (-1476.451) (-1472.725) (-1472.301) -- 0:00:51
      281000 -- (-1472.147) (-1473.655) (-1476.009) [-1475.551] * [-1470.574] (-1471.649) (-1471.619) (-1474.185) -- 0:00:51
      281500 -- (-1472.830) (-1472.222) [-1469.138] (-1475.783) * [-1473.597] (-1475.129) (-1473.433) (-1469.805) -- 0:00:51
      282000 -- (-1475.062) (-1477.999) (-1469.466) [-1472.121] * (-1474.937) (-1473.579) (-1474.850) [-1470.035] -- 0:00:50
      282500 -- (-1471.409) [-1470.952] (-1471.142) (-1471.073) * (-1473.578) [-1474.929] (-1473.462) (-1473.051) -- 0:00:50
      283000 -- [-1472.629] (-1474.856) (-1471.404) (-1474.186) * [-1471.627] (-1475.637) (-1470.685) (-1473.725) -- 0:00:50
      283500 -- (-1470.377) [-1470.318] (-1475.252) (-1471.969) * (-1472.514) (-1476.494) [-1478.690] (-1475.393) -- 0:00:50
      284000 -- (-1471.119) (-1472.691) [-1471.724] (-1472.422) * (-1472.939) [-1471.741] (-1471.222) (-1474.326) -- 0:00:50
      284500 -- (-1470.559) (-1472.540) (-1472.502) [-1470.321] * [-1471.326] (-1477.832) (-1477.991) (-1476.238) -- 0:00:50
      285000 -- (-1474.656) (-1472.091) [-1471.533] (-1471.005) * (-1475.801) [-1475.156] (-1475.842) (-1472.810) -- 0:00:50

      Average standard deviation of split frequencies: 0.010805

      285500 -- [-1473.744] (-1473.241) (-1471.057) (-1472.910) * (-1475.302) (-1474.121) [-1473.375] (-1471.617) -- 0:00:50
      286000 -- (-1471.051) (-1473.319) (-1471.714) [-1473.606] * (-1476.243) (-1472.157) (-1473.928) [-1471.679] -- 0:00:49
      286500 -- (-1475.412) [-1477.133] (-1471.747) (-1472.832) * (-1471.071) (-1472.993) (-1472.994) [-1470.088] -- 0:00:49
      287000 -- (-1473.190) (-1475.077) [-1472.353] (-1476.107) * (-1470.902) (-1473.005) (-1473.588) [-1474.811] -- 0:00:49
      287500 -- (-1470.437) (-1473.209) [-1472.673] (-1478.216) * (-1472.986) [-1471.610] (-1475.716) (-1472.894) -- 0:00:49
      288000 -- [-1470.437] (-1472.809) (-1470.082) (-1472.127) * (-1470.307) [-1475.811] (-1473.374) (-1473.642) -- 0:00:49
      288500 -- (-1471.131) (-1473.341) (-1469.414) [-1471.953] * (-1472.631) (-1473.785) (-1473.719) [-1476.086] -- 0:00:49
      289000 -- (-1469.150) [-1475.742] (-1470.318) (-1473.121) * [-1471.277] (-1471.932) (-1473.492) (-1472.851) -- 0:00:49
      289500 -- (-1471.686) [-1470.409] (-1471.440) (-1475.472) * [-1473.960] (-1472.033) (-1473.393) (-1471.392) -- 0:00:49
      290000 -- (-1474.190) (-1470.913) [-1471.036] (-1472.775) * [-1472.540] (-1472.078) (-1472.349) (-1473.421) -- 0:00:48

      Average standard deviation of split frequencies: 0.010399

      290500 -- (-1471.691) (-1474.352) (-1472.861) [-1474.132] * [-1472.235] (-1476.050) (-1471.486) (-1473.242) -- 0:00:48
      291000 -- (-1476.379) (-1475.045) (-1472.726) [-1472.256] * (-1474.471) [-1472.344] (-1476.213) (-1473.961) -- 0:00:51
      291500 -- (-1472.713) (-1474.462) [-1473.186] (-1477.949) * (-1474.441) (-1473.643) [-1473.924] (-1472.382) -- 0:00:51
      292000 -- (-1473.773) (-1473.892) (-1473.933) [-1473.389] * [-1471.412] (-1475.749) (-1472.770) (-1472.366) -- 0:00:50
      292500 -- [-1475.847] (-1472.073) (-1473.763) (-1477.079) * (-1474.107) (-1476.887) [-1476.113] (-1473.989) -- 0:00:50
      293000 -- [-1472.152] (-1470.170) (-1472.773) (-1475.021) * [-1472.812] (-1471.290) (-1471.488) (-1473.612) -- 0:00:50
      293500 -- (-1473.619) (-1472.591) (-1470.902) [-1474.134] * (-1472.460) (-1474.506) [-1471.759] (-1475.503) -- 0:00:50
      294000 -- (-1474.784) (-1470.474) (-1470.698) [-1471.570] * (-1474.150) (-1474.105) (-1471.331) [-1475.309] -- 0:00:50
      294500 -- (-1473.898) (-1473.411) (-1476.496) [-1472.770] * (-1475.927) (-1474.390) [-1470.545] (-1472.403) -- 0:00:50
      295000 -- (-1472.391) [-1473.607] (-1473.020) (-1474.489) * [-1474.007] (-1473.204) (-1470.153) (-1473.825) -- 0:00:50

      Average standard deviation of split frequencies: 0.008582

      295500 -- (-1471.279) (-1472.945) (-1472.734) [-1474.930] * [-1473.597] (-1475.339) (-1474.864) (-1474.526) -- 0:00:50
      296000 -- (-1474.600) [-1476.152] (-1473.110) (-1480.029) * (-1473.996) [-1474.200] (-1473.084) (-1469.893) -- 0:00:49
      296500 -- (-1472.893) (-1472.403) [-1470.437] (-1471.186) * [-1476.529] (-1478.049) (-1470.627) (-1474.506) -- 0:00:49
      297000 -- (-1473.326) (-1472.808) [-1470.602] (-1473.335) * (-1473.369) (-1472.379) (-1471.398) [-1473.661] -- 0:00:49
      297500 -- (-1473.700) (-1472.502) [-1469.663] (-1471.758) * [-1475.368] (-1473.767) (-1474.440) (-1474.250) -- 0:00:49
      298000 -- (-1471.206) (-1472.697) [-1470.146] (-1472.825) * [-1473.845] (-1472.192) (-1472.503) (-1472.501) -- 0:00:49
      298500 -- [-1470.175] (-1472.930) (-1469.069) (-1473.378) * (-1472.463) [-1474.791] (-1472.966) (-1474.107) -- 0:00:49
      299000 -- (-1470.136) (-1471.640) (-1470.350) [-1476.820] * (-1475.002) (-1471.231) [-1474.255] (-1472.910) -- 0:00:49
      299500 -- (-1471.286) [-1469.963] (-1470.573) (-1475.922) * [-1473.739] (-1472.877) (-1470.264) (-1475.311) -- 0:00:49
      300000 -- (-1469.514) [-1474.016] (-1471.554) (-1474.533) * (-1472.934) [-1469.737] (-1473.765) (-1472.461) -- 0:00:48

      Average standard deviation of split frequencies: 0.009309

      300500 -- (-1470.570) (-1472.826) (-1469.285) [-1470.640] * [-1470.524] (-1470.756) (-1477.390) (-1476.222) -- 0:00:48
      301000 -- (-1472.296) (-1472.317) [-1470.071] (-1474.461) * [-1472.143] (-1469.343) (-1473.942) (-1471.708) -- 0:00:48
      301500 -- (-1472.910) (-1475.154) (-1472.045) [-1471.397] * (-1471.690) [-1473.872] (-1477.137) (-1471.111) -- 0:00:48
      302000 -- (-1472.837) (-1473.871) (-1470.452) [-1473.568] * (-1472.417) (-1472.534) (-1473.192) [-1473.443] -- 0:00:48
      302500 -- (-1470.891) (-1473.449) (-1472.297) [-1472.005] * [-1470.716] (-1473.612) (-1472.248) (-1472.267) -- 0:00:48
      303000 -- (-1474.016) (-1470.694) [-1472.666] (-1475.377) * (-1471.220) (-1470.835) (-1474.144) [-1469.365] -- 0:00:48
      303500 -- (-1482.508) [-1473.499] (-1471.676) (-1471.531) * (-1471.634) [-1471.582] (-1470.446) (-1474.340) -- 0:00:48
      304000 -- (-1471.917) (-1476.229) (-1469.949) [-1470.738] * (-1469.702) [-1470.735] (-1474.536) (-1473.216) -- 0:00:48
      304500 -- (-1472.568) [-1474.276] (-1470.906) (-1475.564) * [-1473.459] (-1474.447) (-1472.423) (-1473.832) -- 0:00:47
      305000 -- (-1472.012) (-1474.727) [-1471.266] (-1472.986) * (-1471.886) (-1470.483) (-1476.588) [-1473.892] -- 0:00:47

      Average standard deviation of split frequencies: 0.008901

      305500 -- [-1472.281] (-1474.137) (-1473.858) (-1471.325) * [-1473.933] (-1468.719) (-1476.202) (-1471.370) -- 0:00:50
      306000 -- (-1471.605) (-1471.597) [-1473.336] (-1470.896) * (-1472.960) (-1470.575) (-1471.331) [-1474.390] -- 0:00:49
      306500 -- (-1476.196) (-1472.319) (-1471.024) [-1470.643] * (-1473.498) (-1472.300) (-1481.426) [-1470.620] -- 0:00:49
      307000 -- (-1470.666) (-1473.172) [-1473.369] (-1471.778) * (-1472.679) (-1473.124) [-1474.673] (-1470.111) -- 0:00:49
      307500 -- [-1474.835] (-1473.262) (-1475.381) (-1472.549) * (-1473.544) [-1473.129] (-1473.622) (-1470.067) -- 0:00:49
      308000 -- (-1475.557) (-1472.782) (-1469.887) [-1474.287] * (-1471.825) (-1475.654) (-1477.051) [-1471.530] -- 0:00:49
      308500 -- (-1473.012) (-1472.696) [-1469.417] (-1473.835) * (-1472.326) (-1476.274) [-1474.235] (-1473.730) -- 0:00:49
      309000 -- (-1472.976) (-1475.546) [-1470.643] (-1475.264) * (-1470.996) (-1475.493) [-1474.334] (-1476.743) -- 0:00:49
      309500 -- (-1471.676) (-1471.658) [-1474.204] (-1476.509) * (-1469.979) (-1473.429) (-1474.937) [-1472.928] -- 0:00:49
      310000 -- [-1472.133] (-1471.249) (-1475.293) (-1471.806) * (-1473.809) (-1473.644) [-1475.081] (-1472.236) -- 0:00:48

      Average standard deviation of split frequencies: 0.008156

      310500 -- (-1474.079) (-1473.896) (-1471.869) [-1476.673] * (-1471.091) (-1470.936) [-1476.644] (-1470.552) -- 0:00:48
      311000 -- (-1472.818) (-1470.871) [-1470.412] (-1473.359) * (-1474.822) [-1471.156] (-1476.383) (-1471.167) -- 0:00:48
      311500 -- (-1473.904) (-1472.222) [-1470.825] (-1473.515) * (-1471.722) (-1472.506) [-1475.574] (-1472.846) -- 0:00:48
      312000 -- (-1472.679) (-1473.684) [-1474.164] (-1475.067) * (-1470.567) [-1469.139] (-1470.776) (-1472.241) -- 0:00:48
      312500 -- (-1476.370) [-1471.931] (-1471.210) (-1472.178) * (-1475.575) [-1471.147] (-1470.616) (-1471.069) -- 0:00:48
      313000 -- [-1476.755] (-1471.085) (-1471.430) (-1473.970) * (-1471.992) (-1471.046) (-1469.122) [-1473.185] -- 0:00:48
      313500 -- (-1476.076) (-1474.581) (-1472.148) [-1471.581] * (-1472.584) [-1475.959] (-1469.851) (-1469.402) -- 0:00:48
      314000 -- (-1471.181) [-1471.347] (-1469.068) (-1476.050) * (-1472.569) (-1472.631) [-1472.152] (-1472.288) -- 0:00:48
      314500 -- (-1472.984) (-1475.517) (-1475.030) [-1474.603] * (-1471.261) (-1470.941) [-1471.050] (-1469.452) -- 0:00:47
      315000 -- [-1471.896] (-1473.114) (-1474.597) (-1474.748) * (-1474.211) (-1472.094) [-1469.594] (-1470.906) -- 0:00:47

      Average standard deviation of split frequencies: 0.009044

      315500 -- (-1472.259) (-1471.806) [-1475.597] (-1474.554) * [-1474.588] (-1472.933) (-1472.861) (-1472.018) -- 0:00:47
      316000 -- (-1471.396) (-1473.639) [-1471.588] (-1472.389) * (-1477.481) [-1470.385] (-1472.237) (-1471.668) -- 0:00:47
      316500 -- (-1472.661) [-1469.724] (-1470.497) (-1472.699) * (-1473.224) [-1472.350] (-1473.288) (-1470.721) -- 0:00:47
      317000 -- (-1471.911) [-1469.654] (-1469.778) (-1475.150) * [-1471.076] (-1470.468) (-1474.164) (-1473.597) -- 0:00:47
      317500 -- (-1473.603) (-1471.408) [-1473.178] (-1473.066) * (-1474.571) (-1470.590) [-1471.837] (-1474.712) -- 0:00:47
      318000 -- (-1469.563) [-1471.029] (-1473.611) (-1472.053) * (-1472.530) (-1470.373) [-1472.096] (-1472.012) -- 0:00:47
      318500 -- (-1473.329) [-1472.823] (-1473.893) (-1472.173) * (-1471.771) (-1472.619) [-1473.182] (-1470.768) -- 0:00:47
      319000 -- (-1471.927) (-1475.810) (-1469.396) [-1472.490] * [-1470.799] (-1473.466) (-1470.646) (-1471.692) -- 0:00:46
      319500 -- (-1471.141) (-1471.891) [-1472.669] (-1474.328) * (-1470.486) (-1473.257) [-1474.115] (-1471.714) -- 0:00:46
      320000 -- (-1474.094) [-1473.196] (-1473.899) (-1471.969) * [-1472.176] (-1473.542) (-1471.465) (-1473.635) -- 0:00:46

      Average standard deviation of split frequencies: 0.009188

      320500 -- [-1474.425] (-1473.984) (-1469.782) (-1472.312) * (-1471.419) (-1473.633) (-1472.058) [-1473.348] -- 0:00:48
      321000 -- (-1472.877) (-1474.486) [-1472.743] (-1472.465) * (-1475.271) (-1475.840) [-1470.840] (-1473.130) -- 0:00:48
      321500 -- (-1469.713) (-1474.538) [-1472.224] (-1472.795) * (-1474.506) (-1473.769) [-1471.476] (-1471.641) -- 0:00:48
      322000 -- (-1472.134) [-1471.462] (-1475.332) (-1473.728) * (-1471.284) (-1471.440) (-1469.425) [-1474.005] -- 0:00:48
      322500 -- (-1471.420) (-1471.330) (-1476.041) [-1472.571] * [-1476.204] (-1471.266) (-1470.692) (-1474.723) -- 0:00:48
      323000 -- [-1476.177] (-1471.618) (-1474.641) (-1476.070) * [-1472.761] (-1472.735) (-1471.724) (-1474.616) -- 0:00:48
      323500 -- (-1473.263) (-1471.169) [-1471.777] (-1473.449) * [-1469.847] (-1470.738) (-1469.703) (-1474.164) -- 0:00:48
      324000 -- (-1473.335) [-1471.422] (-1470.158) (-1473.074) * (-1472.771) (-1474.502) (-1468.111) [-1470.577] -- 0:00:47
      324500 -- [-1470.031] (-1477.251) (-1471.844) (-1474.185) * (-1474.304) [-1472.455] (-1472.513) (-1473.869) -- 0:00:47
      325000 -- [-1472.234] (-1472.695) (-1471.506) (-1474.395) * (-1474.359) (-1471.492) (-1473.785) [-1469.689] -- 0:00:47

      Average standard deviation of split frequencies: 0.008336

      325500 -- (-1471.094) [-1469.435] (-1471.825) (-1471.906) * (-1473.542) (-1471.188) (-1471.852) [-1473.803] -- 0:00:47
      326000 -- (-1474.802) (-1470.634) [-1473.561] (-1472.546) * (-1472.634) [-1469.370] (-1472.044) (-1472.069) -- 0:00:47
      326500 -- (-1473.060) (-1469.918) (-1473.906) [-1473.485] * (-1472.504) [-1471.081] (-1470.171) (-1470.541) -- 0:00:47
      327000 -- (-1472.496) (-1472.662) (-1470.866) [-1471.225] * [-1474.458] (-1471.767) (-1473.345) (-1472.163) -- 0:00:47
      327500 -- [-1472.285] (-1471.026) (-1472.153) (-1470.363) * [-1473.245] (-1473.975) (-1472.258) (-1469.860) -- 0:00:47
      328000 -- (-1474.381) (-1472.176) [-1474.232] (-1472.670) * [-1474.881] (-1472.490) (-1472.940) (-1473.240) -- 0:00:47
      328500 -- (-1471.094) [-1470.076] (-1470.748) (-1473.420) * (-1473.523) (-1473.037) [-1472.018] (-1473.244) -- 0:00:47
      329000 -- (-1472.046) [-1476.831] (-1471.316) (-1474.299) * (-1475.416) (-1473.465) (-1470.701) [-1473.797] -- 0:00:46
      329500 -- (-1468.749) [-1477.714] (-1472.986) (-1474.160) * (-1473.338) (-1472.032) [-1472.851] (-1472.940) -- 0:00:46
      330000 -- [-1472.200] (-1476.670) (-1471.315) (-1472.931) * [-1473.888] (-1471.179) (-1469.971) (-1474.460) -- 0:00:46

      Average standard deviation of split frequencies: 0.008973

      330500 -- [-1472.654] (-1479.627) (-1473.632) (-1472.492) * (-1474.761) (-1472.073) [-1469.142] (-1474.118) -- 0:00:46
      331000 -- (-1473.113) [-1471.594] (-1482.177) (-1473.981) * (-1473.388) [-1472.630] (-1469.965) (-1472.012) -- 0:00:46
      331500 -- (-1473.145) (-1471.235) [-1475.728] (-1472.850) * [-1473.115] (-1471.431) (-1473.499) (-1472.486) -- 0:00:46
      332000 -- (-1473.670) (-1473.764) [-1474.163] (-1472.101) * [-1471.654] (-1471.551) (-1471.776) (-1471.480) -- 0:00:46
      332500 -- (-1472.435) (-1473.064) (-1474.294) [-1472.199] * (-1471.775) (-1472.885) [-1478.031] (-1473.114) -- 0:00:46
      333000 -- (-1472.605) [-1472.427] (-1472.772) (-1473.994) * (-1473.546) (-1471.500) [-1472.629] (-1474.055) -- 0:00:46
      333500 -- (-1472.302) (-1470.758) [-1473.197] (-1474.025) * (-1475.428) (-1470.104) [-1468.985] (-1471.220) -- 0:00:45
      334000 -- [-1472.136] (-1477.506) (-1474.792) (-1470.143) * (-1469.464) (-1481.441) [-1470.942] (-1469.844) -- 0:00:45
      334500 -- (-1471.212) (-1473.744) [-1471.799] (-1470.063) * (-1473.836) (-1473.345) [-1468.866] (-1473.378) -- 0:00:45
      335000 -- (-1472.566) (-1472.059) (-1471.928) [-1473.163] * (-1471.749) (-1474.610) (-1475.191) [-1470.615] -- 0:00:47

      Average standard deviation of split frequencies: 0.009733

      335500 -- [-1471.589] (-1474.554) (-1471.907) (-1474.026) * [-1473.103] (-1473.542) (-1472.343) (-1476.626) -- 0:00:47
      336000 -- [-1471.155] (-1479.110) (-1471.351) (-1473.415) * (-1475.156) [-1471.042] (-1472.373) (-1475.513) -- 0:00:47
      336500 -- (-1471.417) (-1472.491) (-1473.542) [-1471.544] * [-1473.271] (-1472.952) (-1476.786) (-1478.772) -- 0:00:47
      337000 -- (-1472.219) (-1474.523) [-1472.420] (-1474.121) * (-1478.317) (-1471.972) [-1475.725] (-1475.543) -- 0:00:47
      337500 -- (-1474.084) (-1475.417) (-1474.528) [-1473.316] * (-1475.159) (-1469.564) (-1470.307) [-1477.518] -- 0:00:47
      338000 -- (-1474.521) (-1476.938) [-1470.738] (-1474.396) * (-1473.073) [-1470.022] (-1471.013) (-1476.028) -- 0:00:47
      338500 -- [-1472.690] (-1474.122) (-1470.325) (-1472.597) * [-1474.222] (-1473.963) (-1473.603) (-1472.387) -- 0:00:46
      339000 -- (-1474.259) (-1472.314) [-1472.887] (-1470.859) * (-1476.640) (-1472.230) (-1473.963) [-1474.492] -- 0:00:46
      339500 -- (-1472.677) (-1469.849) [-1471.127] (-1472.733) * [-1473.330] (-1473.086) (-1478.508) (-1472.352) -- 0:00:46
      340000 -- (-1472.485) [-1472.665] (-1473.633) (-1476.258) * [-1474.768] (-1475.332) (-1472.803) (-1472.157) -- 0:00:46

      Average standard deviation of split frequencies: 0.010811

      340500 -- [-1473.489] (-1474.098) (-1476.663) (-1472.964) * (-1471.831) (-1472.483) [-1472.425] (-1471.938) -- 0:00:46
      341000 -- [-1474.205] (-1472.087) (-1475.782) (-1475.207) * (-1470.788) (-1471.368) (-1470.728) [-1472.845] -- 0:00:46
      341500 -- (-1473.143) [-1472.869] (-1475.431) (-1474.761) * (-1471.571) [-1470.590] (-1473.681) (-1474.401) -- 0:00:46
      342000 -- (-1472.704) [-1471.626] (-1474.312) (-1478.198) * (-1474.742) [-1474.022] (-1471.365) (-1474.448) -- 0:00:46
      342500 -- (-1476.819) [-1473.247] (-1470.762) (-1474.569) * (-1472.232) (-1481.727) (-1471.591) [-1471.418] -- 0:00:46
      343000 -- (-1482.750) (-1473.878) (-1471.301) [-1473.539] * [-1469.057] (-1474.519) (-1474.893) (-1471.705) -- 0:00:45
      343500 -- (-1474.808) (-1476.432) [-1472.554] (-1475.089) * (-1476.082) (-1472.570) [-1473.600] (-1472.154) -- 0:00:45
      344000 -- (-1472.125) [-1472.907] (-1471.195) (-1475.273) * (-1471.809) (-1469.548) [-1471.979] (-1472.285) -- 0:00:45
      344500 -- (-1474.382) (-1474.028) [-1474.487] (-1473.122) * (-1472.031) (-1474.448) [-1473.847] (-1472.034) -- 0:00:45
      345000 -- (-1473.770) (-1472.324) [-1471.585] (-1477.162) * (-1472.689) (-1469.866) (-1472.617) [-1471.229] -- 0:00:45

      Average standard deviation of split frequencies: 0.010559

      345500 -- [-1471.651] (-1474.943) (-1469.987) (-1475.422) * (-1474.063) [-1470.866] (-1471.746) (-1471.162) -- 0:00:45
      346000 -- (-1472.972) (-1474.623) (-1473.149) [-1474.835] * [-1471.803] (-1473.527) (-1472.753) (-1472.867) -- 0:00:45
      346500 -- [-1470.021] (-1474.597) (-1471.032) (-1475.061) * (-1475.241) (-1475.301) (-1472.094) [-1473.959] -- 0:00:45
      347000 -- (-1473.225) (-1473.138) [-1469.212] (-1474.024) * (-1473.431) (-1472.428) (-1473.035) [-1477.368] -- 0:00:45
      347500 -- (-1472.620) (-1472.309) [-1470.906] (-1472.336) * (-1473.668) [-1471.432] (-1471.168) (-1474.761) -- 0:00:45
      348000 -- (-1472.377) [-1473.327] (-1476.872) (-1475.848) * (-1475.272) (-1469.521) (-1471.122) [-1482.502] -- 0:00:44
      348500 -- (-1469.855) [-1471.442] (-1479.758) (-1476.117) * (-1473.376) (-1474.203) [-1472.538] (-1479.124) -- 0:00:44
      349000 -- (-1475.482) (-1472.308) (-1482.206) [-1479.530] * (-1469.542) [-1473.712] (-1473.756) (-1473.017) -- 0:00:44
      349500 -- (-1475.166) [-1472.542] (-1469.981) (-1473.315) * (-1470.561) (-1472.699) [-1472.608] (-1473.284) -- 0:00:44
      350000 -- [-1471.908] (-1473.280) (-1472.889) (-1473.942) * (-1472.298) [-1473.974] (-1474.089) (-1473.763) -- 0:00:46

      Average standard deviation of split frequencies: 0.010502

      350500 -- (-1471.012) [-1472.253] (-1474.710) (-1473.013) * (-1472.857) [-1473.592] (-1470.723) (-1473.328) -- 0:00:46
      351000 -- (-1471.606) [-1471.342] (-1473.405) (-1472.027) * [-1471.180] (-1472.018) (-1477.234) (-1472.412) -- 0:00:46
      351500 -- (-1473.285) [-1473.102] (-1474.446) (-1474.758) * [-1469.099] (-1473.255) (-1473.924) (-1473.216) -- 0:00:46
      352000 -- (-1471.189) [-1469.811] (-1469.929) (-1473.239) * [-1473.598] (-1473.563) (-1474.783) (-1473.860) -- 0:00:46
      352500 -- (-1470.367) (-1470.448) [-1470.281] (-1471.591) * [-1472.459] (-1472.459) (-1475.732) (-1471.771) -- 0:00:45
      353000 -- [-1469.657] (-1474.795) (-1473.025) (-1471.629) * (-1471.862) [-1470.224] (-1470.642) (-1470.659) -- 0:00:45
      353500 -- (-1470.506) [-1473.386] (-1471.490) (-1471.773) * (-1470.796) (-1470.725) (-1471.062) [-1471.863] -- 0:00:45
      354000 -- (-1471.149) [-1472.460] (-1471.634) (-1473.013) * (-1470.235) (-1470.054) (-1474.802) [-1470.578] -- 0:00:45
      354500 -- [-1476.112] (-1472.811) (-1469.833) (-1471.825) * [-1471.694] (-1472.204) (-1470.614) (-1473.124) -- 0:00:45
      355000 -- (-1470.324) (-1472.174) [-1470.886] (-1472.482) * [-1472.197] (-1471.312) (-1471.979) (-1472.994) -- 0:00:45

      Average standard deviation of split frequencies: 0.010428

      355500 -- (-1471.092) (-1476.750) [-1470.494] (-1473.114) * (-1471.150) (-1472.753) (-1474.238) [-1471.375] -- 0:00:45
      356000 -- (-1474.074) (-1474.176) (-1471.728) [-1471.101] * (-1470.468) [-1474.904] (-1471.684) (-1472.422) -- 0:00:45
      356500 -- (-1471.843) (-1473.843) [-1471.622] (-1470.816) * (-1472.079) (-1473.510) (-1470.527) [-1475.417] -- 0:00:45
      357000 -- [-1473.571] (-1473.426) (-1472.136) (-1471.772) * [-1471.362] (-1474.800) (-1472.740) (-1473.820) -- 0:00:45
      357500 -- (-1471.758) [-1471.613] (-1473.026) (-1473.392) * (-1470.526) (-1478.880) [-1474.761] (-1474.122) -- 0:00:44
      358000 -- [-1473.091] (-1473.079) (-1471.054) (-1471.558) * (-1474.081) (-1474.018) [-1475.619] (-1471.644) -- 0:00:44
      358500 -- [-1472.608] (-1475.692) (-1470.871) (-1482.905) * (-1475.814) (-1474.701) (-1472.639) [-1473.285] -- 0:00:44
      359000 -- (-1470.927) [-1473.599] (-1471.777) (-1483.285) * (-1470.485) (-1474.038) (-1477.282) [-1476.179] -- 0:00:44
      359500 -- (-1469.897) (-1475.997) [-1469.789] (-1481.099) * [-1469.362] (-1473.618) (-1472.745) (-1470.782) -- 0:00:44
      360000 -- [-1469.186] (-1472.576) (-1469.110) (-1471.468) * (-1472.078) [-1475.624] (-1473.914) (-1474.752) -- 0:00:44

      Average standard deviation of split frequencies: 0.010130

      360500 -- [-1471.762] (-1473.931) (-1481.399) (-1474.728) * (-1470.656) [-1475.111] (-1474.366) (-1473.814) -- 0:00:44
      361000 -- [-1469.588] (-1469.731) (-1473.159) (-1482.534) * (-1473.570) (-1475.533) (-1471.064) [-1469.866] -- 0:00:44
      361500 -- (-1475.819) (-1477.422) [-1474.145] (-1482.626) * (-1473.250) [-1472.743] (-1471.836) (-1470.506) -- 0:00:44
      362000 -- (-1472.863) [-1470.453] (-1470.780) (-1477.699) * (-1471.479) (-1473.401) [-1470.919] (-1469.704) -- 0:00:44
      362500 -- (-1473.118) [-1477.882] (-1472.224) (-1470.848) * (-1473.535) (-1476.219) (-1471.841) [-1470.046] -- 0:00:43
      363000 -- [-1468.855] (-1472.568) (-1472.664) (-1471.877) * (-1472.100) [-1473.460] (-1474.470) (-1472.079) -- 0:00:43
      363500 -- (-1470.081) [-1472.659] (-1471.207) (-1471.344) * (-1473.585) [-1473.193] (-1478.823) (-1472.567) -- 0:00:43
      364000 -- (-1476.963) (-1476.424) [-1472.712] (-1469.375) * [-1473.166] (-1472.540) (-1477.157) (-147